F464505

General Info

Members Datasets Scaffolds Average Seq Length
567 334 543 141

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10766700|Ga0114129_107667002
Length 163
Sequence MSAPREPNCVNWEVDVALRYLHTMVRIGNIDASLDFYVKKLGMEEVRRVENEAGRYTLIFLAAPADKGRAASDRAPLLELTFNWDPEAYGEGRNFGHLAFEVDDIYATCERLMKSGVTINRPPRDGRMAFVRSPDNISIELLQKGASQPKQEPWASMPNTGKW

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
4 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
5 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
6 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
7 2854911287 Brucella lupini LUP21 Isolate Unclassified
8 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
9 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
10 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
11 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
12 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
13 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
14 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
15 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
16 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
17 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
18 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
19 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
20 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
21 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
237 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
331 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
332 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
333 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
334 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 0
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 3
Rhizoplane 6.7
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1002332 3300001978 Bacteria 1536
2 JGI24740J21852_10088030 3300001979 Bacteria 804
3 JGI24739J22299_10009851 3300001989 Bacteria 3553
4 JGI24743J22301_10018499 3300001991 Bacteria 1317
5 JGI24738J21930_10012102 3300002075 Bacteria 1887
6 JGI24744J21845_10020411 3300002077 Bacteria 1306
7 JGI24035J26624_1040892 3300002126 Bacteria 518
8 JGI25159J45721_1008703 3300002987 Bacteria 2763
9 Ga0065165_1000139 3300005262 Bacteria 126209
10 Ga0065712_10300798 3300005290 Bacteria 860
11 Ga0065707_10962379 3300005295 Bacteria 549
12 Ga0070658_10270085 3300005327 Bacteria 1446
13 Ga0070676_10003658 3300005328 Bacteria 8050
14 Ga0070683_100053092 3300005329 Bacteria 3756
15 Ga0070690_100000438 3300005330 Bacteria 21088
16 Ga0070670_100653297 3300005331 Bacteria 943
17 Ga0070677_10554822 3300005333 Bacteria 630
18 Ga0068869_100094424 3300005334 Bacteria 2255
19 Ga0070666_10061379 3300005335 Bacteria 2545
20 Ga0070680_100002037 3300005336 Bacteria 14916
21 Ga0070680_100554916 3300005336 Bacteria 985
22 Ga0070682_100000387 3300005337 Bacteria 29331
23 Ga0068868_100017196 3300005338 Bacteria 5382
24 Ga0070660_100000388 3300005339 Bacteria 29290
25 Ga0070689_100001805 3300005340 Bacteria 13754
26 Ga0070689_100978425 3300005340 Bacteria 752
27 Ga0070691_10000292 3300005341 Bacteria 17472
28 Ga0070687_100118921 3300005343 Bacteria 1508
29 Ga0070661_100000689 3300005344 Bacteria 24833
30 Ga0070692_10000219 3300005345 Bacteria 15626
31 Ga0070692_10458368 3300005345 Bacteria 817
32 Ga0070668_100037915 3300005347 Bacteria 3682
33 Ga0070668_100337586 3300005347 Bacteria 1272
34 Ga0070669_100008539 3300005353 Bacteria 7313
35 Ga0070675_100019549 3300005354 Bacteria 5399
36 Ga0070671_100005562 3300005355 Bacteria 10042
37 Ga0070671_100614722 3300005355 Bacteria 939
38 Ga0070674_100001254 3300005356 Bacteria 13338
39 Ga0070673_100000261 3300005364 Bacteria 26911
40 Ga0070673_101216782 3300005364 Bacteria 706
41 Ga0070659_100000894 3300005366 Bacteria 21817
42 Ga0070667_100000657 3300005367 Bacteria 33552
43 Ga0070703_10009380 3300005406 Bacteria 2761
44 Ga0070709_10002437 3300005434 Bacteria 10081
45 Ga0070714_100002744 3300005435 Bacteria 12973
46 Ga0070710_10002924 3300005437 Bacteria 8119
47 Ga0070701_10001727 3300005438 Bacteria 8218
48 Ga0070701_10141573 3300005438 Bacteria 1376
49 Ga0070711_100002149 3300005439 Bacteria 11175
50 Ga0070705_100002088 3300005440 Bacteria 10192
51 Ga0070705_100248803 3300005440 Bacteria 1247
52 Ga0070705_100868636 3300005440 Bacteria 723
53 Ga0070700_100004756 3300005441 Bacteria 7123
54 Ga0070694_100000328 3300005444 Bacteria 25571
55 Ga0070694_100041056 3300005444 Bacteria 3084
56 Ga0070663_100001791 3300005455 Bacteria 11959
57 Ga0070663_100249266 3300005455 Bacteria 1405
58 Ga0070663_101096451 3300005455 Bacteria 696
59 Ga0070678_100000632 3300005456 Bacteria 17253
60 Ga0070678_100918719 3300005456 Bacteria 801
61 Ga0070662_100030650 3300005457 Bacteria 3766
62 Ga0070662_100510186 3300005457 Bacteria 1004
63 Ga0070662_100779817 3300005457 Bacteria 812
64 Ga0068867_100011267 3300005459 Bacteria 6306
65 Ga0068867_100149954 3300005459 Bacteria 1831
66 Ga0068867_100731645 3300005459 Bacteria 876
67 Ga0070685_10028185 3300005466 Bacteria 3110
68 Ga0070698_100655715 3300005471 Bacteria 991
69 Ga0070698_101164530 3300005471 Bacteria 720
70 Ga0070699_100178330 3300005518 Bacteria 1885
71 Ga0070679_100084846 3300005530 Bacteria 3154
72 Ga0070679_100288615 3300005530 Bacteria 1592
73 Ga0070679_100508922 3300005530 Bacteria 1148
74 Ga0070684_100151109 3300005535 Bacteria 2104
75 Ga0070697_100095855 3300005536 Bacteria 2461
76 Ga0068853_100001286 3300005539 Bacteria 17997
77 Ga0070672_100012128 3300005543 Bacteria 6035
78 Ga0070686_100001964 3300005544 Bacteria 11415
79 Ga0070695_100001555 3300005545 Bacteria 12802
80 Ga0070695_100018457 3300005545 Bacteria 4236
81 Ga0070695_100489524 3300005545 Bacteria 949
82 Ga0070696_100004201 3300005546 Bacteria 9592
83 Ga0070696_100132244 3300005546 Bacteria 1816
84 Ga0070696_100150545 3300005546 Bacteria 1707
85 Ga0070696_100643062 3300005546 Bacteria 859
86 Ga0070693_100000155 3300005547 Bacteria 31196
