F464505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 334 | 543 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10766700|Ga0114129_107667002 |
| Length | 163 |
| Sequence | MSAPREPNCVNWEVDVALRYLHTMVRIGNIDASLDFYVKKLGMEEVRRVENEAGRYTLIFLAAPADKGRAASDRAPLLELTFNWDPEAYGEGRNFGHLAFEVDDIYATCERLMKSGVTINRPPRDGRMAFVRSPDNISIELLQKGASQPKQEPWASMPNTGKW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 4 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 5 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 6 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 7 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 8 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 9 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 10 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 11 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 12 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 13 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 14 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 15 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 16 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 17 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 18 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 19 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 20 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 21 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 27 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 28 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 331 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 332 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 333 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 334 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.77 |
| Metatranscriptomes | 0 |
| Isolates | 4.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 3 |
| Rhizoplane | 6.7 |
| Rhizosphere | 86.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1002332 | 3300001978 | Bacteria | 1536 |
| 2 | JGI24740J21852_10088030 | 3300001979 | Bacteria | 804 |
| 3 | JGI24739J22299_10009851 | 3300001989 | Bacteria | 3553 |
| 4 | JGI24743J22301_10018499 | 3300001991 | Bacteria | 1317 |
| 5 | JGI24738J21930_10012102 | 3300002075 | Bacteria | 1887 |
| 6 | JGI24744J21845_10020411 | 3300002077 | Bacteria | 1306 |
| 7 | JGI24035J26624_1040892 | 3300002126 | Bacteria | 518 |
| 8 | JGI25159J45721_1008703 | 3300002987 | Bacteria | 2763 |
| 9 | Ga0065165_1000139 | 3300005262 | Bacteria | 126209 |
| 10 | Ga0065712_10300798 | 3300005290 | Bacteria | 860 |
| 11 | Ga0065707_10962379 | 3300005295 | Bacteria | 549 |
| 12 | Ga0070658_10270085 | 3300005327 | Bacteria | 1446 |
| 13 | Ga0070676_10003658 | 3300005328 | Bacteria | 8050 |
| 14 | Ga0070683_100053092 | 3300005329 | Bacteria | 3756 |
| 15 | Ga0070690_100000438 | 3300005330 | Bacteria | 21088 |
| 16 | Ga0070670_100653297 | 3300005331 | Bacteria | 943 |
| 17 | Ga0070677_10554822 | 3300005333 | Bacteria | 630 |
| 18 | Ga0068869_100094424 | 3300005334 | Bacteria | 2255 |
| 19 | Ga0070666_10061379 | 3300005335 | Bacteria | 2545 |
| 20 | Ga0070680_100002037 | 3300005336 | Bacteria | 14916 |
| 21 | Ga0070680_100554916 | 3300005336 | Bacteria | 985 |
| 22 | Ga0070682_100000387 | 3300005337 | Bacteria | 29331 |
| 23 | Ga0068868_100017196 | 3300005338 | Bacteria | 5382 |
| 24 | Ga0070660_100000388 | 3300005339 | Bacteria | 29290 |
| 25 | Ga0070689_100001805 | 3300005340 | Bacteria | 13754 |
| 26 | Ga0070689_100978425 | 3300005340 | Bacteria | 752 |
| 27 | Ga0070691_10000292 | 3300005341 | Bacteria | 17472 |
| 28 | Ga0070687_100118921 | 3300005343 | Bacteria | 1508 |
| 29 | Ga0070661_100000689 | 3300005344 | Bacteria | 24833 |
| 30 | Ga0070692_10000219 | 3300005345 | Bacteria | 15626 |
| 31 | Ga0070692_10458368 | 3300005345 | Bacteria | 817 |
| 32 | Ga0070668_100037915 | 3300005347 | Bacteria | 3682 |
| 33 | Ga0070668_100337586 | 3300005347 | Bacteria | 1272 |
| 34 | Ga0070669_100008539 | 3300005353 | Bacteria | 7313 |
| 35 | Ga0070675_100019549 | 3300005354 | Bacteria | 5399 |
| 36 | Ga0070671_100005562 | 3300005355 | Bacteria | 10042 |
| 37 | Ga0070671_100614722 | 3300005355 | Bacteria | 939 |
| 38 | Ga0070674_100001254 | 3300005356 | Bacteria | 13338 |
| 39 | Ga0070673_100000261 | 3300005364 | Bacteria | 26911 |
| 40 | Ga0070673_101216782 | 3300005364 | Bacteria | 706 |
| 41 | Ga0070659_100000894 | 3300005366 | Bacteria | 21817 |
| 42 | Ga0070667_100000657 | 3300005367 | Bacteria | 33552 |
| 43 | Ga0070703_10009380 | 3300005406 | Bacteria | 2761 |
| 44 | Ga0070709_10002437 | 3300005434 | Bacteria | 10081 |
| 45 | Ga0070714_100002744 | 3300005435 | Bacteria | 12973 |
| 46 | Ga0070710_10002924 | 3300005437 | Bacteria | 8119 |
| 47 | Ga0070701_10001727 | 3300005438 | Bacteria | 8218 |
| 48 | Ga0070701_10141573 | 3300005438 | Bacteria | 1376 |
| 49 | Ga0070711_100002149 | 3300005439 | Bacteria | 11175 |
| 50 | Ga0070705_100002088 | 3300005440 | Bacteria | 10192 |
| 51 | Ga0070705_100248803 | 3300005440 | Bacteria | 1247 |
| 52 | Ga0070705_100868636 | 3300005440 | Bacteria | 723 |
| 53 | Ga0070700_100004756 | 3300005441 | Bacteria | 7123 |
| 54 | Ga0070694_100000328 | 3300005444 | Bacteria | 25571 |
| 55 | Ga0070694_100041056 | 3300005444 | Bacteria | 3084 |
| 56 | Ga0070663_100001791 | 3300005455 | Bacteria | 11959 |
| 57 | Ga0070663_100249266 | 3300005455 | Bacteria | 1405 |
| 58 | Ga0070663_101096451 | 3300005455 | Bacteria | 696 |
| 59 | Ga0070678_100000632 | 3300005456 | Bacteria | 17253 |
| 60 | Ga0070678_100918719 | 3300005456 | Bacteria | 801 |
| 61 | Ga0070662_100030650 | 3300005457 | Bacteria | 3766 |
| 62 | Ga0070662_100510186 | 3300005457 | Bacteria | 1004 |
| 63 | Ga0070662_100779817 | 3300005457 | Bacteria | 812 |
| 64 | Ga0068867_100011267 | 3300005459 | Bacteria | 6306 |
| 65 | Ga0068867_100149954 | 3300005459 | Bacteria | 1831 |
| 66 | Ga0068867_100731645 | 3300005459 | Bacteria | 876 |
| 67 | Ga0070685_10028185 | 3300005466 | Bacteria | 3110 |
| 68 | Ga0070698_100655715 | 3300005471 | Bacteria | 991 |
| 69 | Ga0070698_101164530 | 3300005471 | Bacteria | 720 |
| 70 | Ga0070699_100178330 | 3300005518 | Bacteria | 1885 |
| 71 | Ga0070679_100084846 | 3300005530 | Bacteria | 3154 |
| 72 | Ga0070679_100288615 | 3300005530 | Bacteria | 1592 |
| 73 | Ga0070679_100508922 | 3300005530 | Bacteria | 1148 |
| 74 | Ga0070684_100151109 | 3300005535 | Bacteria | 2104 |
| 75 | Ga0070697_100095855 | 3300005536 | Bacteria | 2461 |
| 76 | Ga0068853_100001286 | 3300005539 | Bacteria | 17997 |
| 77 | Ga0070672_100012128 | 3300005543 | Bacteria | 6035 |
| 78 | Ga0070686_100001964 | 3300005544 | Bacteria | 11415 |
| 79 | Ga0070695_100001555 | 3300005545 | Bacteria | 12802 |
| 80 | Ga0070695_100018457 | 3300005545 | Bacteria | 4236 |
| 81 | Ga0070695_100489524 | 3300005545 | Bacteria | 949 |
| 82 | Ga0070696_100004201 | 3300005546 | Bacteria | 9592 |
| 83 | Ga0070696_100132244 | 3300005546 | Bacteria | 1816 |
| 84 | Ga0070696_100150545 | 3300005546 | Bacteria | 1707 |
| 85 | Ga0070696_100643062 | 3300005546 | Bacteria | 859 |
| 86 | Ga0070693_100000155 | 3300005547 | Bacteria | 31196 |
| 87 | Ga0070665_100046043 | 3300005548 | Bacteria | 4382 |
| 88 | Ga0070665_100055541 | 3300005548 | Bacteria | 3971 |
| 89 | Ga0070665_100169639 | 3300005548 | Bacteria | 2184 |
| 90 | Ga0070704_100000688 | 3300005549 | Bacteria | 16380 |
| 91 | Ga0070704_100014300 | 3300005549 | Bacteria | 4955 |
| 92 | Ga0068855_100021777 | 3300005563 | Bacteria | 7687 |
| 93 | Ga0068855_100124728 | 3300005563 | Bacteria | 2945 |
| 94 | Ga0068855_100583639 | 3300005563 | Bacteria | 1207 |
| 95 | Ga0070664_100000700 | 3300005564 | Bacteria | 25609 |
| 96 | Ga0068857_100016875 | 3300005577 | Bacteria | 6397 |
| 97 | Ga0068857_100627953 | 3300005577 | Bacteria | 1017 |
| 98 | Ga0068854_100012167 | 3300005578 | Bacteria | 5631 |
| 99 | Ga0068856_100006465 | 3300005614 | Bacteria | 11493 |
| 100 | Ga0068856_100743527 | 3300005614 | Bacteria | 1001 |
| 101 | Ga0068856_100879724 | 3300005614 | Bacteria | 915 |
| 102 | Ga0070702_100000900 | 3300005615 | Bacteria | 11580 |
| 103 | Ga0070702_100580753 | 3300005615 | Bacteria | 837 |
| 104 | Ga0070702_100612316 | 3300005615 | Bacteria | 818 |
| 105 | Ga0068852_100003766 | 3300005616 | Bacteria | 10635 |
| 106 | Ga0068859_100003442 | 3300005617 | Bacteria | 16087 |
| 107 | Ga0068859_100079479 | 3300005617 | Bacteria | 3320 |
| 108 | Ga0068864_100040683 | 3300005618 | Bacteria | 3975 |
| 109 | Ga0068864_100176307 | 3300005618 | Bacteria | 1952 |
| 110 | Ga0068866_10006085 | 3300005718 | Bacteria | 5021 |
| 111 | Ga0068861_100002000 | 3300005719 | Bacteria | 13182 |
| 112 | Ga0068861_100239207 | 3300005719 | Bacteria | 1543 |
| 113 | Ga0068861_100370751 | 3300005719 | Bacteria | 1262 |
| 114 | Ga0068851_10009852 | 3300005834 | Bacteria | 4451 |
| 115 | Ga0068863_100003165 | 3300005841 | Bacteria | 16266 |
| 116 | Ga0068858_100003788 | 3300005842 | Bacteria | 14954 |
| 117 | Ga0068858_100112973 | 3300005842 | Bacteria | 2537 |
| 118 | Ga0068858_100267494 | 3300005842 | Bacteria | 1626 |
| 119 | Ga0068860_100011302 | 3300005843 | Bacteria | 8797 |
| 120 | Ga0068860_100041622 | 3300005843 | Bacteria | 4388 |
| 121 | Ga0068860_100588663 | 3300005843 | Bacteria | 1117 |
| 122 | Ga0068860_101508434 | 3300005843 | Bacteria | 694 |
| 123 | Ga0068862_100003901 | 3300005844 | Bacteria | 12673 |
| 124 | Ga0068862_100373264 | 3300005844 | Bacteria | 1328 |
| 125 | Ga0068862_101379218 | 3300005844 | Bacteria | 708 |
| 126 | Ga0075432_10004639 | 3300006058 | Bacteria | 4680 |
| 127 | Ga0070715_10000219 | 3300006163 | Bacteria | 13624 |
| 128 | Ga0070716_100001003 | 3300006173 | Bacteria | 12339 |
| 129 | Ga0070712_100000382 | 3300006175 | Bacteria | 25268 |
| 130 | Ga0097621_100074986 | 3300006237 | Bacteria | 2803 |
| 131 | Ga0068871_100036883 | 3300006358 | Bacteria | 3895 |
| 132 | Ga0075428_100005355 | 3300006844 | Bacteria | 14267 |
| 133 | Ga0075428_100025063 | 3300006844 | Bacteria | 6599 |
| 134 | Ga0075428_100048914 | 3300006844 | Bacteria | 4640 |
| 135 | Ga0075430_100113127 | 3300006846 | Bacteria | 2263 |
| 136 | Ga0075431_100020190 | 3300006847 | Bacteria | 6804 |
| 137 | Ga0075433_10023713 | 3300006852 | Bacteria | 5168 |
| 138 | Ga0075433_10071637 | 3300006852 | Bacteria | 3046 |
| 139 | Ga0075433_10577726 | 3300006852 | Bacteria | 987 |
| 140 | Ga0075433_10660214 | 3300006852 | Bacteria | 917 |
| 141 | Ga0075434_100000816 | 3300006871 | Bacteria | 24729 |
| 142 | Ga0075434_100228863 | 3300006871 | Bacteria | 1878 |
| 143 | Ga0075429_100066687 | 3300006880 | Bacteria | 3134 |
| 144 | Ga0068865_100001670 | 3300006881 | Bacteria | 12986 |
| 145 | Ga0075436_100010755 | 3300006914 | Bacteria | 6276 |
| 146 | Ga0097620_100003442 | 3300006931 | Bacteria | 16087 |
| 147 | Ga0097620_100079478 | 3300006931 | Bacteria | 3320 |
| 148 | Ga0075435_100013741 | 3300007076 | Bacteria | 6033 |
| 149 | Ga0075435_100296757 | 3300007076 | Bacteria | 1382 |
| 150 | Ga0075435_100630022 | 3300007076 | Bacteria | 930 |
| 151 | Ga0099795_10000277 | 3300007788 | Bacteria | 9160 |
| 152 | Ga0105251_10051940 | 3300009011 | Bacteria | 1953 |
| 153 | Ga0105250_10004911 | 3300009092 | Bacteria | 6076 |
| 154 | Ga0105240_10087353 | 3300009093 | Bacteria | 3819 |
| 155 | Ga0111539_10003231 | 3300009094 | Bacteria | 21556 |
| 156 | Ga0111539_10025839 | 3300009094 | Bacteria | 7190 |
| 157 | Ga0111539_10042888 | 3300009094 | Bacteria | 5428 |
| 158 | Ga0111539_10261458 | 3300009094 | Bacteria | 2015 |
| 159 | Ga0111539_11782060 | 3300009094 | Bacteria | 714 |
| 160 | Ga0111539_12934380 | 3300009094 | Bacteria | 552 |
| 161 | Ga0105245_10000729 | 3300009098 | Bacteria | 29644 |
| 162 | Ga0105245_10322741 | 3300009098 | Bacteria | 1522 |
| 163 | Ga0105245_10462571 | 3300009098 | Bacteria | 1279 |
| 164 | Ga0105245_10796714 | 3300009098 | Bacteria | 983 |
| 165 | Ga0105245_11049798 | 3300009098 | Bacteria | 860 |
| 166 | Ga0105247_10000684 | 3300009101 | Bacteria | 26726 |
| 167 | Ga0105247_10048586 | 3300009101 | Bacteria | 2606 |
| 168 | Ga0114129_10262815 | 3300009147 | Bacteria | 2312 |
| 169 | Ga0114129_10451995 | 3300009147 | Bacteria | 1685 |
| 170 | Ga0114129_10766700 | 3300009147 | Bacteria | 1234 |
| 171 | Ga0114129_12121847 | 3300009147 | Bacteria | 677 |
| 172 | Ga0114129_12210865 | 3300009147 | Bacteria | 662 |
| 173 | Ga0105243_10585268 | 3300009148 | Bacteria | 1072 |
| 174 | Ga0105243_10600539 | 3300009148 | Bacteria | 1059 |
| 175 | Ga0105241_10001572 | 3300009174 | Bacteria | 17474 |
| 176 | Ga0105242_10000957 | 3300009176 | Bacteria | 22525 |
| 177 | Ga0105242_10400007 | 3300009176 | Bacteria | 1281 |
| 178 | Ga0105248_10000854 | 3300009177 | Bacteria | 34286 |
| 179 | Ga0105248_10202816 | 3300009177 | Bacteria | 2234 |
| 180 | Ga0105237_10000974 | 3300009545 | Bacteria | 38484 |
| 181 | Ga0105237_10632355 | 3300009545 | Bacteria | 1077 |
| 182 | Ga0105238_10015589 | 3300009551 | Bacteria | 7694 |
| 183 | Ga0105249_10000677 | 3300009553 | Bacteria | 30987 |
| 184 | Ga0105249_10000819 | 3300009553 | Bacteria | 28036 |
| 185 | Ga0105249_10433334 | 3300009553 | Bacteria | 1351 |
| 186 | Ga0105249_10996849 | 3300009553 | Bacteria | 906 |
| 187 | Ga0105249_11379435 | 3300009553 | Bacteria | 777 |
| 188 | Ga0105028_136920 | 3300009993 | Bacteria | 549 |
| 189 | Ga0099796_10112416 | 3300010159 | Bacteria | 1038 |
| 190 | Ga0105239_10194373 | 3300010375 | Bacteria | 2272 |
| 191 | Ga0105239_10364602 | 3300010375 | Bacteria | 1632 |
| 192 | Ga0105239_10714834 | 3300010375 | Bacteria | 1146 |
| 193 | Ga0105239_10862667 | 3300010375 | Bacteria | 1038 |
| 194 | Ga0105246_10088196 | 3300011119 | Bacteria | 2228 |
| 195 | Ga0157373_10045042 | 3300013100 | Bacteria | 3149 |
| 196 | Ga0157373_10087372 | 3300013100 | Bacteria | 2197 |
| 197 | Ga0157373_10177370 | 3300013100 | Bacteria | 1500 |
| 198 | Ga0157371_10623784 | 3300013102 | Bacteria | 803 |
| 199 | Ga0157370_10433797 | 3300013104 | Bacteria | 1208 |
| 200 | Ga0157369_10003955 | 3300013105 | Bacteria | 17571 |
| 201 | Ga0157374_10009897 | 3300013296 | Bacteria | 8182 |
| 202 | Ga0157374_11345889 | 3300013296 | Bacteria | 736 |
| 203 | Ga0157378_10005422 | 3300013297 | Bacteria | 11185 |
| 204 | Ga0163162_10011008 | 3300013306 | Bacteria | 8808 |
| 205 | Ga0163162_10172389 | 3300013306 | Bacteria | 2288 |
| 206 | Ga0163162_10259420 | 3300013306 | Bacteria | 1870 |
| 207 | Ga0163162_10310914 | 3300013306 | Bacteria | 1708 |
| 208 | Ga0157372_10004565 | 3300013307 | Bacteria | 14741 |
| 209 | Ga0157372_10009106 | 3300013307 | Bacteria | 10547 |
| 210 | Ga0157375_10003432 | 3300013308 | Bacteria | 13745 |
| 211 | Ga0157375_10098179 | 3300013308 | Bacteria | 3005 |
| 212 | Ga0157375_11949552 | 3300013308 | Bacteria | 698 |
| 213 | Ga0163163_10059879 | 3300014325 | Bacteria | 3768 |
| 214 | Ga0163163_10136227 | 3300014325 | Bacteria | 2497 |
| 215 | Ga0157380_10004146 | 3300014326 | Bacteria | 10018 |
| 216 | Ga0157380_10291523 | 3300014326 | Bacteria | 1498 |
| 217 | Ga0157377_10059168 | 3300014745 | Bacteria | 2183 |
| 218 | Ga0157379_10000639 | 3300014968 | Bacteria | 28232 |
| 219 | Ga0157379_10009390 | 3300014968 | Bacteria | 8523 |
| 220 | Ga0157379_10332947 | 3300014968 | Bacteria | 1387 |
| 221 | Ga0163161_10000811 | 3300017792 | Bacteria | 24480 |
| 222 | Ga0163161_10284256 | 3300017792 | Bacteria | 1298 |
| 223 | Ga0163161_10454753 | 3300017792 | Bacteria | 1036 |
| 224 | Ga0213875_10138389 | 3300021388 | Bacteria | 1139 |
| 225 | Ga0209130_1000148 | 3300025284 | Bacteria | 109763 |
| 226 | Ga0207426_1012161 | 3300025302 | Bacteria | 3246 |
| 227 | Ga0207697_10028477 | 3300025315 | Bacteria | 2285 |
| 228 | Ga0207682_10315678 | 3300025893 | Bacteria | 734 |
| 229 | Ga0207692_10001348 | 3300025898 | Bacteria | 9162 |
| 230 | Ga0207642_10003100 | 3300025899 | Bacteria | 5211 |
| 231 | Ga0207710_10001714 | 3300025900 | Bacteria | 10605 |
| 232 | Ga0207710_10028626 | 3300025900 | Bacteria | 2419 |
| 233 | Ga0207688_10005293 | 3300025901 | Bacteria | 7010 |
| 234 | Ga0207680_10027119 | 3300025903 | Bacteria | 3185 |
| 235 | Ga0207647_10015318 | 3300025904 | Bacteria | 5260 |
| 236 | Ga0207685_10191990 | 3300025905 | Bacteria | 954 |
| 237 | Ga0207699_10007512 | 3300025906 | Bacteria | 5333 |
| 238 | Ga0207645_10001793 | 3300025907 | Bacteria | 17329 |
| 239 | Ga0207645_10073473 | 3300025907 | Bacteria | 2189 |
| 240 | Ga0207705_10455336 | 3300025909 | Bacteria | 992 |
| 241 | Ga0207654_10003238 | 3300025911 | Bacteria | 8223 |
| 242 | Ga0207695_10067858 | 3300025913 | Bacteria | 3656 |
| 243 | Ga0207671_10010988 | 3300025914 | Bacteria | 7413 |
| 244 | Ga0207693_10000998 | 3300025915 | Bacteria | 25439 |
| 245 | Ga0207693_10079594 | 3300025915 | Bacteria | 2565 |
| 246 | Ga0207663_10000837 | 3300025916 | Bacteria | 13939 |
| 247 | Ga0207660_10234578 | 3300025917 | Bacteria | 1443 |
| 248 | Ga0207662_10170737 | 3300025918 | Bacteria | 1394 |
| 249 | Ga0207657_10000516 | 3300025919 | Bacteria | 40906 |
| 250 | Ga0207657_10984135 | 3300025919 | Bacteria | 648 |
| 251 | Ga0207649_10002753 | 3300025920 | Bacteria | 9738 |
| 252 | Ga0207652_10088431 | 3300025921 | Bacteria | 2718 |
| 253 | Ga0207652_10369615 | 3300025921 | Bacteria | 1294 |
| 254 | Ga0207681_10003176 | 3300025923 | Bacteria | 10317 |
| 255 | Ga0207694_10033863 | 3300025924 | Bacteria | 3915 |
| 256 | Ga0207650_10014007 | 3300025925 | Bacteria | 5568 |
| 257 | Ga0207659_10013897 | 3300025926 | Bacteria | 5176 |
| 258 | Ga0207687_10012258 | 3300025927 | Bacteria | 5606 |
| 259 | Ga0207687_11511370 | 3300025927 | Bacteria | 577 |
| 260 | Ga0207700_10104090 | 3300025928 | Bacteria | 2270 |
| 261 | Ga0207664_10007339 | 3300025929 | Bacteria | 7639 |
| 262 | Ga0207644_10012966 | 3300025931 | Bacteria | 5545 |
| 263 | Ga0207690_10002745 | 3300025932 | Bacteria | 10630 |
| 264 | Ga0207706_10002149 | 3300025933 | Bacteria | 19260 |
| 265 | Ga0207706_10404893 | 3300025933 | Bacteria | 1183 |
| 266 | Ga0207686_10497574 | 3300025934 | Bacteria | 945 |
| 267 | Ga0207709_10003398 | 3300025935 | Bacteria | 9503 |
| 268 | Ga0207670_10002453 | 3300025936 | Bacteria | 9731 |
| 269 | Ga0207670_10300231 | 3300025936 | Bacteria | 1257 |
| 270 | Ga0207669_10392546 | 3300025937 | Bacteria | 1084 |
| 271 | Ga0207669_10551640 | 3300025937 | Bacteria | 930 |
| 272 | Ga0207704_10007724 | 3300025938 | Bacteria | 5100 |
| 273 | Ga0207665_10000327 | 3300025939 | Bacteria | 32933 |
| 274 | Ga0207691_10001520 | 3300025940 | Bacteria | 23080 |
| 275 | Ga0207711_10016399 | 3300025941 | Bacteria | 6159 |
| 276 | Ga0207711_10134070 | 3300025941 | Bacteria | 2223 |
| 277 | Ga0207689_10109799 | 3300025942 | Bacteria | 2266 |
| 278 | Ga0207661_10036503 | 3300025944 | Bacteria | 3837 |
| 279 | Ga0207679_10011510 | 3300025945 | Bacteria | 5734 |
| 280 | Ga0207667_10048400 | 3300025949 | Bacteria | 4495 |
| 281 | Ga0207667_10508776 | 3300025949 | Bacteria | 1221 |
| 282 | Ga0207651_10003086 | 3300025960 | Bacteria | 8095 |
| 283 | Ga0207712_10008549 | 3300025961 | Bacteria | 6472 |
| 284 | Ga0207712_10207549 | 3300025961 | Bacteria | 1558 |
| 285 | Ga0207668_10000750 | 3300025972 | Bacteria | 19837 |
| 286 | Ga0207640_10013632 | 3300025981 | Bacteria | 4665 |
| 287 | Ga0207658_10015910 | 3300025986 | Bacteria | 5165 |