87 Ga0070665_100046043 3300005548 Bacteria 4382
88 Ga0070665_100055541 3300005548 Bacteria 3971
89 Ga0070665_100169639 3300005548 Bacteria 2184
90 Ga0070704_100000688 3300005549 Bacteria 16380
91 Ga0070704_100014300 3300005549 Bacteria 4955
92 Ga0068855_100021777 3300005563 Bacteria 7687
93 Ga0068855_100124728 3300005563 Bacteria 2945
94 Ga0068855_100583639 3300005563 Bacteria 1207
95 Ga0070664_100000700 3300005564 Bacteria 25609
96 Ga0068857_100016875 3300005577 Bacteria 6397
97 Ga0068857_100627953 3300005577 Bacteria 1017
98 Ga0068854_100012167 3300005578 Bacteria 5631
99 Ga0068856_100006465 3300005614 Bacteria 11493
100 Ga0068856_100743527 3300005614 Bacteria 1001
101 Ga0068856_100879724 3300005614 Bacteria 915
102 Ga0070702_100000900 3300005615 Bacteria 11580
103 Ga0070702_100580753 3300005615 Bacteria 837
104 Ga0070702_100612316 3300005615 Bacteria 818
105 Ga0068852_100003766 3300005616 Bacteria 10635
106 Ga0068859_100003442 3300005617 Bacteria 16087
107 Ga0068859_100079479 3300005617 Bacteria 3320
108 Ga0068864_100040683 3300005618 Bacteria 3975
109 Ga0068864_100176307 3300005618 Bacteria 1952
110 Ga0068866_10006085 3300005718 Bacteria 5021
111 Ga0068861_100002000 3300005719 Bacteria 13182
112 Ga0068861_100239207 3300005719 Bacteria 1543
113 Ga0068861_100370751 3300005719 Bacteria 1262
114 Ga0068851_10009852 3300005834 Bacteria 4451
115 Ga0068863_100003165 3300005841 Bacteria 16266
116 Ga0068858_100003788 3300005842 Bacteria 14954
117 Ga0068858_100112973 3300005842 Bacteria 2537
118 Ga0068858_100267494 3300005842 Bacteria 1626
119 Ga0068860_100011302 3300005843 Bacteria 8797
120 Ga0068860_100041622 3300005843 Bacteria 4388
121 Ga0068860_100588663 3300005843 Bacteria 1117
122 Ga0068860_101508434 3300005843 Bacteria 694
123 Ga0068862_100003901 3300005844 Bacteria 12673
124 Ga0068862_100373264 3300005844 Bacteria 1328
125 Ga0068862_101379218 3300005844 Bacteria 708
126 Ga0075432_10004639 3300006058 Bacteria 4680
127 Ga0070715_10000219 3300006163 Bacteria 13624
128 Ga0070716_100001003 3300006173 Bacteria 12339
129 Ga0070712_100000382 3300006175 Bacteria 25268
130 Ga0097621_100074986 3300006237 Bacteria 2803
131 Ga0068871_100036883 3300006358 Bacteria 3895
132 Ga0075428_100005355 3300006844 Bacteria 14267
133 Ga0075428_100025063 3300006844 Bacteria 6599
134 Ga0075428_100048914 3300006844 Bacteria 4640
135 Ga0075430_100113127 3300006846 Bacteria 2263
136 Ga0075431_100020190 3300006847 Bacteria 6804
137 Ga0075433_10023713 3300006852 Bacteria 5168
138 Ga0075433_10071637 3300006852 Bacteria 3046
139 Ga0075433_10577726 3300006852 Bacteria 987
140 Ga0075433_10660214 3300006852 Bacteria 917
141 Ga0075434_100000816 3300006871 Bacteria 24729
142 Ga0075434_100228863 3300006871 Bacteria 1878
143 Ga0075429_100066687 3300006880 Bacteria 3134
144 Ga0068865_100001670 3300006881 Bacteria 12986
145 Ga0075436_100010755 3300006914 Bacteria 6276
146 Ga0097620_100003442 3300006931 Bacteria 16087
147 Ga0097620_100079478 3300006931 Bacteria 3320
148 Ga0075435_100013741 3300007076 Bacteria 6033
149 Ga0075435_100296757 3300007076 Bacteria 1382
150 Ga0075435_100630022 3300007076 Bacteria 930
151 Ga0099795_10000277 3300007788 Bacteria 9160
152 Ga0105251_10051940 3300009011 Bacteria 1953
153 Ga0105250_10004911 3300009092 Bacteria 6076
154 Ga0105240_10087353 3300009093 Bacteria 3819
155 Ga0111539_10003231 3300009094 Bacteria 21556
156 Ga0111539_10025839 3300009094 Bacteria 7190
157 Ga0111539_10042888 3300009094 Bacteria 5428
158 Ga0111539_10261458 3300009094 Bacteria 2015
159 Ga0111539_11782060 3300009094 Bacteria 714
160 Ga0111539_12934380 3300009094 Bacteria 552
161 Ga0105245_10000729 3300009098 Bacteria 29644
162 Ga0105245_10322741 3300009098 Bacteria 1522
163 Ga0105245_10462571 3300009098 Bacteria 1279
164 Ga0105245_10796714 3300009098 Bacteria 983
165 Ga0105245_11049798 3300009098 Bacteria 860
166 Ga0105247_10000684 3300009101 Bacteria 26726
167 Ga0105247_10048586 3300009101 Bacteria 2606
168 Ga0114129_10262815 3300009147 Bacteria 2312
169 Ga0114129_10451995 3300009147 Bacteria 1685
170 Ga0114129_10766700 3300009147 Bacteria 1234
171 Ga0114129_12121847 3300009147 Bacteria 677
172 Ga0114129_12210865 3300009147 Bacteria 662
173 Ga0105243_10585268 3300009148 Bacteria 1072
174 Ga0105243_10600539 3300009148 Bacteria 1059
175 Ga0105241_10001572 3300009174 Bacteria 17474
176 Ga0105242_10000957 3300009176 Bacteria 22525
177 Ga0105242_10400007 3300009176 Bacteria 1281
178 Ga0105248_10000854 3300009177 Bacteria 34286
179 Ga0105248_10202816 3300009177 Bacteria 2234
180 Ga0105237_10000974 3300009545 Bacteria 38484
181 Ga0105237_10632355 3300009545 Bacteria 1077
182 Ga0105238_10015589 3300009551 Bacteria 7694
183 Ga0105249_10000677 3300009553 Bacteria 30987
184 Ga0105249_10000819 3300009553 Bacteria 28036
185 Ga0105249_10433334 3300009553 Bacteria 1351
186 Ga0105249_10996849 3300009553 Bacteria 906
187 Ga0105249_11379435 3300009553 Bacteria 777
188 Ga0105028_136920 3300009993 Bacteria 549
189 Ga0099796_10112416 3300010159 Bacteria 1038
190 Ga0105239_10194373 3300010375 Bacteria 2272
191 Ga0105239_10364602 3300010375 Bacteria 1632
192 Ga0105239_10714834 3300010375 Bacteria 1146
193 Ga0105239_10862667 3300010375 Bacteria 1038
194 Ga0105246_10088196 3300011119 Bacteria 2228
195 Ga0157373_10045042 3300013100 Bacteria 3149
196 Ga0157373_10087372 3300013100 Bacteria 2197
197 Ga0157373_10177370 3300013100 Bacteria 1500
198 Ga0157371_10623784 3300013102 Bacteria 803
199 Ga0157370_10433797 3300013104 Bacteria 1208
200 Ga0157369_10003955 3300013105 Bacteria 17571
201 Ga0157374_10009897 3300013296 Bacteria 8182
202 Ga0157374_11345889 3300013296 Bacteria 736
203 Ga0157378_10005422 3300013297 Bacteria 11185
204 Ga0163162_10011008 3300013306 Bacteria 8808
205 Ga0163162_10172389 3300013306 Bacteria 2288
206 Ga0163162_10259420 3300013306 Bacteria 1870
207 Ga0163162_10310914 3300013306 Bacteria 1708
208 Ga0157372_10004565 3300013307 Bacteria 14741
209 Ga0157372_10009106 3300013307 Bacteria 10547
210 Ga0157375_10003432 3300013308 Bacteria 13745
211 Ga0157375_10098179 3300013308 Bacteria 3005
212 Ga0157375_11949552 3300013308 Bacteria 698
213 Ga0163163_10059879 3300014325 Bacteria 3768
214 Ga0163163_10136227 3300014325 Bacteria 2497
215 Ga0157380_10004146 3300014326 Bacteria 10018
216 Ga0157380_10291523 3300014326 Bacteria 1498
217 Ga0157377_10059168 3300014745 Bacteria 2183
218 Ga0157379_10000639 3300014968 Bacteria 28232
219 Ga0157379_10009390 3300014968 Bacteria 8523
220 Ga0157379_10332947 3300014968 Bacteria 1387
221 Ga0163161_10000811 3300017792 Bacteria 24480
222 Ga0163161_10284256 3300017792 Bacteria 1298
223 Ga0163161_10454753 3300017792 Bacteria 1036
224 Ga0213875_10138389 3300021388 Bacteria 1139
225 Ga0209130_1000148 3300025284 Bacteria 109763
226 Ga0207426_1012161 3300025302 Bacteria 3246
227 Ga0207697_10028477 3300025315 Bacteria 2285
228 Ga0207682_10315678 3300025893 Bacteria 734
229 Ga0207692_10001348 3300025898 Bacteria 9162
230 Ga0207642_10003100 3300025899 Bacteria 5211
231 Ga0207710_10001714 3300025900 Bacteria 10605
232 Ga0207710_10028626 3300025900 Bacteria 2419
233 Ga0207688_10005293 3300025901 Bacteria 7010
234 Ga0207680_10027119 3300025903 Bacteria 3185
235 Ga0207647_10015318 3300025904 Bacteria 5260
236 Ga0207685_10191990 3300025905 Bacteria 954
237 Ga0207699_10007512 3300025906 Bacteria 5333
238 Ga0207645_10001793 3300025907 Bacteria 17329
239 Ga0207645_10073473 3300025907 Bacteria 2189
240 Ga0207705_10455336 3300025909 Bacteria 992
241 Ga0207654_10003238 3300025911 Bacteria 8223
242 Ga0207695_10067858 3300025913 Bacteria 3656
243 Ga0207671_10010988 3300025914 Bacteria 7413
244 Ga0207693_10000998 3300025915 Bacteria 25439
245 Ga0207693_10079594 3300025915 Bacteria 2565
246 Ga0207663_10000837 3300025916 Bacteria 13939
247 Ga0207660_10234578 3300025917 Bacteria 1443
248 Ga0207662_10170737 3300025918 Bacteria 1394
249 Ga0207657_10000516 3300025919 Bacteria 40906
250 Ga0207657_10984135 3300025919 Bacteria 648
251 Ga0207649_10002753 3300025920 Bacteria 9738
252 Ga0207652_10088431 3300025921 Bacteria 2718
253 Ga0207652_10369615 3300025921 Bacteria 1294
254 Ga0207681_10003176 3300025923 Bacteria 10317
255 Ga0207694_10033863 3300025924 Bacteria 3915
256 Ga0207650_10014007 3300025925 Bacteria 5568
257 Ga0207659_10013897 3300025926 Bacteria 5176
258 Ga0207687_10012258 3300025927 Bacteria 5606
259 Ga0207687_11511370 3300025927 Bacteria 577
260 Ga0207700_10104090 3300025928 Bacteria 2270
261 Ga0207664_10007339 3300025929 Bacteria 7639
262 Ga0207644_10012966 3300025931 Bacteria 5545
263 Ga0207690_10002745 3300025932 Bacteria 10630
264 Ga0207706_10002149 3300025933 Bacteria 19260
265 Ga0207706_10404893 3300025933 Bacteria 1183
266 Ga0207686_10497574 3300025934 Bacteria 945
267 Ga0207709_10003398 3300025935 Bacteria 9503
268 Ga0207670_10002453 3300025936 Bacteria 9731
269 Ga0207670_10300231 3300025936 Bacteria 1257
270 Ga0207669_10392546 3300025937 Bacteria 1084
271 Ga0207669_10551640 3300025937 Bacteria 930
272 Ga0207704_10007724 3300025938 Bacteria 5100
273 Ga0207665_10000327 3300025939 Bacteria 32933
274 Ga0207691_10001520 3300025940 Bacteria 23080
275 Ga0207711_10016399 3300025941 Bacteria 6159
276 Ga0207711_10134070 3300025941 Bacteria 2223
277 Ga0207689_10109799 3300025942 Bacteria 2266
278 Ga0207661_10036503 3300025944 Bacteria 3837
279 Ga0207679_10011510 3300025945 Bacteria 5734
280 Ga0207667_10048400 3300025949 Bacteria 4495
281 Ga0207667_10508776 3300025949 Bacteria 1221
282 Ga0207651_10003086 3300025960 Bacteria 8095
283 Ga0207712_10008549 3300025961 Bacteria 6472
284 Ga0207712_10207549 3300025961 Bacteria 1558
285 Ga0207668_10000750 3300025972 Bacteria 19837
286 Ga0207640_10013632 3300025981 Bacteria 4665
287 Ga0207658_10015910 3300025986 Bacteria 5165
288 Ga0207658_10099507 3300025986 Bacteria 2275
289 Ga0207677_10001747 3300026023 Bacteria 11514
290 Ga0207677_10385929 3300026023 Bacteria 1183
291 Ga0207703_10016044 3300026035 Bacteria 5842
292 Ga0207703_10123674 3300026035 Bacteria 2224
293 Ga0207703_10211017 3300026035 Bacteria 1731
294 Ga0207639_10001489 3300026041 Bacteria 15765
295 Ga0207678_10001037 3300026067 Bacteria 25384
296 Ga0207678_10087333 3300026067 Bacteria 2665
297 Ga0207708_10001427 3300026075 Bacteria 17929
298 Ga0207708_10043008 3300026075 Bacteria 3442
299 Ga0207708_11309830 3300026075 Bacteria 635
300 Ga0207702_10260873 3300026078 Bacteria 1631
301 Ga0207702_10965549 3300026078 Bacteria 845
302 Ga0207641_10007269 3300026088 Bacteria 9226
303 Ga0207648_10119341 3300026089 Bacteria 2318
304 Ga0207648_10157288 3300026089 Bacteria 2006
305 Ga0207648_10274667 3300026089 Bacteria 1506
306 Ga0207676_10505190 3300026095 Bacteria 1148
307 Ga0207674_10008428 3300026116 Bacteria 11909
308 Ga0207675_100001630 3300026118 Bacteria 22489
309 Ga0207675_100061833 3300026118 Bacteria 3496
310 Ga0207675_102274861 3300026118 Bacteria 556
311 Ga0207683_10000351 3300026121 Bacteria 42117
312 Ga0207698_10011180 3300026142 Bacteria 5807
313 Ga0209982_1015127 3300027552 Bacteria 1169
314 Ga0207428_10000848 3300027907 Bacteria 34448
315 Ga0207428_10009164 3300027907 Bacteria 8894
316 Ga0207428_10314720 3300027907 Bacteria 1157
317 Ga0268266_10009645 3300028379 Bacteria 8490
318 Ga0268266_10098975 3300028379 Bacteria 2567
319 Ga0268266_10912769 3300028379 Bacteria 849
320 Ga0268265_10082932 3300028380 Bacteria 2536
321 Ga0268265_10156047 3300028380 Bacteria 1932
322 Ga0268264_10007128 3300028381 Bacteria 9370
323 Ga0268264_10081525 3300028381 Bacteria 2765
324 Ga0268264_10487459 3300028381 Bacteria 1200
325 Ga0268264_11308790 3300028381 Bacteria 735
326 Ga0268264_11313734 3300028381 Bacteria 733
327 Ga0307515_10041543 3300028794 Bacteria 7225
328 Ga0265339_10131861 3300031249 Bacteria 1277
329 Ga0307413_10033805 3300031824 Bacteria 2916
330 Ga0307410_10093742 3300031852 Bacteria 2137
331 Ga0307407_10390983 3300031903 Bacteria 995
332 Ga0307412_11694705 3300031911 Bacteria 579