| 288 | Ga0207658_10099507 | 3300025986 | Bacteria | 2275 |
| 289 | Ga0207677_10001747 | 3300026023 | Bacteria | 11514 |
| 290 | Ga0207677_10385929 | 3300026023 | Bacteria | 1183 |
| 291 | Ga0207703_10016044 | 3300026035 | Bacteria | 5842 |
| 292 | Ga0207703_10123674 | 3300026035 | Bacteria | 2224 |
| 293 | Ga0207703_10211017 | 3300026035 | Bacteria | 1731 |
| 294 | Ga0207639_10001489 | 3300026041 | Bacteria | 15765 |
| 295 | Ga0207678_10001037 | 3300026067 | Bacteria | 25384 |
| 296 | Ga0207678_10087333 | 3300026067 | Bacteria | 2665 |
| 297 | Ga0207708_10001427 | 3300026075 | Bacteria | 17929 |
| 298 | Ga0207708_10043008 | 3300026075 | Bacteria | 3442 |
| 299 | Ga0207708_11309830 | 3300026075 | Bacteria | 635 |
| 300 | Ga0207702_10260873 | 3300026078 | Bacteria | 1631 |
| 301 | Ga0207702_10965549 | 3300026078 | Bacteria | 845 |
| 302 | Ga0207641_10007269 | 3300026088 | Bacteria | 9226 |
| 303 | Ga0207648_10119341 | 3300026089 | Bacteria | 2318 |
| 304 | Ga0207648_10157288 | 3300026089 | Bacteria | 2006 |
| 305 | Ga0207648_10274667 | 3300026089 | Bacteria | 1506 |
| 306 | Ga0207676_10505190 | 3300026095 | Bacteria | 1148 |
| 307 | Ga0207674_10008428 | 3300026116 | Bacteria | 11909 |
| 308 | Ga0207675_100001630 | 3300026118 | Bacteria | 22489 |
| 309 | Ga0207675_100061833 | 3300026118 | Bacteria | 3496 |
| 310 | Ga0207675_102274861 | 3300026118 | Bacteria | 556 |
| 311 | Ga0207683_10000351 | 3300026121 | Bacteria | 42117 |
| 312 | Ga0207698_10011180 | 3300026142 | Bacteria | 5807 |
| 313 | Ga0209982_1015127 | 3300027552 | Bacteria | 1169 |
| 314 | Ga0207428_10000848 | 3300027907 | Bacteria | 34448 |
| 315 | Ga0207428_10009164 | 3300027907 | Bacteria | 8894 |
| 316 | Ga0207428_10314720 | 3300027907 | Bacteria | 1157 |
| 317 | Ga0268266_10009645 | 3300028379 | Bacteria | 8490 |
| 318 | Ga0268266_10098975 | 3300028379 | Bacteria | 2567 |
| 319 | Ga0268266_10912769 | 3300028379 | Bacteria | 849 |
| 320 | Ga0268265_10082932 | 3300028380 | Bacteria | 2536 |
| 321 | Ga0268265_10156047 | 3300028380 | Bacteria | 1932 |
| 322 | Ga0268264_10007128 | 3300028381 | Bacteria | 9370 |
| 323 | Ga0268264_10081525 | 3300028381 | Bacteria | 2765 |
| 324 | Ga0268264_10487459 | 3300028381 | Bacteria | 1200 |
| 325 | Ga0268264_11308790 | 3300028381 | Bacteria | 735 |
| 326 | Ga0268264_11313734 | 3300028381 | Bacteria | 733 |
| 327 | Ga0307515_10041543 | 3300028794 | Bacteria | 7225 |
| 328 | Ga0265339_10131861 | 3300031249 | Bacteria | 1277 |
| 329 | Ga0307413_10033805 | 3300031824 | Bacteria | 2916 |
| 330 | Ga0307410_10093742 | 3300031852 | Bacteria | 2137 |
| 331 | Ga0307407_10390983 | 3300031903 | Bacteria | 995 |
| 332 | Ga0307412_11694705 | 3300031911 | Bacteria | 579 |
| 333 | Ga0307409_100865340 | 3300031995 | Bacteria | 915 |
| 334 | Ga0307411_10062011 | 3300032005 | Bacteria | 2492 |
| 335 | Ga0316583_10276920 | 3300032133 | Bacteria | 581 |
| 336 | Ga0373959_0018780 | 3300034820 | Bacteria | 1304 |
| 337 | Ga0373934_0395611 | 3300035086 | Bacteria | 577 |
| 338 | Ga0373940_0163197 | 3300035088 | Bacteria | 716 |
| 339 | Ga0373949_0016771 | 3300035090 | Bacteria | 1645 |
| 340 | Ga0373952_0050653 | 3300035092 | Bacteria | 989 |
| 341 | Ga0373932_0015228 | 3300035112 | Bacteria | 1947 |
| 342 | Ga0373939_0007872 | 3300035114 | Bacteria | 2598 |
| 343 | Ga0373939_0112948 | 3300035114 | Bacteria | 948 |
| 344 | Ga0373941_0212663 | 3300035115 | Bacteria | 740 |
| 345 | Ga0373960_0021175 | 3300035121 | Bacteria | 1727 |
| 346 | Ga0373960_0226034 | 3300035121 | Bacteria | 671 |
| 347 | Ga0373962_0035130 | 3300035242 | Bacteria | 1391 |
| 348 | Ga0373931_0038762 | 3300035691 | Bacteria | 2494 |
| 349 | Ga0373931_0117931 | 3300035691 | Bacteria | 1514 |
| 350 | Ga0373931_0127847 | 3300035691 | Bacteria | 1459 |
| 351 | Ga0373931_1109884 | 3300035691 | Bacteria | 539 |
| 352 | Ga0373935_0291975 | 3300035692 | Bacteria | 1150 |
| 353 | Ga0395899_0798554 | 3300037312 | Bacteria | 583 |
| 354 | Ga0395899_0817820 | 3300037312 | Bacteria | 574 |
| 355 | Ga0395900_0016744 | 3300037418 | Bacteria | 7479 |
| 356 | Ga0395900_0033099 | 3300037418 | Bacteria | 5320 |
| 357 | Ga0395898_0012412 | 3300037466 | Bacteria | 8808 |
| 358 | Ga0395905_0003223 | 3300037471 | Bacteria | 17551 |
| 359 | Ga0395905_0004050 | 3300037471 | Bacteria | 15372 |
| 360 | Ga0395905_0023167 | 3300037471 | Bacteria | 5870 |
| 361 | Ga0395905_0271728 | 3300037471 | Bacteria | 1581 |
| 362 | Ga0395905_0646513 | 3300037471 | Bacteria | 959 |
| 363 | Ga0436364_0106943 | 3300037853 | Bacteria | 1356 |
| 364 | Ga0395901_0002307 | 3300038443 | Bacteria | 19441 |
| 365 | Ga0395901_0024398 | 3300038443 | Bacteria | 6206 |
| 366 | Ga0395901_0151929 | 3300038443 | Bacteria | 2433 |
| 367 | Ga0395901_0162507 | 3300038443 | Bacteria | 2345 |
| 368 | Ga0395901_0512617 | 3300038443 | Bacteria | 1219 |
| 369 | Ga0242420_016057 | 3300038996 | Bacteria | 1300 |
| 370 | Ga0436365_0298347 | 3300039437 | Bacteria | 3147 |
| 371 | Ga0436365_1488000 | 3300039437 | Bacteria | 2002 |
| 372 | Ga0436363_1683999 | 3300039450 | Bacteria | 724 |
| 373 | Ga0436362_0392232 | 3300039453 | Bacteria | 566 |
| 374 | Ga0451804_1098456 | 3300041463 | Bacteria | 542 |
| 375 | Ga0451807_2417449 | 3300041486 | Unclassified | 596 |
| 376 | Ga0451853_1916364 | 3300041512 | Bacteria | 829 |
| 377 | Ga0439448_0072126 | 3300042005 | Bacteria | 1151 |
| 378 | Ga0451577_0103421 | 3300042876 | Bacteria | 2545 |
| 379 | Ga0466969_0006879 | 3300044656 | Bacteria | 6053 |
| 380 | Ga0453684_0064854 | 3300044712 | Bacteria | 4661 |
| 381 | Ga0466959_0118251 | 3300045049 | Bacteria | 1886 |
| 382 | Ga0451576_0021118 | 3300045051 | Bacteria | 7078 |
| 383 | Ga0466967_0518382 | 3300045976 | Bacteria | 1171 |
| 384 | Ga0466967_1430111 | 3300045976 | Bacteria | 689 |
| 385 | Ga0495603_0095535 | 3300046455 | Bacteria | 1737 |
| 386 | Ga0495584_0221712 | 3300046491 | Bacteria | 961 |
| 387 | Ga0495663_0084891 | 3300046525 | Bacteria | 1025 |
| 388 | Ga0495640_0812314 | 3300046533 | Bacteria | 557 |
| 389 | Ga0495659_0221145 | 3300046664 | Bacteria | 782 |
| 390 | Ga0496100_0004200 | 3300048903 | Bacteria | 7600 |
| 391 | Ga0496100_0029702 | 3300048903 | Bacteria | 3384 |
| 392 | Ga0496100_0167650 | 3300048903 | Bacteria | 1579 |
| 393 | Ga0496101_0060595 | 3300048904 | Bacteria | 2746 |
| 394 | Ga0496102_0043736 | 3300048905 | Bacteria | 4062 |
| 395 | Ga0496102_0206610 | 3300048905 | Bacteria | 1851 |
| 396 | Ga0496103_0033024 | 3300048906 | Bacteria | 3160 |
| 397 | Ga0496103_0451697 | 3300048906 | Bacteria | 824 |
| 398 | Ga0496104_0005063 | 3300048907 | Bacteria | 11496 |
| 399 | Ga0496104_0009183 | 3300048907 | Bacteria | 8792 |
| 400 | Ga0496105_0009909 | 3300048908 | Bacteria | 7472 |
| 401 | Ga0496105_0306154 | 3300048908 | Bacteria | 1276 |
| 402 | Ga0496106_0007965 | 3300048909 | Bacteria | 7829 |
| 403 | Ga0496106_0040950 | 3300048909 | Bacteria | 3471 |
| 404 | Ga0496106_0538295 | 3300048909 | Bacteria | 937 |
| 405 | Ga0496107_0009229 | 3300048910 | Bacteria | 6835 |
| 406 | Ga0496107_0072591 | 3300048910 | Bacteria | 2502 |
| 407 | Ga0496107_0201197 | 3300048910 | Bacteria | 1480 |
| 408 | Ga0496108_0009910 | 3300048911 | Bacteria | 7723 |
| 409 | Ga0496109_0054964 | 3300048912 | Bacteria | 3631 |
| 410 | Ga0496109_0615727 | 3300048912 | Bacteria | 1022 |
| 411 | Ga0496110_0011546 | 3300048913 | Bacteria | 7237 |
| 412 | Ga0496110_0043061 | 3300048913 | Bacteria | 3941 |
| 413 | Ga0496110_0236520 | 3300048913 | Bacteria | 1662 |
| 414 | Ga0496111_0005813 | 3300048914 | Bacteria | 7953 |
| 415 | Ga0496111_0479332 | 3300048914 | Bacteria | 917 |
| 416 | Ga0496112_0008663 | 3300048915 | Bacteria | 9120 |
| 417 | Ga0496112_0181790 | 3300048915 | Bacteria | 2066 |
| 418 | Ga0496112_0343241 | 3300048915 | Bacteria | 1436 |
| 419 | Ga0496113_0004893 | 3300048916 | Bacteria | 8298 |
| 420 | Ga0496113_0084581 | 3300048916 | Bacteria | 2436 |
| 421 | Ga0496113_0443418 | 3300048916 | Bacteria | 1043 |
| 422 | Ga0496114_0005724 | 3300048917 | Bacteria | 9750 |
| 423 | Ga0496115_0004344 | 3300048918 | Bacteria | 10258 |
| 424 | Ga0496115_0071340 | 3300048918 | Bacteria | 2817 |
| 425 | Ga0496115_0579361 | 3300048918 | Bacteria | 894 |
| 426 | Ga0496119_0252665 | 3300048922 | Bacteria | 888 |
| 427 | Ga0496119_0502286 | 3300048922 | Bacteria | 564 |
| 428 | Ga0496122_0218147 | 3300048925 | Bacteria | 1097 |
| 429 | Ga0496123_0038623 | 3300048926 | Bacteria | 3353 |
| 430 | Ga0496123_0189773 | 3300048926 | Bacteria | 1064 |
| 431 | Ga0501031_0005682 | 3300049568 | Bacteria | 8126 |
| 432 | Ga0501032_0533074 | 3300049569 | Bacteria | 749 |
| 433 | Ga0501033_0021281 | 3300049570 | Bacteria | 4892 |
| 434 | Ga0501033_0048718 | 3300049570 | Bacteria | 3147 |
| 435 | Ga0501033_0056907 | 3300049570 | Bacteria | 2890 |
| 436 | Ga0501033_0165133 | 3300049570 | Bacteria | 1592 |
| 437 | Ga0501034_0120551 | 3300049571 | Bacteria | 2609 |
| 438 | Ga0501034_0333773 | 3300049571 | Bacteria | 1447 |
| 439 | Ga0501036_0127414 | 3300049572 | Bacteria | 2150 |
| 440 | Ga0501036_0292143 | 3300049572 | Bacteria | 1363 |
| 441 | Ga0501036_1030803 | 3300049572 | Bacteria | 673 |
| 442 | Ga0501037_0161736 | 3300049573 | Bacteria | 1596 |
| 443 | Ga0501037_0171170 | 3300049573 | Bacteria | 1543 |
| 444 | Ga0501038_0068438 | 3300049574 | Bacteria | 3018 |
| 445 | Ga0501039_0141278 | 3300049575 | Bacteria | 1891 |
| 446 | Ga0501040_0039252 | 3300049576 | Bacteria | 3219 |
| 447 | Ga0501040_0060207 | 3300049576 | Bacteria | 2609 |
| 448 | Ga0501041_0036276 | 3300049577 | Bacteria | 2987 |
| 449 | Ga0501041_0338062 | 3300049577 | Bacteria | 951 |
| 450 | Ga0501042_0126366 | 3300049578 | Bacteria | 1841 |