333 Ga0307409_100865340 3300031995 Bacteria 915
334 Ga0307411_10062011 3300032005 Bacteria 2492
335 Ga0316583_10276920 3300032133 Bacteria 581
336 Ga0373959_0018780 3300034820 Bacteria 1304
337 Ga0373934_0395611 3300035086 Bacteria 577
338 Ga0373940_0163197 3300035088 Bacteria 716
339 Ga0373949_0016771 3300035090 Bacteria 1645
340 Ga0373952_0050653 3300035092 Bacteria 989
341 Ga0373932_0015228 3300035112 Bacteria 1947
342 Ga0373939_0007872 3300035114 Bacteria 2598
343 Ga0373939_0112948 3300035114 Bacteria 948
344 Ga0373941_0212663 3300035115 Bacteria 740
345 Ga0373960_0021175 3300035121 Bacteria 1727
346 Ga0373960_0226034 3300035121 Bacteria 671
347 Ga0373962_0035130 3300035242 Bacteria 1391
348 Ga0373931_0038762 3300035691 Bacteria 2494
349 Ga0373931_0117931 3300035691 Bacteria 1514
350 Ga0373931_0127847 3300035691 Bacteria 1459
351 Ga0373931_1109884 3300035691 Bacteria 539
352 Ga0373935_0291975 3300035692 Bacteria 1150
353 Ga0395899_0798554 3300037312 Bacteria 583
354 Ga0395899_0817820 3300037312 Bacteria 574
355 Ga0395900_0016744 3300037418 Bacteria 7479
356 Ga0395900_0033099 3300037418 Bacteria 5320
357 Ga0395898_0012412 3300037466 Bacteria 8808
358 Ga0395905_0003223 3300037471 Bacteria 17551
359 Ga0395905_0004050 3300037471 Bacteria 15372
360 Ga0395905_0023167 3300037471 Bacteria 5870
361 Ga0395905_0271728 3300037471 Bacteria 1581
362 Ga0395905_0646513 3300037471 Bacteria 959
363 Ga0436364_0106943 3300037853 Bacteria 1356
364 Ga0395901_0002307 3300038443 Bacteria 19441
365 Ga0395901_0024398 3300038443 Bacteria 6206
366 Ga0395901_0151929 3300038443 Bacteria 2433
367 Ga0395901_0162507 3300038443 Bacteria 2345
368 Ga0395901_0512617 3300038443 Bacteria 1219
369 Ga0242420_016057 3300038996 Bacteria 1300
370 Ga0436365_0298347 3300039437 Bacteria 3147
371 Ga0436365_1488000 3300039437 Bacteria 2002
372 Ga0436363_1683999 3300039450 Bacteria 724
373 Ga0436362_0392232 3300039453 Bacteria 566
374 Ga0451804_1098456 3300041463 Bacteria 542
375 Ga0451807_2417449 3300041486 Unclassified 596
376 Ga0451853_1916364 3300041512 Bacteria 829
377 Ga0439448_0072126 3300042005 Bacteria 1151
378 Ga0451577_0103421 3300042876 Bacteria 2545
379 Ga0466969_0006879 3300044656 Bacteria 6053
380 Ga0453684_0064854 3300044712 Bacteria 4661
381 Ga0466959_0118251 3300045049 Bacteria 1886
382 Ga0451576_0021118 3300045051 Bacteria 7078
383 Ga0466967_0518382 3300045976 Bacteria 1171
384 Ga0466967_1430111 3300045976 Bacteria 689
385 Ga0495603_0095535 3300046455 Bacteria 1737
386 Ga0495584_0221712 3300046491 Bacteria 961
387 Ga0495663_0084891 3300046525 Bacteria 1025
388 Ga0495640_0812314 3300046533 Bacteria 557
389 Ga0495659_0221145 3300046664 Bacteria 782
390 Ga0496100_0004200 3300048903 Bacteria 7600
391 Ga0496100_0029702 3300048903 Bacteria 3384
392 Ga0496100_0167650 3300048903 Bacteria 1579
393 Ga0496101_0060595 3300048904 Bacteria 2746
394 Ga0496102_0043736 3300048905 Bacteria 4062
395 Ga0496102_0206610 3300048905 Bacteria 1851
396 Ga0496103_0033024 3300048906 Bacteria 3160
397 Ga0496103_0451697 3300048906 Bacteria 824
398 Ga0496104_0005063 3300048907 Bacteria 11496
399 Ga0496104_0009183 3300048907 Bacteria 8792
400 Ga0496105_0009909 3300048908 Bacteria 7472
401 Ga0496105_0306154 3300048908 Bacteria 1276
402 Ga0496106_0007965 3300048909 Bacteria 7829
403 Ga0496106_0040950 3300048909 Bacteria 3471
404 Ga0496106_0538295 3300048909 Bacteria 937
405 Ga0496107_0009229 3300048910 Bacteria 6835
406 Ga0496107_0072591 3300048910 Bacteria 2502
407 Ga0496107_0201197 3300048910 Bacteria 1480
408 Ga0496108_0009910 3300048911 Bacteria 7723
409 Ga0496109_0054964 3300048912 Bacteria 3631
410 Ga0496109_0615727 3300048912 Bacteria 1022
411 Ga0496110_0011546 3300048913 Bacteria 7237
412 Ga0496110_0043061 3300048913 Bacteria 3941
413 Ga0496110_0236520 3300048913 Bacteria 1662
414 Ga0496111_0005813 3300048914 Bacteria 7953
415 Ga0496111_0479332 3300048914 Bacteria 917
416 Ga0496112_0008663 3300048915 Bacteria 9120
417 Ga0496112_0181790 3300048915 Bacteria 2066
418 Ga0496112_0343241 3300048915 Bacteria 1436
419 Ga0496113_0004893 3300048916 Bacteria 8298
420 Ga0496113_0084581 3300048916 Bacteria 2436
421 Ga0496113_0443418 3300048916 Bacteria 1043
422 Ga0496114_0005724 3300048917 Bacteria 9750
423 Ga0496115_0004344 3300048918 Bacteria 10258
424 Ga0496115_0071340 3300048918 Bacteria 2817
425 Ga0496115_0579361 3300048918 Bacteria 894
426 Ga0496119_0252665 3300048922 Bacteria 888
427 Ga0496119_0502286 3300048922 Bacteria 564
428 Ga0496122_0218147 3300048925 Bacteria 1097
429 Ga0496123_0038623 3300048926 Bacteria 3353
430 Ga0496123_0189773 3300048926 Bacteria 1064
431 Ga0501031_0005682 3300049568 Bacteria 8126
432 Ga0501032_0533074 3300049569 Bacteria 749
433 Ga0501033_0021281 3300049570 Bacteria 4892
434 Ga0501033_0048718 3300049570 Bacteria 3147
435 Ga0501033_0056907 3300049570 Bacteria 2890
436 Ga0501033_0165133 3300049570 Bacteria 1592
437 Ga0501034_0120551 3300049571 Bacteria 2609
438 Ga0501034_0333773 3300049571 Bacteria 1447
439 Ga0501036_0127414 3300049572 Bacteria 2150
440 Ga0501036_0292143 3300049572 Bacteria 1363
441 Ga0501036_1030803 3300049572 Bacteria 673
442 Ga0501037_0161736 3300049573 Bacteria 1596
443 Ga0501037_0171170 3300049573 Bacteria 1543
444 Ga0501038_0068438 3300049574 Bacteria 3018
445 Ga0501039_0141278 3300049575 Bacteria 1891
446 Ga0501040_0039252 3300049576 Bacteria 3219
447 Ga0501040_0060207 3300049576 Bacteria 2609
448 Ga0501041_0036276 3300049577 Bacteria 2987
449 Ga0501041_0338062 3300049577 Bacteria 951
450 Ga0501042_0126366 3300049578 Bacteria 1841
451 Ga0501043_0014056 3300049579 Bacteria 6265
452 Ga0501043_0251695 3300049579 Bacteria 1360
453 Ga0501043_0262011 3300049579 Bacteria 1329
454 Ga0501046_0019989 3300049580 Bacteria 5544
455 Ga0501046_0024802 3300049580 Bacteria 4914
456 Ga0501046_0248995 3300049580 Bacteria 1308
457 Ga0501046_1086756 3300049580 Bacteria 553
458 Ga0501047_0007534 3300049581 Bacteria 10248
459 Ga0501047_0058256 3300049581 Bacteria 3731