| 451 | Ga0501043_0014056 | 3300049579 | Bacteria | 6265 |
| 452 | Ga0501043_0251695 | 3300049579 | Bacteria | 1360 |
| 453 | Ga0501043_0262011 | 3300049579 | Bacteria | 1329 |
| 454 | Ga0501046_0019989 | 3300049580 | Bacteria | 5544 |
| 455 | Ga0501046_0024802 | 3300049580 | Bacteria | 4914 |
| 456 | Ga0501046_0248995 | 3300049580 | Bacteria | 1308 |
| 457 | Ga0501046_1086756 | 3300049580 | Bacteria | 553 |
| 458 | Ga0501047_0007534 | 3300049581 | Bacteria | 10248 |
| 459 | Ga0501047_0058256 | 3300049581 | Bacteria | 3731 |
| 460 | Ga0501048_0047231 | 3300049582 | Bacteria | 3072 |
| 461 | Ga0501048_0289474 | 3300049582 | Bacteria | 1165 |
| 462 | Ga0501048_0652568 | 3300049582 | Bacteria | 755 |
| 463 | Ga0501048_1063668 | 3300049582 | Bacteria | 582 |
| 464 | Ga0501067_0099779 | 3300049583 | Bacteria | 1612 |
| 465 | Ga0501068_0019286 | 3300049584 | Bacteria | 3957 |
| 466 | Ga0501068_0277657 | 3300049584 | Bacteria | 1070 |
| 467 | Ga0501068_0311427 | 3300049584 | Bacteria | 1008 |
| 468 | Ga0501068_0324581 | 3300049584 | Bacteria | 987 |
| 469 | Ga0501068_1118321 | 3300049584 | Bacteria | 521 |
| 470 | Ga0501069_0820609 | 3300049585 | Bacteria | 564 |
| 471 | Ga0501070_0004914 | 3300049586 | Bacteria | 11416 |
| 472 | Ga0501070_0769458 | 3300049586 | Bacteria | 758 |
| 473 | Ga0501071_0300222 | 3300049587 | Bacteria | 1217 |
| 474 | Ga0501072_0324826 | 3300049588 | Bacteria | 1223 |
| 475 | Ga0501073_0081763 | 3300049589 | Bacteria | 2247 |
| 476 | Ga0501073_0096993 | 3300049589 | Bacteria | 2047 |
| 477 | Ga0501074_0046656 | 3300049590 | Bacteria | 3132 |
| 478 | Ga0501074_0070617 | 3300049590 | Bacteria | 2510 |
| 479 | Ga0501074_0093084 | 3300049590 | Bacteria | 2158 |
| 480 | Ga0501075_0053501 | 3300049591 | Bacteria | 3036 |
| 481 | Ga0501075_0117123 | 3300049591 | Bacteria | 2025 |
| 482 | Ga0501075_0386604 | 3300049591 | Bacteria | 1067 |
| 483 | Ga0501076_0129484 | 3300049592 | Bacteria | 2046 |
| 484 | Ga0501076_0358212 | 3300049592 | Bacteria | 1198 |
| 485 | Ga0501076_1407917 | 3300049592 | Bacteria | 573 |
| 486 | Ga0501077_0110718 | 3300049593 | Bacteria | 1740 |
| 487 | Ga0501077_0231486 | 3300049593 | Bacteria | 1174 |
| 488 | Ga0501077_0242933 | 3300049593 | Bacteria | 1144 |
| 489 | Ga0501079_0010630 | 3300049741 | Bacteria | 7005 |
| 490 | Ga0501079_0045265 | 3300049741 | Bacteria | 3396 |
| 491 | Ga0501079_0208955 | 3300049741 | Bacteria | 1525 |
| 492 | Ga0501080_0128641 | 3300049742 | Bacteria | 2345 |
| 493 | Ga0501081_0019065 | 3300049743 | Bacteria | 4563 |
| 494 | Ga0501081_0221043 | 3300049743 | Bacteria | 1377 |
| 495 | Ga0501081_0386577 | 3300049743 | Bacteria | 1035 |
| 496 | Ga0501081_0924334 | 3300049743 | Bacteria | 658 |
| 497 | Ga0501083_0010130 | 3300049744 | Bacteria | 6643 |
| 498 | Ga0501083_0061110 | 3300049744 | Bacteria | 2516 |
| 499 | Ga0501083_0181885 | 3300049744 | Bacteria | 1373 |
| 500 | Ga0501035_0031055 | 3300049822 | Bacteria | 4865 |
| 501 | Ga0501035_0099958 | 3300049822 | Bacteria | 2546 |
| 502 | Ga0501044_0009754 | 3300049823 | Bacteria | 10445 |
| 503 | Ga0501044_0014236 | 3300049823 | Bacteria | 8590 |
| 504 | Ga0501044_0136287 | 3300049823 | Bacteria | 2446 |
| 505 | Ga0501044_0244631 | 3300049823 | Bacteria | 1737 |
| 506 | Ga0501045_0313855 | 3300049824 | Bacteria | 1166 |
| 507 | Ga0501045_0475089 | 3300049824 | Bacteria | 929 |
| 508 | nmdc:mga05p37_120064_c1 | 3300050507 | Bacteria | 3229 |
| 509 | nmdc:mga05p37_310678_c1 | 3300050507 | Bacteria | 1869 |
| 510 | nmdc:mga05p37_516393_c1 | 3300050507 | Bacteria | 1367 |
| 511 | nmdc:mga05p37_879413_c1 | 3300050507 | Bacteria | 969 |
| 512 | nmdc:mga09592_312513_c1 | 3300050508 | Bacteria | 1362 |
| 513 | nmdc:mga09592_612529_c1 | 3300050508 | Bacteria | 932 |
| 514 | nmdc:mga09592_89845_c1 | 3300050508 | Bacteria | 2624 |
| 515 | nmdc:mga0qj67_46110_c1 | 3300050509 | Bacteria | 3441 |
| 516 | nmdc:mga06r32_234051_c1 | 3300050510 | Bacteria | 1825 |
| 517 | nmdc:mga06r32_331556_c1 | 3300050510 | Bacteria | 1507 |
| 518 | nmdc:mga06r32_561355_c1 | 3300050510 | Bacteria | 1115 |
| 519 | nmdc:mga08y16_102399_c1 | 3300050511 | Bacteria | 2981 |
| 520 | nmdc:mga08y16_1871768_c1 | 3300050511 | Bacteria | 552 |
| 521 | nmdc:mga08y16_456041_c1 | 3300050511 | Bacteria | 1303 |
| 522 | nmdc:mga08y16_595696_c1 | 3300050511 | Bacteria | 1115 |
| 523 | nmdc:mga08y16_70374_c1 | 3300050511 | Bacteria | 3647 |
| 524 | nmdc:mga0n895_487618_c1 | 3300050512 | Bacteria | 1243 |
| 525 | nmdc:mga0n895_9664_c1 | 3300050512 | Bacteria | 8456 |
| 526 | nmdc:mga0rr50_7289_c1 | 3300050513 | Bacteria | 6804 |
| 527 | nmdc:mga0rr50_7300_c1 | 3300050513 | Bacteria | 6801 |
| 528 | nmdc:mga08x19_265765_c1 | 3300050514 | Bacteria | 1187 |
| 529 | nmdc:mga0a205_155332_c1 | 3300050515 | Bacteria | 2187 |
| 530 | nmdc:mga0a205_43542_c1 | 3300050515 | Bacteria | 4328 |
| 531 | nmdc:mga0a205_862_c1 | 3300050515 | Bacteria | 24830 |
| 532 | nmdc:mga0sz30_62281_c1 | 3300050516 | Bacteria | 1595 |
| 533 | Ga0500568_0086419 | 3300053139 | Bacteria | 1186 |
| 534 | Ga0501084_0007831 | 3300054114 | Bacteria | 8792 |
| 535 | Ga0501084_0011362 | 3300054114 | Bacteria | 7374 |
| 536 | Ga0501084_0075694 | 3300054114 | Bacteria | 2820 |
| 537 | Ga0501084_0225678 | 3300054114 | Bacteria | 1581 |
| 538 | Ga0501082_0051224 | 3300060353 | Bacteria | 3558 |
| 539 | Ga0501082_0071386 | 3300060353 | Bacteria | 2990 |
| 540 | Ga0501082_0102677 | 3300060353 | Bacteria | 2473 |
| 541 | Ga0501082_1071448 | 3300060353 | Bacteria | 705 |
| 542 | Ga0530510_0133334 | 3300061734 | Bacteria | 1828 |
| 543 | Ga0530510_1508512 | 3300061734 | Bacteria | 516 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_1109884 | Ga0373931_1109884_47_454 | 129 |
| 2 | 3300041486 | Ga0451807_2417449 | Ga0451807_2417449_80_481 | 129 |
| 3 | 3300049568 | Ga0501031_0005682 | Ga0501031_0005682_4340_4771 | 131 |
| 4 | 3300049570 | Ga0501033_0021281 | Ga0501033_0021281_1674_2105 | 131 |
| 5 | 3300049571 | Ga0501034_0120551 | Ga0501034_0120551_831_1262 | 131 |
| 6 | 3300049572 | Ga0501036_0292143 | Ga0501036_0292143_822_1253 | 131 |
| 7 | 3300049573 | Ga0501037_0171170 | Ga0501037_0171170_871_1302 | 131 |
| 8 | 3300049576 | Ga0501040_0039252 | Ga0501040_0039252_242_673 | 131 |
| 9 | 3300049579 | Ga0501043_0014056 | Ga0501043_0014056_3470_3901 | 131 |
| 10 | 3300049580 | Ga0501046_0024802 | Ga0501046_0024802_2086_2517 | 131 |
| 11 | 3300049581 | Ga0501047_0058256 | Ga0501047_0058256_3059_3490 | 131 |
| 12 | 3300049582 | Ga0501048_0652568 | Ga0501048_0652568_82_513 | 131 |
| 13 | 3300049583 | Ga0501067_0099779 | Ga0501067_0099779_502_933 | 131 |
| 14 | 3300049584 | Ga0501068_0311427 | Ga0501068_0311427_252_683 | 131 |
| 15 | 3300049587 | Ga0501071_0300222 | Ga0501071_0300222_10_441 | 131 |
| 16 | 3300049589 | Ga0501073_0096993 | Ga0501073_0096993_1186_1617 | 131 |
| 17 | 3300049590 | Ga0501074_0093084 | Ga0501074_0093084_451_882 | 131 |
| 18 | 3300049744 | Ga0501083_0010130 | Ga0501083_0010130_6027_6458 | 131 |
| 19 | 3300049822 | Ga0501035_0031055 | Ga0501035_0031055_2037_2468 | 131 |
| 20 | 3300049823 | Ga0501044_0014236 | Ga0501044_0014236_794_1225 | 131 |
| 21 | 3300054114 | Ga0501084_0075694 | Ga0501084_0075694_1508_1939 | 131 |
| 22 | 3300060353 | Ga0501082_0102677 | Ga0501082_0102677_1166_1597 | 131 |
| 23 | 3300009098 | Ga0105245_11049798 | Ga0105245_110497982 | 132 |
| 24 | 3300041512 | Ga0451853_1916364 | Ga0451853_1916364_42_476 | 132 |
| 25 | 3300005549 | Ga0070704_100014300 | Ga0070704_1000143004 | 133 |
| 26 | 3300005577 | Ga0068857_100627953 | Ga0068857_1006279532 | 133 |
| 27 | 3300007788 | Ga0099795_10000277 | Ga0099795_100002777 | 133 |
| 28 | 3300009094 | Ga0111539_10025839 | Ga0111539_100258393 | 133 |
| 29 | 3300009098 | Ga0105245_10796714 | Ga0105245_107967141 | 133 |
| 30 | 3300009147 | Ga0114129_12121847 | Ga0114129_121218471 | 133 |
| 31 | 3300009148 | Ga0105243_10600539 | Ga0105243_106005392 | 133 |
| 32 | 3300009545 | Ga0105237_10632355 | Ga0105237_106323551 | 133 |
| 33 | 3300009553 | Ga0105249_10000819 | Ga0105249_1000081927 | 133 |
| 34 | 3300009553 | Ga0105249_10996849 | Ga0105249_109968491 | 133 |
| 35 | 3300009993 | Ga0105028_136920 | Ga0105028_1369201 | 133 |
| 36 | 3300010159 | Ga0099796_10112416 | Ga0099796_101124162 | 133 |
| 37 | 3300010375 | Ga0105239_10194373 | Ga0105239_101943733 | 133 |
| 38 | 3300013100 | Ga0157373_10177370 | Ga0157373_101773703 | 133 |
| 39 | 3300013306 | Ga0163162_10172389 | Ga0163162_101723892 | 133 |
| 40 | 3300013307 | Ga0157372_10004565 | Ga0157372_1000456515 | 133 |
| 41 | 3300014325 | Ga0163163_10136227 | Ga0163163_101362272 | 133 |
| 42 | 3300014326 | Ga0157380_10291523 | Ga0157380_102915232 | 133 |
| 43 | 3300014968 | Ga0157379_10332947 | Ga0157379_103329471 | 133 |
| 44 | 3300035114 | Ga0373939_0112948 | Ga0373939_0112948_512_934 | 133 |
| 45 | 3300035121 | Ga0373960_0226034 | Ga0373960_0226034_228_650 | 133 |
| 46 | 3300035242 | Ga0373962_0035130 | Ga0373962_0035130_89_511 | 133 |
| 47 | 3300035691 | Ga0373931_0038762 | Ga0373931_0038762_636_1058 | 133 |
| 48 | 3300035692 | Ga0373935_0291975 | Ga0373935_0291975_22_444 | 133 |
| 49 | 3300041463 | Ga0451804_1098456 | Ga0451804_1098456_24_440 | 133 |
| 50 | 3300042005 | Ga0439448_0072126 | Ga0439448_0072126_92_532 | 133 |
| 51 | 3300044656 | Ga0466969_0006879 | Ga0466969_0006879_169_570 | 133 |
| 52 | 3300045049 | Ga0466959_0118251 | Ga0466959_0118251_1091_1492 | 133 |
| 53 | 3300046533 | Ga0495640_0812314 | Ga0495640_0812314_73_495 | 133 |
| 54 | 3300048903 | Ga0496100_0029702 | Ga0496100_0029702_1118_1540 | 133 |
| 55 | 3300048907 | Ga0496104_0005063 | Ga0496104_0005063_4054_4476 | 133 |
| 56 | 3300048908 | Ga0496105_0306154 | Ga0496105_0306154_446_868 | 133 |
| 57 | 3300048909 | Ga0496106_0040950 | Ga0496106_0040950_1721_2143 | 133 |
| 58 | 3300048910 | Ga0496107_0072591 | Ga0496107_0072591_625_1047 | 133 |
| 59 | 3300048913 | Ga0496110_0011546 | Ga0496110_0011546_2633_3055 | 133 |
| 60 | 3300048914 | Ga0496111_0479332 | Ga0496111_0479332_480_902 | 133 |
| 61 | 3300048915 | Ga0496112_0181790 | Ga0496112_0181790_485_907 | 133 |
| 62 | 3300048922 | Ga0496119_0502286 | Ga0496119_0502286_122_553 | 133 |
| 63 | 3300048925 | Ga0496122_0218147 | Ga0496122_0218147_64_495 | 133 |
| 64 | 3300049592 | Ga0501076_1407917 | Ga0501076_1407917_101_523 | 133 |
| 65 | 3300049824 | Ga0501045_0475089 | Ga0501045_0475089_171_578 | 133 |
| 66 | 3300050507 | nmdc:mga05p37_120064_c1 | nmdc:mga05p37_120064_c1_1382_1804 | 133 |
| 67 | 3300050508 | nmdc:mga09592_312513_c1 | nmdc:mga09592_312513_c1_279_701 | 133 |
| 68 | 3300050509 | nmdc:mga0qj67_46110_c1 | nmdc:mga0qj67_46110_c1_319_741 | 133 |
| 69 | 3300050510 | nmdc:mga06r32_331556_c1 | nmdc:mga06r32_331556_c1_897_1319 | 133 |
| 70 | 3300050511 | nmdc:mga08y16_70374_c1 | nmdc:mga08y16_70374_c1_3146_3568 | 133 |
| 71 | 3300060353 | Ga0501082_1071448 | Ga0501082_1071448_111_533 | 133 |
| 72 | 3300061734 | Ga0530510_1508512 | Ga0530510_1508512_54_476 | 133 |
| 73 | 3300005457 | Ga0070662_100510186 | Ga0070662_1005101862 | 134 |
| 74 | 3300005563 | Ga0068855_100124728 | Ga0068855_1001247284 | 134 |
| 75 | 3300005563 | Ga0068855_100583639 | Ga0068855_1005836392 | 134 |
| 76 | 3300005614 | Ga0068856_100743527 | Ga0068856_1007435272 | 134 |
| 77 | 3300013100 | Ga0157373_10045042 | Ga0157373_100450424 | 134 |
| 78 | 3300013104 | Ga0157370_10433797 | Ga0157370_104337972 | 134 |
| 79 | 3300025949 | Ga0207667_10508776 | Ga0207667_105087761 | 134 |
| 80 | 3300031824 | Ga0307413_10033805 | Ga0307413_100338053 | 134 |
| 81 | 3300031852 | Ga0307410_10093742 | Ga0307410_100937423 | 134 |
| 82 | 3300031903 | Ga0307407_10390983 | Ga0307407_103909832 | 134 |
| 83 | 3300031911 | Ga0307412_11694705 | Ga0307412_116947052 | 134 |
| 84 | 3300031995 | Ga0307409_100865340 | Ga0307409_1008653402 | 134 |
| 85 | 3300032005 | Ga0307411_10062011 | Ga0307411_100620113 | 134 |
| 86 | 3300037312 | Ga0395899_0798554 | Ga0395899_0798554_33_449 | 134 |
| 87 | 3300037418 | Ga0395900_0016744 | Ga0395900_0016744_2390_2806 | 134 |
| 88 | 3300037471 | Ga0395905_0003223 | Ga0395905_0003223_6552_6968 | 134 |
| 89 | 3300037471 | Ga0395905_0023167 | Ga0395905_0023167_5350_5766 | 134 |
| 90 | 3300037471 | Ga0395905_0271728 | Ga0395905_0271728_638_1057 | 134 |
| 91 | 3300037471 | Ga0395905_0646513 | Ga0395905_0646513_18_434 | 134 |
| 92 | 3300038443 | Ga0395901_0002307 | Ga0395901_0002307_103_519 | 134 |
| 93 | 3300038443 | Ga0395901_0151929 | Ga0395901_0151929_1921_2337 | 134 |
| 94 | 3300038443 | Ga0395901_0162507 | Ga0395901_0162507_1875_2291 | 134 |
| 95 | 3300038443 | Ga0395901_0512617 | Ga0395901_0512617_455_871 | 134 |
| 96 | 3300039437 | Ga0436365_1488000 | Ga0436365_1488000_1391_1813 | 134 |
| 97 | 3300039450 | Ga0436363_1683999 | Ga0436363_1683999_273_695 | 134 |
| 98 | 3300039453 | Ga0436362_0392232 | Ga0436362_0392232_38_460 | 134 |
| 99 | 3300045976 | Ga0466967_0518382 | Ga0466967_0518382_174_590 | 134 |
| 100 | iso_pu_bacteria | 2507262055 | 2507508768 | 134 |
| 101 | iso_pu_bacteria | 2508501042 | 2508691375 | 134 |
| 102 | iso_pu_bacteria | 2515154112 | 2515628183 | 134 |
| 103 | iso_pu_bacteria | 2847930680 | 2847936043 | 134 |
| 104 | iso_pu_bacteria | 2879083081 | 2879085501 | 134 |
| 105 | iso_pu_bacteria | 2906626472 | 2906629909 | 134 |
| 106 | iso_pu_bacteria | 2935608549 | 2935608693 | 134 |
| 107 | iso_pu_bacteria | 2935819856 | 2935821833 | 134 |
| 108 | iso_pu_bacteria | 2935847175 | 2935847436 | 134 |
| 109 | iso_pu_bacteria | 2935908558 | 2935909297 | 134 |
| 110 | iso_pu_bacteria | 2935916978 | 2935920018 | 134 |
| 111 | iso_pu_bacteria | 2935926038 | 2935926129 | 134 |
| 112 | iso_pu_bacteria | 2935934488 | 2935934579 | 134 |
| 113 | iso_pu_bacteria | 2935942939 | 2935943029 | 134 |
| 114 | iso_pu_bacteria | 2935951376 | 2935951467 | 134 |
| 115 | iso_pu_bacteria | 2935967501 | 2935967592 | 134 |
| 116 | iso_pu_bacteria | 8019629233 | 8019634663 | 134 |
| 117 | iso_pu_bacteria | 8019668869 | 8019672053 | 134 |
| 118 | iso_pu_bacteria | 8019678201 | 8019684043 | 134 |
| 119 | iso_pu_bacteria | 8019687851 | 8019689865 | 134 |
| 120 | 3300005440 | Ga0070705_100868636 | Ga0070705_1008686362 | 135 |
| 121 | 3300005530 | Ga0070679_100288615 | Ga0070679_1002886153 | 135 |
| 122 | 3300013102 | Ga0157371_10623784 | Ga0157371_106237842 | 135 |
| 123 | 3300025921 | Ga0207652_10369615 | Ga0207652_103696153 | 135 |
| 124 | 3300049570 | Ga0501033_0165133 | Ga0501033_0165133_753_1178 | 135 |
| 125 | 3300049571 | Ga0501034_0333773 | Ga0501034_0333773_603_1028 | 135 |
| 126 | 3300049572 | Ga0501036_0127414 | Ga0501036_0127414_383_808 | 135 |
| 127 | 3300049573 | Ga0501037_0161736 | Ga0501037_0161736_158_583 | 135 |
| 128 | 3300049579 | Ga0501043_0262011 | Ga0501043_0262011_871_1296 | 135 |
| 129 | 3300049580 | Ga0501046_1086756 | Ga0501046_1086756_89_514 | 135 |
| 130 | 3300049581 | Ga0501047_0007534 | Ga0501047_0007534_9659_10084 | 135 |
| 131 | 3300049582 | Ga0501048_0289474 | Ga0501048_0289474_615_1040 | 135 |
| 132 | 3300049586 | Ga0501070_0004914 | Ga0501070_0004914_7801_8226 | 135 |
| 133 | 3300049586 | Ga0501070_0769458 | Ga0501070_0769458_137_556 | 135 |
| 134 | 3300049822 | Ga0501035_0099958 | Ga0501035_0099958_718_1143 | 135 |
| 135 | 3300049823 | Ga0501044_0009754 | Ga0501044_0009754_9813_10238 | 135 |
| 136 | 3300049823 | Ga0501044_0136287 | Ga0501044_0136287_1221_1646 | 135 |
| 137 | iso_pu_bacteria | 2643221564 | 2643837228 | 135 |
| 138 | iso_pu_bacteria | 2837678835 | 2837680483 | 135 |
| 139 | iso_pu_bacteria | 2854911287 | 2854912202 | 135 |
| 140 | iso_pu_bacteria | 2917699015 | 2917701248 | 135 |
| 141 | 3300031249 | Ga0265339_10131861 | Ga0265339_101318611 | 138 |
| 142 | 3300045976 | Ga0466967_1430111 | Ga0466967_1430111_61_513 | 138 |
| 143 | 3300048918 | Ga0496115_0071340 | Ga0496115_0071340_981_1433 | 138 |
| 144 | 3300001978 | JGI24747J21853_1002332 | JGI24747J21853_10023322 | 139 |
| 145 | 3300001979 | JGI24740J21852_10088030 | JGI24740J21852_100880301 | 139 |
| 146 | 3300001989 | JGI24739J22299_10009851 | JGI24739J22299_100098513 | 139 |
| 147 | 3300001991 | JGI24743J22301_10018499 | JGI24743J22301_100184993 | 139 |
| 148 | 3300002075 | JGI24738J21930_10012102 | JGI24738J21930_100121023 | 139 |
| 149 | 3300002077 | JGI24744J21845_10020411 | JGI24744J21845_100204112 | 139 |
| 150 | 3300002126 | JGI24035J26624_1040892 | JGI24035J26624_10408921 | 139 |
| 151 | 3300002987 | JGI25159J45721_1008703 | JGI25159J45721_10087033 | 139 |
| 152 | 3300005262 | Ga0065165_1000139 | Ga0065165_100013936 | 139 |
| 153 | 3300005290 | Ga0065712_10300798 | Ga0065712_103007981 | 139 |
| 154 | 3300005295 | Ga0065707_10962379 | Ga0065707_109623791 | 139 |
| 155 | 3300005327 | Ga0070658_10270085 | Ga0070658_102700852 | 139 |
| 156 | 3300005328 | Ga0070676_10003658 | Ga0070676_100036589 | 139 |
| 157 | 3300005329 | Ga0070683_100053092 | Ga0070683_1000530925 | 139 |
| 158 | 3300005330 | Ga0070690_100000438 | Ga0070690_10000043814 | 139 |
| 159 | 3300005331 | Ga0070670_100653297 | Ga0070670_1006532972 | 139 |
| 160 | 3300005333 | Ga0070677_10554822 | Ga0070677_105548221 | 139 |
| 161 | 3300005334 | Ga0068869_100094424 | Ga0068869_1000944243 | 139 |
| 162 | 3300005335 | Ga0070666_10061379 | Ga0070666_100613793 | 139 |
| 163 | 3300005336 | Ga0070680_100002037 | Ga0070680_10000203713 | 139 |
| 164 | 3300005336 | Ga0070680_100554916 | Ga0070680_1005549162 | 139 |
| 165 | 3300005337 | Ga0070682_100000387 | Ga0070682_10000038716 | 139 |
| 166 | 3300005338 | Ga0068868_100017196 | Ga0068868_1000171962 | 139 |
| 167 | 3300005339 | Ga0070660_100000388 | Ga0070660_10000038831 | 139 |
| 168 | 3300005340 | Ga0070689_100001805 | Ga0070689_1000018059 | 139 |
| 169 | 3300005340 | Ga0070689_100978425 | Ga0070689_1009784251 | 139 |
| 170 | 3300005341 | Ga0070691_10000292 | Ga0070691_1000029217 | 139 |
| 171 | 3300005343 | Ga0070687_100118921 | Ga0070687_1001189213 | 139 |
| 172 | 3300005344 | Ga0070661_100000689 | Ga0070661_10000068919 | 139 |
| 173 | 3300005345 | Ga0070692_10000219 | Ga0070692_1000021916 | 139 |
| 174 | 3300005345 | Ga0070692_10458368 | Ga0070692_104583682 | 139 |
| 175 | 3300005347 | Ga0070668_100037915 | Ga0070668_1000379157 | 139 |
| 176 | 3300005347 | Ga0070668_100337586 | Ga0070668_1003375863 | 139 |
| 177 | 3300005353 | Ga0070669_100008539 | Ga0070669_1000085392 | 139 |
| 178 | 3300005354 | Ga0070675_100019549 | Ga0070675_1000195498 | 139 |
| 179 | 3300005355 | Ga0070671_100005562 | Ga0070671_1000055623 | 139 |
| 180 | 3300005355 | Ga0070671_100614722 | Ga0070671_1006147221 | 139 |
| 181 | 3300005356 | Ga0070674_100001254 | Ga0070674_10000125416 | 139 |
| 182 | 3300005364 | Ga0070673_100000261 | Ga0070673_10000026110 | 139 |
| 183 | 3300005364 | Ga0070673_101216782 | Ga0070673_1012167821 | 139 |
| 184 | 3300005366 | Ga0070659_100000894 | Ga0070659_1000008947 | 139 |
| 185 | 3300005367 | Ga0070667_100000657 | Ga0070667_10000065719 | 139 |
| 186 | 3300005406 | Ga0070703_10009380 | Ga0070703_100093803 | 139 |
| 187 | 3300005434 | Ga0070709_10002437 | Ga0070709_100024375 | 139 |
| 188 | 3300005435 | Ga0070714_100002744 | Ga0070714_10000274413 | 139 |
| 189 | 3300005437 | Ga0070710_10002924 | Ga0070710_100029249 | 139 |
| 190 | 3300005438 | Ga0070701_10001727 | Ga0070701_100017279 | 139 |
| 191 | 3300005438 | Ga0070701_10141573 | Ga0070701_101415733 | 139 |