460 Ga0501048_0047231 3300049582 Bacteria 3072
461 Ga0501048_0289474 3300049582 Bacteria 1165
462 Ga0501048_0652568 3300049582 Bacteria 755
463 Ga0501048_1063668 3300049582 Bacteria 582
464 Ga0501067_0099779 3300049583 Bacteria 1612
465 Ga0501068_0019286 3300049584 Bacteria 3957
466 Ga0501068_0277657 3300049584 Bacteria 1070
467 Ga0501068_0311427 3300049584 Bacteria 1008
468 Ga0501068_0324581 3300049584 Bacteria 987
469 Ga0501068_1118321 3300049584 Bacteria 521
470 Ga0501069_0820609 3300049585 Bacteria 564
471 Ga0501070_0004914 3300049586 Bacteria 11416
472 Ga0501070_0769458 3300049586 Bacteria 758
473 Ga0501071_0300222 3300049587 Bacteria 1217
474 Ga0501072_0324826 3300049588 Bacteria 1223
475 Ga0501073_0081763 3300049589 Bacteria 2247
476 Ga0501073_0096993 3300049589 Bacteria 2047
477 Ga0501074_0046656 3300049590 Bacteria 3132
478 Ga0501074_0070617 3300049590 Bacteria 2510
479 Ga0501074_0093084 3300049590 Bacteria 2158
480 Ga0501075_0053501 3300049591 Bacteria 3036
481 Ga0501075_0117123 3300049591 Bacteria 2025
482 Ga0501075_0386604 3300049591 Bacteria 1067
483 Ga0501076_0129484 3300049592 Bacteria 2046
484 Ga0501076_0358212 3300049592 Bacteria 1198
485 Ga0501076_1407917 3300049592 Bacteria 573
486 Ga0501077_0110718 3300049593 Bacteria 1740
487 Ga0501077_0231486 3300049593 Bacteria 1174
488 Ga0501077_0242933 3300049593 Bacteria 1144
489 Ga0501079_0010630 3300049741 Bacteria 7005
490 Ga0501079_0045265 3300049741 Bacteria 3396
491 Ga0501079_0208955 3300049741 Bacteria 1525
492 Ga0501080_0128641 3300049742 Bacteria 2345
493 Ga0501081_0019065 3300049743 Bacteria 4563
494 Ga0501081_0221043 3300049743 Bacteria 1377
495 Ga0501081_0386577 3300049743 Bacteria 1035
496 Ga0501081_0924334 3300049743 Bacteria 658
497 Ga0501083_0010130 3300049744 Bacteria 6643
498 Ga0501083_0061110 3300049744 Bacteria 2516
499 Ga0501083_0181885 3300049744 Bacteria 1373
500 Ga0501035_0031055 3300049822 Bacteria 4865
501 Ga0501035_0099958 3300049822 Bacteria 2546
502 Ga0501044_0009754 3300049823 Bacteria 10445
503 Ga0501044_0014236 3300049823 Bacteria 8590
504 Ga0501044_0136287 3300049823 Bacteria 2446
505 Ga0501044_0244631 3300049823 Bacteria 1737
506 Ga0501045_0313855 3300049824 Bacteria 1166
507 Ga0501045_0475089 3300049824 Bacteria 929
508 nmdc:mga05p37_120064_c1 3300050507 Bacteria 3229
509 nmdc:mga05p37_310678_c1 3300050507 Bacteria 1869
510 nmdc:mga05p37_516393_c1 3300050507 Bacteria 1367
511 nmdc:mga05p37_879413_c1 3300050507 Bacteria 969
512 nmdc:mga09592_312513_c1 3300050508 Bacteria 1362
513 nmdc:mga09592_612529_c1 3300050508 Bacteria 932
514 nmdc:mga09592_89845_c1 3300050508 Bacteria 2624
515 nmdc:mga0qj67_46110_c1 3300050509 Bacteria 3441
516 nmdc:mga06r32_234051_c1 3300050510 Bacteria 1825
517 nmdc:mga06r32_331556_c1 3300050510 Bacteria 1507
518 nmdc:mga06r32_561355_c1 3300050510 Bacteria 1115
519 nmdc:mga08y16_102399_c1 3300050511 Bacteria 2981
520 nmdc:mga08y16_1871768_c1 3300050511 Bacteria 552
521 nmdc:mga08y16_456041_c1 3300050511 Bacteria 1303
522 nmdc:mga08y16_595696_c1 3300050511 Bacteria 1115
523 nmdc:mga08y16_70374_c1 3300050511 Bacteria 3647
524 nmdc:mga0n895_487618_c1 3300050512 Bacteria 1243
525 nmdc:mga0n895_9664_c1 3300050512 Bacteria 8456
526 nmdc:mga0rr50_7289_c1 3300050513 Bacteria 6804
527 nmdc:mga0rr50_7300_c1 3300050513 Bacteria 6801
528 nmdc:mga08x19_265765_c1 3300050514 Bacteria 1187
529 nmdc:mga0a205_155332_c1 3300050515 Bacteria 2187
530 nmdc:mga0a205_43542_c1 3300050515 Bacteria 4328
531 nmdc:mga0a205_862_c1 3300050515 Bacteria 24830
532 nmdc:mga0sz30_62281_c1 3300050516 Bacteria 1595
533 Ga0500568_0086419 3300053139 Bacteria 1186
534 Ga0501084_0007831 3300054114 Bacteria 8792
535 Ga0501084_0011362 3300054114 Bacteria 7374
536 Ga0501084_0075694 3300054114 Bacteria 2820
537 Ga0501084_0225678 3300054114 Bacteria 1581
538 Ga0501082_0051224 3300060353 Bacteria 3558
539 Ga0501082_0071386 3300060353 Bacteria 2990
540 Ga0501082_0102677 3300060353 Bacteria 2473
541 Ga0501082_1071448 3300060353 Bacteria 705
542 Ga0530510_0133334 3300061734 Bacteria 1828
543 Ga0530510_1508512 3300061734 Bacteria 516

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_1109884 Ga0373931_1109884_47_454 129
2 3300041486 Ga0451807_2417449 Ga0451807_2417449_80_481 129
3 3300049568 Ga0501031_0005682 Ga0501031_0005682_4340_4771 131
4 3300049570 Ga0501033_0021281 Ga0501033_0021281_1674_2105 131
5 3300049571 Ga0501034_0120551 Ga0501034_0120551_831_1262 131
6 3300049572 Ga0501036_0292143 Ga0501036_0292143_822_1253 131
7 3300049573 Ga0501037_0171170 Ga0501037_0171170_871_1302 131
8 3300049576 Ga0501040_0039252 Ga0501040_0039252_242_673 131
9 3300049579 Ga0501043_0014056 Ga0501043_0014056_3470_3901 131
10 3300049580 Ga0501046_0024802 Ga0501046_0024802_2086_2517 131
11 3300049581 Ga0501047_0058256 Ga0501047_0058256_3059_3490 131
12 3300049582 Ga0501048_0652568 Ga0501048_0652568_82_513 131
13 3300049583 Ga0501067_0099779 Ga0501067_0099779_502_933 131
14 3300049584 Ga0501068_0311427 Ga0501068_0311427_252_683 131
15 3300049587 Ga0501071_0300222 Ga0501071_0300222_10_441 131
16 3300049589 Ga0501073_0096993 Ga0501073_0096993_1186_1617 131
17 3300049590 Ga0501074_0093084 Ga0501074_0093084_451_882 131
18 3300049744 Ga0501083_0010130 Ga0501083_0010130_6027_6458 131
19 3300049822 Ga0501035_0031055 Ga0501035_0031055_2037_2468 131
20 3300049823 Ga0501044_0014236 Ga0501044_0014236_794_1225 131
21 3300054114 Ga0501084_0075694 Ga0501084_0075694_1508_1939 131
22 3300060353 Ga0501082_0102677 Ga0501082_0102677_1166_1597 131
23 3300009098 Ga0105245_11049798 Ga0105245_110497982 132
24 3300041512 Ga0451853_1916364 Ga0451853_1916364_42_476 132
25 3300005549 Ga0070704_100014300 Ga0070704_1000143004 133
26 3300005577 Ga0068857_100627953 Ga0068857_1006279532 133
27 3300007788 Ga0099795_10000277 Ga0099795_100002777 133
28 3300009094 Ga0111539_10025839 Ga0111539_100258393 133
29 3300009098 Ga0105245_10796714 Ga0105245_107967141 133
30 3300009147 Ga0114129_12121847 Ga0114129_121218471 133
31 3300009148 Ga0105243_10600539 Ga0105243_106005392 133
32 3300009545 Ga0105237_10632355 Ga0105237_106323551 133
33 3300009553 Ga0105249_10000819 Ga0105249_1000081927 133
34 3300009553 Ga0105249_10996849 Ga0105249_109968491 133
35 3300009993 Ga0105028_136920 Ga0105028_1369201 133
36 3300010159 Ga0099796_10112416 Ga0099796_101124162 133
37 3300010375 Ga0105239_10194373 Ga0105239_101943733 133
38 3300013100 Ga0157373_10177370 Ga0157373_101773703 133
39 3300013306 Ga0163162_10172389 Ga0163162_101723892 133
40 3300013307 Ga0157372_10004565 Ga0157372_1000456515 133
41 3300014325 Ga0163163_10136227 Ga0163163_101362272 133
42 3300014326 Ga0157380_10291523 Ga0157380_102915232 133
43 3300014968 Ga0157379_10332947 Ga0157379_103329471 133
44 3300035114 Ga0373939_0112948 Ga0373939_0112948_512_934 133
45 3300035121 Ga0373960_0226034 Ga0373960_0226034_228_650 133
46 3300035242 Ga0373962_0035130 Ga0373962_0035130_89_511 133
47 3300035691 Ga0373931_0038762 Ga0373931_0038762_636_1058 133
48 3300035692 Ga0373935_0291975 Ga0373935_0291975_22_444 133
49 3300041463 Ga0451804_1098456 Ga0451804_1098456_24_440 133
50 3300042005 Ga0439448_0072126 Ga0439448_0072126_92_532 133
51 3300044656 Ga0466969_0006879 Ga0466969_0006879_169_570 133
52 3300045049 Ga0466959_0118251 Ga0466959_0118251_1091_1492 133
53 3300046533 Ga0495640_0812314 Ga0495640_0812314_73_495 133
54 3300048903 Ga0496100_0029702 Ga0496100_0029702_1118_1540 133
55 3300048907 Ga0496104_0005063 Ga0496104_0005063_4054_4476 133
56 3300048908 Ga0496105_0306154 Ga0496105_0306154_446_868 133
57 3300048909 Ga0496106_0040950 Ga0496106_0040950_1721_2143 133
58 3300048910 Ga0496107_0072591 Ga0496107_0072591_625_1047 133
59 3300048913 Ga0496110_0011546 Ga0496110_0011546_2633_3055 133
60 3300048914 Ga0496111_0479332 Ga0496111_0479332_480_902 133
61 3300048915 Ga0496112_0181790 Ga0496112_0181790_485_907 133
62 3300048922 Ga0496119_0502286 Ga0496119_0502286_122_553 133
63 3300048925 Ga0496122_0218147 Ga0496122_0218147_64_495 133
64 3300049592 Ga0501076_1407917 Ga0501076_1407917_101_523 133
65 3300049824 Ga0501045_0475089 Ga0501045_0475089_171_578 133
66 3300050507 nmdc:mga05p37_120064_c1 nmdc:mga05p37_120064_c1_1382_1804 133
67 3300050508 nmdc:mga09592_312513_c1 nmdc:mga09592_312513_c1_279_701 133
68 3300050509 nmdc:mga0qj67_46110_c1 nmdc:mga0qj67_46110_c1_319_741 133
69 3300050510 nmdc:mga06r32_331556_c1 nmdc:mga06r32_331556_c1_897_1319 133
70 3300050511 nmdc:mga08y16_70374_c1 nmdc:mga08y16_70374_c1_3146_3568 133
71 3300060353 Ga0501082_1071448 Ga0501082_1071448_111_533 133
72 3300061734 Ga0530510_1508512 Ga0530510_1508512_54_476 133
73 3300005457 Ga0070662_100510186 Ga0070662_1005101862 134
74 3300005563 Ga0068855_100124728 Ga0068855_1001247284 134
75 3300005563 Ga0068855_100583639 Ga0068855_1005836392 134
76 3300005614 Ga0068856_100743527 Ga0068856_1007435272 134
77 3300013100 Ga0157373_10045042 Ga0157373_100450424 134
78 3300013104 Ga0157370_10433797 Ga0157370_104337972 134
79 3300025949 Ga0207667_10508776 Ga0207667_105087761 134
80 3300031824 Ga0307413_10033805 Ga0307413_100338053 134
81 3300031852 Ga0307410_10093742 Ga0307410_100937423 134
82 3300031903 Ga0307407_10390983 Ga0307407_103909832 134
83 3300031911 Ga0307412_11694705 Ga0307412_116947052 134
84 3300031995 Ga0307409_100865340 Ga0307409_1008653402 134
85 3300032005 Ga0307411_10062011 Ga0307411_100620113 134
86 3300037312 Ga0395899_0798554 Ga0395899_0798554_33_449 134
87 3300037418 Ga0395900_0016744 Ga0395900_0016744_2390_2806 134
88 3300037471 Ga0395905_0003223 Ga0395905_0003223_6552_6968 134
89 3300037471 Ga0395905_0023167 Ga0395905_0023167_5350_5766 134
90 3300037471 Ga0395905_0271728 Ga0395905_0271728_638_1057 134
91 3300037471 Ga0395905_0646513 Ga0395905_0646513_18_434 134
92 3300038443 Ga0395901_0002307 Ga0395901_0002307_103_519 134
93 3300038443 Ga0395901_0151929 Ga0395901_0151929_1921_2337 134
94 3300038443 Ga0395901_0162507 Ga0395901_0162507_1875_2291 134
95 3300038443 Ga0395901_0512617 Ga0395901_0512617_455_871 134
96 3300039437 Ga0436365_1488000 Ga0436365_1488000_1391_1813 134
97 3300039450 Ga0436363_1683999 Ga0436363_1683999_273_695 134
98 3300039453 Ga0436362_0392232 Ga0436362_0392232_38_460 134
99 3300045976 Ga0466967_0518382 Ga0466967_0518382_174_590 134
100 iso_pu_bacteria 2507262055 2507508768 134
101 iso_pu_bacteria 2508501042 2508691375 134
102 iso_pu_bacteria 2515154112 2515628183 134
103 iso_pu_bacteria 2847930680 2847936043 134
104 iso_pu_bacteria 2879083081 2879085501 134
105 iso_pu_bacteria 2906626472 2906629909 134
106 iso_pu_bacteria 2935608549 2935608693 134
107 iso_pu_bacteria 2935819856 2935821833 134
108 iso_pu_bacteria 2935847175 2935847436 134
109 iso_pu_bacteria 2935908558 2935909297 134
110 iso_pu_bacteria 2935916978 2935920018 134
111 iso_pu_bacteria 2935926038 2935926129 134
112 iso_pu_bacteria 2935934488 2935934579 134
113 iso_pu_bacteria 2935942939 2935943029 134
114 iso_pu_bacteria 2935951376 2935951467 134
115 iso_pu_bacteria 2935967501 2935967592 134
116 iso_pu_bacteria 8019629233 8019634663 134
117 iso_pu_bacteria 8019668869 8019672053 134
118 iso_pu_bacteria 8019678201 8019684043 134
119 iso_pu_bacteria 8019687851 8019689865 134
120 3300005440 Ga0070705_100868636 Ga0070705_1008686362 135
121 3300005530 Ga0070679_100288615 Ga0070679_1002886153 135
122 3300013102 Ga0157371_10623784 Ga0157371_106237842 135
123 3300025921 Ga0207652_10369615 Ga0207652_103696153 135
124 3300049570 Ga0501033_0165133 Ga0501033_0165133_753_1178 135
125 3300049571 Ga0501034_0333773 Ga0501034_0333773_603_1028 135
126 3300049572 Ga0501036_0127414 Ga0501036_0127414_383_808 135
127 3300049573 Ga0501037_0161736 Ga0501037_0161736_158_583 135
128 3300049579 Ga0501043_0262011 Ga0501043_0262011_871_1296 135
129 3300049580 Ga0501046_1086756 Ga0501046_1086756_89_514 135
130 3300049581 Ga0501047_0007534 Ga0501047_0007534_9659_10084 135
131 3300049582 Ga0501048_0289474 Ga0501048_0289474_615_1040 135
132 3300049586 Ga0501070_0004914 Ga0501070_0004914_7801_8226 135