| 192 | 3300005439 | Ga0070711_100002149 | Ga0070711_1000021493 | 139 |
| 193 | 3300005440 | Ga0070705_100002088 | Ga0070705_10000208814 | 139 |
| 194 | 3300005440 | Ga0070705_100248803 | Ga0070705_1002488031 | 139 |
| 195 | 3300005441 | Ga0070700_100004756 | Ga0070700_1000047561 | 139 |
| 196 | 3300005444 | Ga0070694_100000328 | Ga0070694_1000003283 | 139 |
| 197 | 3300005444 | Ga0070694_100041056 | Ga0070694_1000410566 | 139 |
| 198 | 3300005455 | Ga0070663_100001791 | Ga0070663_1000017916 | 139 |
| 199 | 3300005455 | Ga0070663_100249266 | Ga0070663_1002492661 | 139 |
| 200 | 3300005455 | Ga0070663_101096451 | Ga0070663_1010964511 | 139 |
| 201 | 3300005456 | Ga0070678_100000632 | Ga0070678_10000063221 | 139 |
| 202 | 3300005456 | Ga0070678_100918719 | Ga0070678_1009187191 | 139 |
| 203 | 3300005457 | Ga0070662_100030650 | Ga0070662_1000306507 | 139 |
| 204 | 3300005457 | Ga0070662_100779817 | Ga0070662_1007798171 | 139 |
| 205 | 3300005459 | Ga0068867_100011267 | Ga0068867_1000112677 | 139 |
| 206 | 3300005459 | Ga0068867_100149954 | Ga0068867_1001499542 | 139 |
| 207 | 3300005459 | Ga0068867_100731645 | Ga0068867_1007316451 | 139 |
| 208 | 3300005466 | Ga0070685_10028185 | Ga0070685_100281853 | 139 |
| 209 | 3300005471 | Ga0070698_100655715 | Ga0070698_1006557152 | 139 |
| 210 | 3300005471 | Ga0070698_101164530 | Ga0070698_1011645302 | 139 |
| 211 | 3300005518 | Ga0070699_100178330 | Ga0070699_1001783303 | 139 |
| 212 | 3300005530 | Ga0070679_100084846 | Ga0070679_1000848463 | 139 |
| 213 | 3300005530 | Ga0070679_100508922 | Ga0070679_1005089223 | 139 |
| 214 | 3300005535 | Ga0070684_100151109 | Ga0070684_1001511093 | 139 |
| 215 | 3300005536 | Ga0070697_100095855 | Ga0070697_1000958554 | 139 |
| 216 | 3300005539 | Ga0068853_100001286 | Ga0068853_10000128616 | 139 |
| 217 | 3300005543 | Ga0070672_100012128 | Ga0070672_1000121283 | 139 |
| 218 | 3300005544 | Ga0070686_100001964 | Ga0070686_1000019643 | 139 |
| 219 | 3300005545 | Ga0070695_100001555 | Ga0070695_10000155517 | 139 |
| 220 | 3300005545 | Ga0070695_100018457 | Ga0070695_1000184578 | 139 |
| 221 | 3300005545 | Ga0070695_100489524 | Ga0070695_1004895242 | 139 |
| 222 | 3300005546 | Ga0070696_100004201 | Ga0070696_1000042015 | 139 |
| 223 | 3300005546 | Ga0070696_100132244 | Ga0070696_1001322444 | 139 |
| 224 | 3300005546 | Ga0070696_100150545 | Ga0070696_1001505451 | 139 |
| 225 | 3300005546 | Ga0070696_100643062 | Ga0070696_1006430621 | 139 |
| 226 | 3300005547 | Ga0070693_100000155 | Ga0070693_10000015517 | 139 |
| 227 | 3300005548 | Ga0070665_100046043 | Ga0070665_1000460435 | 139 |
| 228 | 3300005548 | Ga0070665_100055541 | Ga0070665_1000555413 | 139 |
| 229 | 3300005548 | Ga0070665_100169639 | Ga0070665_1001696394 | 139 |
| 230 | 3300005549 | Ga0070704_100000688 | Ga0070704_1000006889 | 139 |
| 231 | 3300005563 | Ga0068855_100021777 | Ga0068855_10002177711 | 139 |
| 232 | 3300005564 | Ga0070664_100000700 | Ga0070664_10000070014 | 139 |
| 233 | 3300005577 | Ga0068857_100016875 | Ga0068857_1000168759 | 139 |
| 234 | 3300005578 | Ga0068854_100012167 | Ga0068854_1000121671 | 139 |
| 235 | 3300005614 | Ga0068856_100006465 | Ga0068856_10000646512 | 139 |
| 236 | 3300005614 | Ga0068856_100879724 | Ga0068856_1008797241 | 139 |
| 237 | 3300005615 | Ga0070702_100000900 | Ga0070702_1000009003 | 139 |
| 238 | 3300005615 | Ga0070702_100580753 | Ga0070702_1005807532 | 139 |
| 239 | 3300005615 | Ga0070702_100612316 | Ga0070702_1006123161 | 139 |
| 240 | 3300005616 | Ga0068852_100003766 | Ga0068852_1000037668 | 139 |
| 241 | 3300005617 | Ga0068859_100003442 | Ga0068859_1000034425 | 139 |
| 242 | 3300005617 | Ga0068859_100079479 | Ga0068859_1000794795 | 139 |
| 243 | 3300005618 | Ga0068864_100040683 | Ga0068864_1000406832 | 139 |
| 244 | 3300005618 | Ga0068864_100176307 | Ga0068864_1001763073 | 139 |
| 245 | 3300005718 | Ga0068866_10006085 | Ga0068866_100060855 | 139 |
| 246 | 3300005719 | Ga0068861_100002000 | Ga0068861_1000020008 | 139 |
| 247 | 3300005719 | Ga0068861_100239207 | Ga0068861_1002392072 | 139 |
| 248 | 3300005719 | Ga0068861_100370751 | Ga0068861_1003707512 | 139 |
| 249 | 3300005834 | Ga0068851_10009852 | Ga0068851_100098525 | 139 |
| 250 | 3300005841 | Ga0068863_100003165 | Ga0068863_1000031659 | 139 |
| 251 | 3300005842 | Ga0068858_100003788 | Ga0068858_1000037883 | 139 |
| 252 | 3300005842 | Ga0068858_100112973 | Ga0068858_1001129733 | 139 |
| 253 | 3300005842 | Ga0068858_100267494 | Ga0068858_1002674942 | 139 |
| 254 | 3300005843 | Ga0068860_100011302 | Ga0068860_1000113026 | 139 |
| 255 | 3300005843 | Ga0068860_100041622 | Ga0068860_1000416222 | 139 |
| 256 | 3300005843 | Ga0068860_100588663 | Ga0068860_1005886633 | 139 |
| 257 | 3300005843 | Ga0068860_101508434 | Ga0068860_1015084341 | 139 |
| 258 | 3300005844 | Ga0068862_100003901 | Ga0068862_1000039012 | 139 |
| 259 | 3300005844 | Ga0068862_100373264 | Ga0068862_1003732642 | 139 |
| 260 | 3300005844 | Ga0068862_101379218 | Ga0068862_1013792181 | 139 |
| 261 | 3300006058 | Ga0075432_10004639 | Ga0075432_100046392 | 139 |
| 262 | 3300006163 | Ga0070715_10000219 | Ga0070715_100002192 | 139 |
| 263 | 3300006173 | Ga0070716_100001003 | Ga0070716_1000010036 | 139 |
| 264 | 3300006175 | Ga0070712_100000382 | Ga0070712_10000038217 | 139 |
| 265 | 3300006237 | Ga0097621_100074986 | Ga0097621_1000749865 | 139 |
| 266 | 3300006358 | Ga0068871_100036883 | Ga0068871_1000368832 | 139 |
| 267 | 3300006844 | Ga0075428_100005355 | Ga0075428_10000535511 | 139 |
| 268 | 3300006844 | Ga0075428_100025063 | Ga0075428_1000250637 | 139 |
| 269 | 3300006844 | Ga0075428_100048914 | Ga0075428_1000489144 | 139 |
| 270 | 3300006846 | Ga0075430_100113127 | Ga0075430_1001131271 | 139 |
| 271 | 3300006847 | Ga0075431_100020190 | Ga0075431_1000201907 | 139 |
| 272 | 3300006852 | Ga0075433_10023713 | Ga0075433_100237133 | 139 |
| 273 | 3300006852 | Ga0075433_10071637 | Ga0075433_100716374 | 139 |
| 274 | 3300006852 | Ga0075433_10577726 | Ga0075433_105777262 | 139 |
| 275 | 3300006852 | Ga0075433_10660214 | Ga0075433_106602142 | 139 |
| 276 | 3300006871 | Ga0075434_100000816 | Ga0075434_10000081634 | 139 |
| 277 | 3300006871 | Ga0075434_100228863 | Ga0075434_1002288631 | 139 |
| 278 | 3300006880 | Ga0075429_100066687 | Ga0075429_1000666873 | 139 |
| 279 | 3300006881 | Ga0068865_100001670 | Ga0068865_1000016706 | 139 |
| 280 | 3300006914 | Ga0075436_100010755 | Ga0075436_1000107552 | 139 |
| 281 | 3300006931 | Ga0097620_100003442 | Ga0097620_10000344216 | 139 |
| 282 | 3300006931 | Ga0097620_100079478 | Ga0097620_1000794781 | 139 |
| 283 | 3300007076 | Ga0075435_100013741 | Ga0075435_1000137413 | 139 |
| 284 | 3300007076 | Ga0075435_100296757 | Ga0075435_1002967571 | 139 |
| 285 | 3300007076 | Ga0075435_100630022 | Ga0075435_1006300223 | 139 |
| 286 | 3300009011 | Ga0105251_10051940 | Ga0105251_100519401 | 139 |
| 287 | 3300009092 | Ga0105250_10004911 | Ga0105250_100049119 | 139 |
| 288 | 3300009093 | Ga0105240_10087353 | Ga0105240_100873531 | 139 |
| 289 | 3300009094 | Ga0111539_10003231 | Ga0111539_1000323111 | 139 |
| 290 | 3300009094 | Ga0111539_10042888 | Ga0111539_100428884 | 139 |
| 291 | 3300009094 | Ga0111539_10261458 | Ga0111539_102614583 | 139 |
| 292 | 3300009094 | Ga0111539_11782060 | Ga0111539_117820602 | 139 |
| 293 | 3300009094 | Ga0111539_12934380 | Ga0111539_129343801 | 139 |
| 294 | 3300009098 | Ga0105245_10000729 | Ga0105245_1000072917 | 139 |
| 295 | 3300009098 | Ga0105245_10322741 | Ga0105245_103227412 | 139 |
| 296 | 3300009098 | Ga0105245_10462571 | Ga0105245_104625712 | 139 |
| 297 | 3300009101 | Ga0105247_10000684 | Ga0105247_1000068418 | 139 |
| 298 | 3300009101 | Ga0105247_10048586 | Ga0105247_100485864 | 139 |
| 299 | 3300009147 | Ga0114129_10262815 | Ga0114129_102628152 | 139 |
| 300 | 3300009147 | Ga0114129_10451995 | Ga0114129_104519952 | 139 |
| 301 | 3300009147 | Ga0114129_10766700 | Ga0114129_107667002 | 139 |
| 302 | 3300009147 | Ga0114129_12210865 | Ga0114129_122108651 | 139 |
| 303 | 3300009148 | Ga0105243_10585268 | Ga0105243_105852682 | 139 |
| 304 | 3300009174 | Ga0105241_10001572 | Ga0105241_1000157216 | 139 |
| 305 | 3300009176 | Ga0105242_10000957 | Ga0105242_100009578 | 139 |
| 306 | 3300009176 | Ga0105242_10400007 | Ga0105242_104000072 | 139 |
| 307 | 3300009177 | Ga0105248_10000854 | Ga0105248_1000085417 | 139 |
| 308 | 3300009177 | Ga0105248_10202816 | Ga0105248_102028165 | 139 |
| 309 | 3300009545 | Ga0105237_10000974 | Ga0105237_1000097426 | 139 |
| 310 | 3300009551 | Ga0105238_10015589 | Ga0105238_1001558912 | 139 |
| 311 | 3300009553 | Ga0105249_10000677 | Ga0105249_1000067720 | 139 |
| 312 | 3300009553 | Ga0105249_10433334 | Ga0105249_104333342 | 139 |
| 313 | 3300009553 | Ga0105249_11379435 | Ga0105249_113794351 | 139 |
| 314 | 3300010375 | Ga0105239_10364602 | Ga0105239_103646022 | 139 |
| 315 | 3300010375 | Ga0105239_10714834 | Ga0105239_107148342 | 139 |
| 316 | 3300010375 | Ga0105239_10862667 | Ga0105239_108626672 | 139 |
| 317 | 3300011119 | Ga0105246_10088196 | Ga0105246_100881964 | 139 |
| 318 | 3300013100 | Ga0157373_10087372 | Ga0157373_100873723 | 139 |
| 319 | 3300013105 | Ga0157369_10003955 | Ga0157369_1000395513 | 139 |
| 320 | 3300013296 | Ga0157374_10009897 | Ga0157374_1000989710 | 139 |
| 321 | 3300013296 | Ga0157374_11345889 | Ga0157374_113458891 | 139 |
| 322 | 3300013297 | Ga0157378_10005422 | Ga0157378_100054227 | 139 |
| 323 | 3300013306 | Ga0163162_10011008 | Ga0163162_100110088 | 139 |
| 324 | 3300013306 | Ga0163162_10259420 | Ga0163162_102594201 | 139 |
| 325 | 3300013306 | Ga0163162_10310914 | Ga0163162_103109142 | 139 |
| 326 | 3300013307 | Ga0157372_10009106 | Ga0157372_100091069 | 139 |
| 327 | 3300013308 | Ga0157375_10003432 | Ga0157375_100034323 | 139 |
| 328 | 3300013308 | Ga0157375_10098179 | Ga0157375_100981795 | 139 |
| 329 | 3300013308 | Ga0157375_11949552 | Ga0157375_119495521 | 139 |
| 330 | 3300014325 | Ga0163163_10059879 | Ga0163163_100598795 | 139 |
| 331 | 3300014326 | Ga0157380_10004146 | Ga0157380_100041463 | 139 |
| 332 | 3300014745 | Ga0157377_10059168 | Ga0157377_100591682 | 139 |
| 333 | 3300014968 | Ga0157379_10000639 | Ga0157379_100006397 | 139 |
| 334 | 3300014968 | Ga0157379_10009390 | Ga0157379_1000939013 | 139 |
| 335 | 3300017792 | Ga0163161_10000811 | Ga0163161_100008119 | 139 |
| 336 | 3300017792 | Ga0163161_10284256 | Ga0163161_102842561 | 139 |
| 337 | 3300017792 | Ga0163161_10454753 | Ga0163161_104547531 | 139 |
| 338 | 3300021388 | Ga0213875_10138389 | Ga0213875_101383893 | 139 |
| 339 | 3300025284 | Ga0209130_1000148 | Ga0209130_100014858 | 139 |
| 340 | 3300025302 | Ga0207426_1012161 | Ga0207426_10121612 | 139 |
| 341 | 3300025315 | Ga0207697_10028477 | Ga0207697_100284773 | 139 |
| 342 | 3300025893 | Ga0207682_10315678 | Ga0207682_103156782 | 139 |
| 343 | 3300025898 | Ga0207692_10001348 | Ga0207692_100013487 | 139 |
| 344 | 3300025899 | Ga0207642_10003100 | Ga0207642_100031004 | 139 |
| 345 | 3300025900 | Ga0207710_10001714 | Ga0207710_100017147 | 139 |
| 346 | 3300025900 | Ga0207710_10028626 | Ga0207710_100286265 | 139 |
| 347 | 3300025901 | Ga0207688_10005293 | Ga0207688_1000529310 | 139 |
| 348 | 3300025903 | Ga0207680_10027119 | Ga0207680_100271193 | 139 |
| 349 | 3300025904 | Ga0207647_10015318 | Ga0207647_100153183 | 139 |
| 350 | 3300025905 | Ga0207685_10191990 | Ga0207685_101919902 | 139 |
| 351 | 3300025906 | Ga0207699_10007512 | Ga0207699_100075127 | 139 |
| 352 | 3300025907 | Ga0207645_10001793 | Ga0207645_100017933 | 139 |
| 353 | 3300025907 | Ga0207645_10073473 | Ga0207645_100734733 | 139 |
| 354 | 3300025909 | Ga0207705_10455336 | Ga0207705_104553362 | 139 |
| 355 | 3300025911 | Ga0207654_10003238 | Ga0207654_100032384 | 139 |
| 356 | 3300025913 | Ga0207695_10067858 | Ga0207695_100678587 | 139 |
| 357 | 3300025914 | Ga0207671_10010988 | Ga0207671_100109888 | 139 |
| 358 | 3300025915 | Ga0207693_10000998 | Ga0207693_1000099813 | 139 |
| 359 | 3300025915 | Ga0207693_10079594 | Ga0207693_100795941 | 139 |
| 360 | 3300025916 | Ga0207663_10000837 | Ga0207663_1000083714 | 139 |
| 361 | 3300025917 | Ga0207660_10234578 | Ga0207660_102345782 | 139 |
| 362 | 3300025918 | Ga0207662_10170737 | Ga0207662_101707373 | 139 |
| 363 | 3300025919 | Ga0207657_10000516 | Ga0207657_1000051629 | 139 |
| 364 | 3300025919 | Ga0207657_10984135 | Ga0207657_109841351 | 139 |
| 365 | 3300025920 | Ga0207649_10002753 | Ga0207649_100027536 | 139 |
| 366 | 3300025921 | Ga0207652_10088431 | Ga0207652_100884316 | 139 |
| 367 | 3300025923 | Ga0207681_10003176 | Ga0207681_100031767 | 139 |
| 368 | 3300025924 | Ga0207694_10033863 | Ga0207694_100338633 | 139 |
| 369 | 3300025925 | Ga0207650_10014007 | Ga0207650_100140073 | 139 |
| 370 | 3300025926 | Ga0207659_10013897 | Ga0207659_100138971 | 139 |
| 371 | 3300025927 | Ga0207687_10012258 | Ga0207687_100122588 | 139 |
| 372 | 3300025927 | Ga0207687_11511370 | Ga0207687_115113701 | 139 |
| 373 | 3300025928 | Ga0207700_10104090 | Ga0207700_101040902 | 139 |
| 374 | 3300025929 | Ga0207664_10007339 | Ga0207664_100073394 | 139 |
| 375 | 3300025931 | Ga0207644_10012966 | Ga0207644_100129662 | 139 |
| 376 | 3300025932 | Ga0207690_10002745 | Ga0207690_100027456 | 139 |
| 377 | 3300025933 | Ga0207706_10002149 | Ga0207706_100021495 | 139 |
| 378 | 3300025933 | Ga0207706_10404893 | Ga0207706_104048931 | 139 |
| 379 | 3300025934 | Ga0207686_10497574 | Ga0207686_104975741 | 139 |
| 380 | 3300025935 | Ga0207709_10003398 | Ga0207709_100033985 | 139 |
| 381 | 3300025936 | Ga0207670_10002453 | Ga0207670_100024536 | 139 |
| 382 | 3300025936 | Ga0207670_10300231 | Ga0207670_103002312 | 139 |
| 383 | 3300025937 | Ga0207669_10392546 | Ga0207669_103925461 | 139 |
| 384 | 3300025937 | Ga0207669_10551640 | Ga0207669_105516401 | 139 |
| 385 | 3300025938 | Ga0207704_10007724 | Ga0207704_100077243 | 139 |
| 386 | 3300025939 | Ga0207665_10000327 | Ga0207665_1000032720 | 139 |
| 387 | 3300025940 | Ga0207691_10001520 | Ga0207691_1000152028 | 139 |
| 388 | 3300025941 | Ga0207711_10016399 | Ga0207711_100163999 | 139 |
| 389 | 3300025941 | Ga0207711_10134070 | Ga0207711_101340704 | 139 |
| 390 | 3300025942 | Ga0207689_10109799 | Ga0207689_101097992 | 139 |
| 391 | 3300025944 | Ga0207661_10036503 | Ga0207661_100365033 | 139 |
| 392 | 3300025945 | Ga0207679_10011510 | Ga0207679_100115109 | 139 |
| 393 | 3300025949 | Ga0207667_10048400 | Ga0207667_100484003 | 139 |
| 394 | 3300025960 | Ga0207651_10003086 | Ga0207651_100030866 | 139 |
| 395 | 3300025961 | Ga0207712_10008549 | Ga0207712_100085496 | 139 |
| 396 | 3300025961 | Ga0207712_10207549 | Ga0207712_102075491 | 139 |
| 397 | 3300025972 | Ga0207668_10000750 | Ga0207668_100007505 | 139 |
| 398 | 3300025981 | Ga0207640_10013632 | Ga0207640_100136321 | 139 |
| 399 | 3300025986 | Ga0207658_10015910 | Ga0207658_100159108 | 139 |
| 400 | 3300025986 | Ga0207658_10099507 | Ga0207658_100995072 | 139 |
| 401 | 3300026023 | Ga0207677_10001747 | Ga0207677_100017479 | 139 |
| 402 | 3300026023 | Ga0207677_10385929 | Ga0207677_103859291 | 139 |
| 403 | 3300026035 | Ga0207703_10016044 | Ga0207703_100160447 | 139 |
| 404 | 3300026035 | Ga0207703_10123674 | Ga0207703_101236745 | 139 |
| 405 | 3300026035 | Ga0207703_10211017 | Ga0207703_102110172 | 139 |
| 406 | 3300026041 | Ga0207639_10001489 | Ga0207639_100014896 | 139 |
| 407 | 3300026067 | Ga0207678_10001037 | Ga0207678_1000103720 | 139 |
| 408 | 3300026067 | Ga0207678_10087333 | Ga0207678_100873333 | 139 |
| 409 | 3300026075 | Ga0207708_10001427 | Ga0207708_100014271 | 139 |
| 410 | 3300026075 | Ga0207708_10043008 | Ga0207708_100430082 | 139 |
| 411 | 3300026075 | Ga0207708_11309830 | Ga0207708_113098301 | 139 |
| 412 | 3300026078 | Ga0207702_10260873 | Ga0207702_102608733 | 139 |
| 413 | 3300026078 | Ga0207702_10965549 | Ga0207702_109655491 | 139 |
| 414 | 3300026088 | Ga0207641_10007269 | Ga0207641_100072699 | 139 |
| 415 | 3300026089 | Ga0207648_10119341 | Ga0207648_101193412 | 139 |
| 416 | 3300026089 | Ga0207648_10157288 | Ga0207648_101572884 | 139 |
| 417 | 3300026089 | Ga0207648_10274667 | Ga0207648_102746672 | 139 |
| 418 | 3300026095 | Ga0207676_10505190 | Ga0207676_105051902 | 139 |
| 419 | 3300026116 | Ga0207674_10008428 | Ga0207674_100084284 | 139 |
| 420 | 3300026118 | Ga0207675_100001630 | Ga0207675_10000163014 | 139 |
| 421 | 3300026118 | Ga0207675_100061833 | Ga0207675_1000618331 | 139 |
| 422 | 3300026118 | Ga0207675_102274861 | Ga0207675_1022748612 | 139 |
| 423 | 3300026121 | Ga0207683_10000351 | Ga0207683_1000035119 | 139 |
| 424 | 3300026142 | Ga0207698_10011180 | Ga0207698_100111806 | 139 |
| 425 | 3300027552 | Ga0209982_1015127 | Ga0209982_10151271 | 139 |
| 426 | 3300027907 | Ga0207428_10000848 | Ga0207428_100008483 | 139 |
| 427 | 3300027907 | Ga0207428_10009164 | Ga0207428_100091647 | 139 |
| 428 | 3300027907 | Ga0207428_10314720 | Ga0207428_103147201 | 139 |
| 429 | 3300028379 | Ga0268266_10009645 | Ga0268266_100096457 | 139 |
| 430 | 3300028379 | Ga0268266_10098975 | Ga0268266_100989752 | 139 |
| 431 | 3300028379 | Ga0268266_10912769 | Ga0268266_109127693 | 139 |
| 432 | 3300028380 | Ga0268265_10082932 | Ga0268265_100829325 | 139 |
| 433 | 3300028380 | Ga0268265_10156047 | Ga0268265_101560471 | 139 |
| 434 | 3300028381 | Ga0268264_10007128 | Ga0268264_100071286 | 139 |
| 435 | 3300028381 | Ga0268264_10081525 | Ga0268264_100815254 | 139 |
| 436 | 3300028381 | Ga0268264_10487459 | Ga0268264_104874591 | 139 |
| 437 | 3300028381 | Ga0268264_11308790 | Ga0268264_113087901 | 139 |
| 438 | 3300028381 | Ga0268264_11313734 | Ga0268264_113137341 | 139 |
| 439 | 3300028794 | Ga0307515_10041543 | Ga0307515_1004154312 | 139 |
| 440 | 3300032133 | Ga0316583_10276920 | Ga0316583_102769201 | 139 |
| 441 | 3300034820 | Ga0373959_0018780 | Ga0373959_0018780_442_861 | 139 |
| 442 | 3300035086 | Ga0373934_0395611 | Ga0373934_0395611_136_555 | 139 |
| 443 | 3300035088 | Ga0373940_0163197 | Ga0373940_0163197_41_460 | 139 |
| 444 | 3300035090 | Ga0373949_0016771 | Ga0373949_0016771_982_1401 | 139 |
| 445 | 3300035092 | Ga0373952_0050653 | Ga0373952_0050653_157_576 | 139 |
| 446 | 3300035112 | Ga0373932_0015228 | Ga0373932_0015228_1221_1640 | 139 |
| 447 | 3300035114 | Ga0373939_0007872 | Ga0373939_0007872_1849_2268 | 139 |
| 448 | 3300035115 | Ga0373941_0212663 | Ga0373941_0212663_59_484 | 139 |
| 449 | 3300035121 | Ga0373960_0021175 | Ga0373960_0021175_1017_1436 | 139 |
| 450 | 3300035691 | Ga0373931_0117931 | Ga0373931_0117931_536_961 | 139 |
| 451 | 3300035691 | Ga0373931_0127847 | Ga0373931_0127847_932_1351 | 139 |
| 452 | 3300037312 | Ga0395899_0817820 | Ga0395899_0817820_111_530 | 139 |
| 453 | 3300037418 | Ga0395900_0033099 | Ga0395900_0033099_791_1210 | 139 |
| 454 | 3300037466 | Ga0395898_0012412 | Ga0395898_0012412_4020_4439 | 139 |
| 455 | 3300037471 | Ga0395905_0004050 | Ga0395905_0004050_5322_5741 | 139 |
| 456 | 3300037853 | Ga0436364_0106943 | Ga0436364_0106943_268_708 | 139 |
| 457 | 3300038443 | Ga0395901_0024398 | Ga0395901_0024398_2326_2745 | 139 |
| 458 | 3300038996 | Ga0242420_016057 | Ga0242420_016057_440_859 | 139 |
| 459 | 3300039437 | Ga0436365_0298347 | Ga0436365_0298347_574_993 | 139 |
| 460 | 3300042876 | Ga0451577_0103421 | Ga0451577_0103421_22_441 | 139 |
| 461 | 3300044712 | Ga0453684_0064854 | Ga0453684_0064854_1692_2111 | 139 |