133 3300049586 Ga0501070_0769458 Ga0501070_0769458_137_556 135
134 3300049822 Ga0501035_0099958 Ga0501035_0099958_718_1143 135
135 3300049823 Ga0501044_0009754 Ga0501044_0009754_9813_10238 135
136 3300049823 Ga0501044_0136287 Ga0501044_0136287_1221_1646 135
137 iso_pu_bacteria 2643221564 2643837228 135
138 iso_pu_bacteria 2837678835 2837680483 135
139 iso_pu_bacteria 2854911287 2854912202 135
140 iso_pu_bacteria 2917699015 2917701248 135
141 3300031249 Ga0265339_10131861 Ga0265339_101318611 138
142 3300045976 Ga0466967_1430111 Ga0466967_1430111_61_513 138
143 3300048918 Ga0496115_0071340 Ga0496115_0071340_981_1433 138
144 3300001978 JGI24747J21853_1002332 JGI24747J21853_10023322 139
145 3300001979 JGI24740J21852_10088030 JGI24740J21852_100880301 139
146 3300001989 JGI24739J22299_10009851 JGI24739J22299_100098513 139
147 3300001991 JGI24743J22301_10018499 JGI24743J22301_100184993 139
148 3300002075 JGI24738J21930_10012102 JGI24738J21930_100121023 139
149 3300002077 JGI24744J21845_10020411 JGI24744J21845_100204112 139
150 3300002126 JGI24035J26624_1040892 JGI24035J26624_10408921 139
151 3300002987 JGI25159J45721_1008703 JGI25159J45721_10087033 139
152 3300005262 Ga0065165_1000139 Ga0065165_100013936 139
153 3300005290 Ga0065712_10300798 Ga0065712_103007981 139
154 3300005295 Ga0065707_10962379 Ga0065707_109623791 139
155 3300005327 Ga0070658_10270085 Ga0070658_102700852 139
156 3300005328 Ga0070676_10003658 Ga0070676_100036589 139
157 3300005329 Ga0070683_100053092 Ga0070683_1000530925 139
158 3300005330 Ga0070690_100000438 Ga0070690_10000043814 139
159 3300005331 Ga0070670_100653297 Ga0070670_1006532972 139
160 3300005333 Ga0070677_10554822 Ga0070677_105548221 139
161 3300005334 Ga0068869_100094424 Ga0068869_1000944243 139
162 3300005335 Ga0070666_10061379 Ga0070666_100613793 139
163 3300005336 Ga0070680_100002037 Ga0070680_10000203713 139
164 3300005336 Ga0070680_100554916 Ga0070680_1005549162 139
165 3300005337 Ga0070682_100000387 Ga0070682_10000038716 139
166 3300005338 Ga0068868_100017196 Ga0068868_1000171962 139
167 3300005339 Ga0070660_100000388 Ga0070660_10000038831 139
168 3300005340 Ga0070689_100001805 Ga0070689_1000018059 139
169 3300005340 Ga0070689_100978425 Ga0070689_1009784251 139
170 3300005341 Ga0070691_10000292 Ga0070691_1000029217 139
171 3300005343 Ga0070687_100118921 Ga0070687_1001189213 139
172 3300005344 Ga0070661_100000689 Ga0070661_10000068919 139
173 3300005345 Ga0070692_10000219 Ga0070692_1000021916 139
174 3300005345 Ga0070692_10458368 Ga0070692_104583682 139
175 3300005347 Ga0070668_100037915 Ga0070668_1000379157 139
176 3300005347 Ga0070668_100337586 Ga0070668_1003375863 139
177 3300005353 Ga0070669_100008539 Ga0070669_1000085392 139
178 3300005354 Ga0070675_100019549 Ga0070675_1000195498 139
179 3300005355 Ga0070671_100005562 Ga0070671_1000055623 139
180 3300005355 Ga0070671_100614722 Ga0070671_1006147221 139
181 3300005356 Ga0070674_100001254 Ga0070674_10000125416 139
182 3300005364 Ga0070673_100000261 Ga0070673_10000026110 139
183 3300005364 Ga0070673_101216782 Ga0070673_1012167821 139
184 3300005366 Ga0070659_100000894 Ga0070659_1000008947 139
185 3300005367 Ga0070667_100000657 Ga0070667_10000065719 139
186 3300005406 Ga0070703_10009380 Ga0070703_100093803 139
187 3300005434 Ga0070709_10002437 Ga0070709_100024375 139
188 3300005435 Ga0070714_100002744 Ga0070714_10000274413 139
189 3300005437 Ga0070710_10002924 Ga0070710_100029249 139
190 3300005438 Ga0070701_10001727 Ga0070701_100017279 139
191 3300005438 Ga0070701_10141573 Ga0070701_101415733 139
192 3300005439 Ga0070711_100002149 Ga0070711_1000021493 139
193 3300005440 Ga0070705_100002088 Ga0070705_10000208814 139
194 3300005440 Ga0070705_100248803 Ga0070705_1002488031 139
195 3300005441 Ga0070700_100004756 Ga0070700_1000047561 139
196 3300005444 Ga0070694_100000328 Ga0070694_1000003283 139
197 3300005444 Ga0070694_100041056 Ga0070694_1000410566 139
198 3300005455 Ga0070663_100001791 Ga0070663_1000017916 139
199 3300005455 Ga0070663_100249266 Ga0070663_1002492661 139
200 3300005455 Ga0070663_101096451 Ga0070663_1010964511 139
201 3300005456 Ga0070678_100000632 Ga0070678_10000063221 139
202 3300005456 Ga0070678_100918719 Ga0070678_1009187191 139
203 3300005457 Ga0070662_100030650 Ga0070662_1000306507 139
204 3300005457 Ga0070662_100779817 Ga0070662_1007798171 139
205 3300005459 Ga0068867_100011267 Ga0068867_1000112677 139
206 3300005459 Ga0068867_100149954 Ga0068867_1001499542 139
207 3300005459 Ga0068867_100731645 Ga0068867_1007316451 139
208 3300005466 Ga0070685_10028185 Ga0070685_100281853 139
209 3300005471 Ga0070698_100655715 Ga0070698_1006557152 139
210 3300005471 Ga0070698_101164530 Ga0070698_1011645302 139
211 3300005518 Ga0070699_100178330 Ga0070699_1001783303 139
212 3300005530 Ga0070679_100084846 Ga0070679_1000848463 139
213 3300005530 Ga0070679_100508922 Ga0070679_1005089223 139
214 3300005535 Ga0070684_100151109 Ga0070684_1001511093 139
215 3300005536 Ga0070697_100095855 Ga0070697_1000958554 139
216 3300005539 Ga0068853_100001286 Ga0068853_10000128616 139
217 3300005543 Ga0070672_100012128 Ga0070672_1000121283 139
218 3300005544 Ga0070686_100001964 Ga0070686_1000019643 139
219 3300005545 Ga0070695_100001555 Ga0070695_10000155517 139
220 3300005545 Ga0070695_100018457 Ga0070695_1000184578 139
221 3300005545 Ga0070695_100489524 Ga0070695_1004895242 139
222 3300005546 Ga0070696_100004201 Ga0070696_1000042015 139
223 3300005546 Ga0070696_100132244 Ga0070696_1001322444 139
224 3300005546 Ga0070696_100150545 Ga0070696_1001505451 139
225 3300005546 Ga0070696_100643062 Ga0070696_1006430621 139
226 3300005547 Ga0070693_100000155 Ga0070693_10000015517 139
227 3300005548 Ga0070665_100046043 Ga0070665_1000460435 139
228 3300005548 Ga0070665_100055541 Ga0070665_1000555413 139
229 3300005548 Ga0070665_100169639 Ga0070665_1001696394 139
230 3300005549 Ga0070704_100000688 Ga0070704_1000006889 139
231 3300005563 Ga0068855_100021777 Ga0068855_10002177711 139
232 3300005564 Ga0070664_100000700 Ga0070664_10000070014 139
233 3300005577 Ga0068857_100016875 Ga0068857_1000168759 139
234 3300005578 Ga0068854_100012167 Ga0068854_1000121671 139
235 3300005614 Ga0068856_100006465 Ga0068856_10000646512 139
236 3300005614 Ga0068856_100879724 Ga0068856_1008797241 139
237 3300005615 Ga0070702_100000900 Ga0070702_1000009003 139
238 3300005615 Ga0070702_100580753 Ga0070702_1005807532 139
239 3300005615 Ga0070702_100612316 Ga0070702_1006123161 139
240 3300005616 Ga0068852_100003766 Ga0068852_1000037668 139
241 3300005617 Ga0068859_100003442 Ga0068859_1000034425 139
242 3300005617 Ga0068859_100079479 Ga0068859_1000794795 139
243 3300005618 Ga0068864_100040683 Ga0068864_1000406832 139
244 3300005618 Ga0068864_100176307 Ga0068864_1001763073 139
245 3300005718 Ga0068866_10006085 Ga0068866_100060855 139
246 3300005719 Ga0068861_100002000 Ga0068861_1000020008 139
247 3300005719 Ga0068861_100239207 Ga0068861_1002392072 139
248 3300005719 Ga0068861_100370751 Ga0068861_1003707512 139
249 3300005834 Ga0068851_10009852 Ga0068851_100098525 139
250 3300005841 Ga0068863_100003165 Ga0068863_1000031659 139
251 3300005842 Ga0068858_100003788 Ga0068858_1000037883 139
252 3300005842 Ga0068858_100112973 Ga0068858_1001129733 139
253 3300005842 Ga0068858_100267494 Ga0068858_1002674942 139
254 3300005843 Ga0068860_100011302 Ga0068860_1000113026 139
255 3300005843 Ga0068860_100041622 Ga0068860_1000416222 139
256 3300005843 Ga0068860_100588663 Ga0068860_1005886633 139
257 3300005843 Ga0068860_101508434 Ga0068860_1015084341 139
258 3300005844 Ga0068862_100003901 Ga0068862_1000039012 139
259 3300005844 Ga0068862_100373264 Ga0068862_1003732642 139
260 3300005844 Ga0068862_101379218 Ga0068862_1013792181 139
261 3300006058 Ga0075432_10004639 Ga0075432_100046392 139
262 3300006163 Ga0070715_10000219 Ga0070715_100002192 139
263 3300006173 Ga0070716_100001003 Ga0070716_1000010036 139
264 3300006175 Ga0070712_100000382 Ga0070712_10000038217 139
265 3300006237 Ga0097621_100074986 Ga0097621_1000749865 139
266 3300006358 Ga0068871_100036883 Ga0068871_1000368832 139
267 3300006844 Ga0075428_100005355 Ga0075428_10000535511 139
268 3300006844 Ga0075428_100025063 Ga0075428_1000250637 139
269 3300006844 Ga0075428_100048914 Ga0075428_1000489144 139
270 3300006846 Ga0075430_100113127 Ga0075430_1001131271 139
271 3300006847 Ga0075431_100020190 Ga0075431_1000201907 139
272 3300006852 Ga0075433_10023713 Ga0075433_100237133 139
273 3300006852 Ga0075433_10071637 Ga0075433_100716374 139
274 3300006852 Ga0075433_10577726 Ga0075433_105777262 139
275 3300006852 Ga0075433_10660214 Ga0075433_106602142 139
276 3300006871 Ga0075434_100000816 Ga0075434_10000081634 139
277 3300006871 Ga0075434_100228863 Ga0075434_1002288631 139
278 3300006880 Ga0075429_100066687 Ga0075429_1000666873 139
279 3300006881 Ga0068865_100001670 Ga0068865_1000016706 139
280 3300006914 Ga0075436_100010755 Ga0075436_1000107552 139
281 3300006931 Ga0097620_100003442 Ga0097620_10000344216 139
282 3300006931 Ga0097620_100079478 Ga0097620_1000794781 139
283 3300007076 Ga0075435_100013741 Ga0075435_1000137413 139
284 3300007076 Ga0075435_100296757 Ga0075435_1002967571 139
285 3300007076 Ga0075435_100630022 Ga0075435_1006300223 139
286 3300009011 Ga0105251_10051940 Ga0105251_100519401 139
287 3300009092 Ga0105250_10004911 Ga0105250_100049119 139
288 3300009093 Ga0105240_10087353 Ga0105240_100873531 139
289 3300009094 Ga0111539_10003231 Ga0111539_1000323111 139
290 3300009094 Ga0111539_10042888 Ga0111539_100428884 139
291 3300009094 Ga0111539_10261458 Ga0111539_102614583 139
292 3300009094 Ga0111539_11782060 Ga0111539_117820602 139
293 3300009094 Ga0111539_12934380 Ga0111539_129343801 139
294 3300009098 Ga0105245_10000729 Ga0105245_1000072917 139
295 3300009098 Ga0105245_10322741 Ga0105245_103227412 139
296 3300009098 Ga0105245_10462571 Ga0105245_104625712 139
297 3300009101 Ga0105247_10000684 Ga0105247_1000068418 139
298 3300009101 Ga0105247_10048586 Ga0105247_100485864 139
299 3300009147 Ga0114129_10262815 Ga0114129_102628152 139
300 3300009147 Ga0114129_10451995 Ga0114129_104519952 139
301 3300009147 Ga0114129_10766700 Ga0114129_107667002 139
302 3300009147 Ga0114129_12210865 Ga0114129_122108651 139
303 3300009148 Ga0105243_10585268 Ga0105243_105852682 139
304 3300009174 Ga0105241_10001572 Ga0105241_1000157216 139
305 3300009176 Ga0105242_10000957 Ga0105242_100009578 139
306 3300009176 Ga0105242_10400007 Ga0105242_104000072 139
307 3300009177 Ga0105248_10000854 Ga0105248_1000085417 139
308 3300009177 Ga0105248_10202816 Ga0105248_102028165 139
309 3300009545 Ga0105237_10000974 Ga0105237_1000097426 139
310 3300009551 Ga0105238_10015589 Ga0105238_1001558912 139
311 3300009553 Ga0105249_10000677 Ga0105249_1000067720 139
312 3300009553 Ga0105249_10433334 Ga0105249_104333342 139
313 3300009553 Ga0105249_11379435 Ga0105249_113794351 139
314 3300010375 Ga0105239_10364602 Ga0105239_103646022 139
315 3300010375 Ga0105239_10714834 Ga0105239_107148342 139
316 3300010375 Ga0105239_10862667 Ga0105239_108626672 139
317 3300011119 Ga0105246_10088196 Ga0105246_100881964 139
318 3300013100 Ga0157373_10087372 Ga0157373_100873723 139
319 3300013105 Ga0157369_10003955 Ga0157369_1000395513 139
320 3300013296 Ga0157374_10009897 Ga0157374_1000989710 139
321 3300013296 Ga0157374_11345889 Ga0157374_113458891 139
322 3300013297 Ga0157378_10005422 Ga0157378_100054227 139
323 3300013306 Ga0163162_10011008 Ga0163162_100110088 139
324 3300013306 Ga0163162_10259420 Ga0163162_102594201 139
325 3300013306 Ga0163162_10310914 Ga0163162_103109142 139
326 3300013307 Ga0157372_10009106 Ga0157372_100091069 139
327 3300013308 Ga0157375_10003432 Ga0157375_100034323 139
328 3300013308 Ga0157375_10098179 Ga0157375_100981795 139
329 3300013308 Ga0157375_11949552 Ga0157375_119495521 139
330 3300014325 Ga0163163_10059879 Ga0163163_100598795 139
331 3300014326 Ga0157380_10004146 Ga0157380_100041463 139
332 3