| 462 | 3300045051 | Ga0451576_0021118 | Ga0451576_0021118_426_845 | 139 |
| 463 | 3300046455 | Ga0495603_0095535 | Ga0495603_0095535_557_982 | 139 |
| 464 | 3300046491 | Ga0495584_0221712 | Ga0495584_0221712_94_519 | 139 |
| 465 | 3300046525 | Ga0495663_0084891 | Ga0495663_0084891_57_482 | 139 |
| 466 | 3300046664 | Ga0495659_0221145 | Ga0495659_0221145_39_464 | 139 |
| 467 | 3300048903 | Ga0496100_0004200 | Ga0496100_0004200_5117_5536 | 139 |
| 468 | 3300048903 | Ga0496100_0167650 | Ga0496100_0167650_1054_1479 | 139 |
| 469 | 3300048904 | Ga0496101_0060595 | Ga0496101_0060595_1458_1877 | 139 |
| 470 | 3300048905 | Ga0496102_0043736 | Ga0496102_0043736_2065_2484 | 139 |
| 471 | 3300048905 | Ga0496102_0206610 | Ga0496102_0206610_607_1032 | 139 |
| 472 | 3300048906 | Ga0496103_0033024 | Ga0496103_0033024_1937_2356 | 139 |
| 473 | 3300048906 | Ga0496103_0451697 | Ga0496103_0451697_205_630 | 139 |
| 474 | 3300048907 | Ga0496104_0009183 | Ga0496104_0009183_3686_4105 | 139 |
| 475 | 3300048908 | Ga0496105_0009909 | Ga0496105_0009909_1937_2356 | 139 |
| 476 | 3300048909 | Ga0496106_0007965 | Ga0496106_0007965_1937_2356 | 139 |
| 477 | 3300048909 | Ga0496106_0538295 | Ga0496106_0538295_243_668 | 139 |
| 478 | 3300048910 | Ga0496107_0009229 | Ga0496107_0009229_1300_1719 | 139 |
| 479 | 3300048910 | Ga0496107_0201197 | Ga0496107_0201197_126_551 | 139 |
| 480 | 3300048911 | Ga0496108_0009910 | Ga0496108_0009910_3615_4034 | 139 |
| 481 | 3300048912 | Ga0496109_0054964 | Ga0496109_0054964_1276_1695 | 139 |
| 482 | 3300048912 | Ga0496109_0615727 | Ga0496109_0615727_94_519 | 139 |
| 483 | 3300048913 | Ga0496110_0043061 | Ga0496110_0043061_1937_2356 | 139 |
| 484 | 3300048913 | Ga0496110_0236520 | Ga0496110_0236520_420_845 | 139 |
| 485 | 3300048914 | Ga0496111_0005813 | Ga0496111_0005813_3920_4339 | 139 |
| 486 | 3300048915 | Ga0496112_0008663 | Ga0496112_0008663_4031_4450 | 139 |
| 487 | 3300048915 | Ga0496112_0343241 | Ga0496112_0343241_608_1027 | 139 |
| 488 | 3300048916 | Ga0496113_0004893 | Ga0496113_0004893_3960_4379 | 139 |
| 489 | 3300048916 | Ga0496113_0084581 | Ga0496113_0084581_1499_1918 | 139 |
| 490 | 3300048916 | Ga0496113_0443418 | Ga0496113_0443418_435_860 | 139 |
| 491 | 3300048917 | Ga0496114_0005724 | Ga0496114_0005724_5010_5429 | 139 |
| 492 | 3300048918 | Ga0496115_0004344 | Ga0496115_0004344_4723_5142 | 139 |
| 493 | 3300048918 | Ga0496115_0579361 | Ga0496115_0579361_30_455 | 139 |
| 494 | 3300048922 | Ga0496119_0252665 | Ga0496119_0252665_38_457 | 139 |
| 495 | 3300048926 | Ga0496123_0038623 | Ga0496123_0038623_774_1223 | 139 |
| 496 | 3300048926 | Ga0496123_0189773 | Ga0496123_0189773_200_649 | 139 |
| 497 | 3300049569 | Ga0501032_0533074 | Ga0501032_0533074_279_704 | 139 |
| 498 | 3300049570 | Ga0501033_0048718 | Ga0501033_0048718_585_1040 | 139 |
| 499 | 3300049570 | Ga0501033_0056907 | Ga0501033_0056907_1986_2411 | 139 |
| 500 | 3300049572 | Ga0501036_1030803 | Ga0501036_1030803_160_585 | 139 |
| 501 | 3300049574 | Ga0501038_0068438 | Ga0501038_0068438_2466_2921 | 139 |
| 502 | 3300049575 | Ga0501039_0141278 | Ga0501039_0141278_497_922 | 139 |
| 503 | 3300049576 | Ga0501040_0060207 | Ga0501040_0060207_2130_2555 | 139 |
| 504 | 3300049577 | Ga0501041_0036276 | Ga0501041_0036276_2082_2507 | 139 |
| 505 | 3300049577 | Ga0501041_0338062 | Ga0501041_0338062_192_611 | 139 |
| 506 | 3300049578 | Ga0501042_0126366 | Ga0501042_0126366_935_1360 | 139 |
| 507 | 3300049579 | Ga0501043_0251695 | Ga0501043_0251695_679_1104 | 139 |
| 508 | 3300049580 | Ga0501046_0019989 | Ga0501046_0019989_4362_4787 | 139 |
| 509 | 3300049580 | Ga0501046_0248995 | Ga0501046_0248995_587_1012 | 139 |
| 510 | 3300049582 | Ga0501048_0047231 | Ga0501048_0047231_97_522 | 139 |
| 511 | 3300049582 | Ga0501048_1063668 | Ga0501048_1063668_60_479 | 139 |
| 512 | 3300049584 | Ga0501068_0019286 | Ga0501068_0019286_1791_2216 | 139 |
| 513 | 3300049584 | Ga0501068_0277657 | Ga0501068_0277657_311_778 | 139 |
| 514 | 3300049584 | Ga0501068_0324581 | Ga0501068_0324581_457_912 | 139 |
| 515 | 3300049584 | Ga0501068_1118321 | Ga0501068_1118321_52_471 | 139 |
| 516 | 3300049585 | Ga0501069_0820609 | Ga0501069_0820609_133_552 | 139 |
| 517 | 3300049588 | Ga0501072_0324826 | Ga0501072_0324826_708_1148 | 139 |
| 518 | 3300049589 | Ga0501073_0081763 | Ga0501073_0081763_724_1149 | 139 |
| 519 | 3300049590 | Ga0501074_0046656 | Ga0501074_0046656_2630_3055 | 139 |
| 520 | 3300049590 | Ga0501074_0070617 | Ga0501074_0070617_29_454 | 139 |
| 521 | 3300049591 | Ga0501075_0053501 | Ga0501075_0053501_35_460 | 139 |
| 522 | 3300049591 | Ga0501075_0117123 | Ga0501075_0117123_10_465 | 139 |
| 523 | 3300049591 | Ga0501075_0386604 | Ga0501075_0386604_266_685 | 139 |
| 524 | 3300049592 | Ga0501076_0129484 | Ga0501076_0129484_1445_1870 | 139 |
| 525 | 3300049592 | Ga0501076_0358212 | Ga0501076_0358212_83_538 | 139 |
| 526 | 3300049593 | Ga0501077_0110718 | Ga0501077_0110718_238_663 | 139 |
| 527 | 3300049593 | Ga0501077_0231486 | Ga0501077_0231486_646_1071 | 139 |
| 528 | 3300049593 | Ga0501077_0242933 | Ga0501077_0242933_487_912 | 139 |
| 529 | 3300049741 | Ga0501079_0010630 | Ga0501079_0010630_5895_6350 | 139 |
| 530 | 3300049741 | Ga0501079_0045265 | Ga0501079_0045265_413_838 | 139 |
| 531 | 3300049741 | Ga0501079_0208955 | Ga0501079_0208955_1089_1508 | 139 |
| 532 | 3300049742 | Ga0501080_0128641 | Ga0501080_0128641_646_1071 | 139 |
| 533 | 3300049743 | Ga0501081_0019065 | Ga0501081_0019065_1475_1930 | 139 |
| 534 | 3300049743 | Ga0501081_0221043 | Ga0501081_0221043_244_669 | 139 |
| 535 | 3300049743 | Ga0501081_0386577 | Ga0501081_0386577_293_718 | 139 |
| 536 | 3300049743 | Ga0501081_0924334 | Ga0501081_0924334_23_451 | 139 |
| 537 | 3300049744 | Ga0501083_0061110 | Ga0501083_0061110_1101_1526 | 139 |
| 538 | 3300049744 | Ga0501083_0181885 | Ga0501083_0181885_409_864 | 139 |
| 539 | 3300049823 | Ga0501044_0244631 | Ga0501044_0244631_1188_1643 | 139 |
| 540 | 3300049824 | Ga0501045_0313855 | Ga0501045_0313855_83_508 | 139 |
| 541 | 3300050507 | nmdc:mga05p37_310678_c1 | nmdc:mga05p37_310678_c1_1345_1764 | 139 |
| 542 | 3300050507 | nmdc:mga05p37_516393_c1 | nmdc:mga05p37_516393_c1_34_480 | 139 |
| 543 | 3300050507 | nmdc:mga05p37_879413_c1 | nmdc:mga05p37_879413_c1_203_628 | 139 |
| 544 | 3300050508 | nmdc:mga09592_612529_c1 | nmdc:mga09592_612529_c1_307_732 | 139 |
| 545 | 3300050508 | nmdc:mga09592_89845_c1 | nmdc:mga09592_89845_c1_313_732 | 139 |
| 546 | 3300050510 | nmdc:mga06r32_234051_c1 | nmdc:mga06r32_234051_c1_878_1303 | 139 |
| 547 | 3300050510 | nmdc:mga06r32_561355_c1 | nmdc:mga06r32_561355_c1_204_623 | 139 |
| 548 | 3300050511 | nmdc:mga08y16_102399_c1 | nmdc:mga08y16_102399_c1_1893_2312 | 139 |
| 549 | 3300050511 | nmdc:mga08y16_1871768_c1 | nmdc:mga08y16_1871768_c1_104_523 | 139 |
| 550 | 3300050511 | nmdc:mga08y16_456041_c1 | nmdc:mga08y16_456041_c1_81_506 | 139 |
| 551 | 3300050511 | nmdc:mga08y16_595696_c1 | nmdc:mga08y16_595696_c1_245_664 | 139 |
| 552 | 3300050512 | nmdc:mga0n895_487618_c1 | nmdc:mga0n895_487618_c1_373_792 | 139 |
| 553 | 3300050512 | nmdc:mga0n895_9664_c1 | nmdc:mga0n895_9664_c1_7083_7502 | 139 |
| 554 | 3300050513 | nmdc:mga0rr50_7289_c1 | nmdc:mga0rr50_7289_c1_5464_5883 | 139 |
| 555 | 3300050513 | nmdc:mga0rr50_7300_c1 | nmdc:mga0rr50_7300_c1_3150_3569 | 139 |
| 556 | 3300050514 | nmdc:mga08x19_265765_c1 | nmdc:mga08x19_265765_c1_452_871 | 139 |
| 557 | 3300050515 | nmdc:mga0a205_155332_c1 | nmdc:mga0a205_155332_c1_1317_1736 | 139 |
| 558 | 3300050515 | nmdc:mga0a205_43542_c1 | nmdc:mga0a205_43542_c1_2097_2522 | 139 |
| 559 | 3300050515 | nmdc:mga0a205_862_c1 | nmdc:mga0a205_862_c1_5518_5937 | 139 |
| 560 | 3300050516 | nmdc:mga0sz30_62281_c1 | nmdc:mga0sz30_62281_c1_968_1417 | 139 |
| 561 | 3300053139 | Ga0500568_0086419 | Ga0500568_0086419_200_640 | 139 |
| 562 | 3300054114 | Ga0501084_0007831 | Ga0501084_0007831_7602_8057 | 139 |
| 563 | 3300054114 | Ga0501084_0011362 | Ga0501084_0011362_5265_5690 | 139 |
| 564 | 3300054114 | Ga0501084_0225678 | Ga0501084_0225678_502_927 | 139 |
| 565 | 3300060353 | Ga0501082_0051224 | Ga0501082_0051224_729_1154 | 139 |
| 566 | 3300060353 | Ga0501082_0071386 | Ga0501082_0071386_60_515 | 139 |
| 567 | 3300061734 | Ga0530510_0133334 | Ga0530510_0133334_415_840 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c21-assembly3.cif.gz_F | specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme | 0.9 | 1 | 120 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.8958 | 1 | 121 |
| 4mtr-assembly1.cif.gz_B | zn-bound gloa2 | 0.8886 | 1 | 121 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.8873 | 1 | 122 |
| 4mtr-assembly1.cif.gz_A | zn-bound gloa2 | 0.8804 | 1 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8958 | 1 | 121 | 3.10.180.10 |
| 4mtrB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8886 | 1 | 121 | 3.10.180.10 |
| 2c21D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8878 | 1 | 120 | 3.10.180.10 |
| af_Q09751_155_302_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8571 | 1 | 121 | 3.10.180.10 |
| af_Q948T6_1_150_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.854 | 1 | 121 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534CJR0-F1-model_v4 | Lactoylglutathione lyase | 0.9987 | 82 | 139 |
GO:0016829
|
| AF-A0A3C7W1R9-F1-model_v4 | Lactoylglutathione lyase | 0.9954 | 88 | 139 |
GO:0016829
|
| AF-A0A534CJR0-F1-model_v4 | Lactoylglutathione lyase | 0.9818 | 82 | 139 |
GO:0016829
|
| AF-A0A3B8WFH9-F1-model_v4 | Lactoylglutathione lyase | 0.9708 | 85 | 139 |
GO:0016829
|
| AF-A0A812ITZ1-F1-model_v4 | deleted | 0.964 | 1 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar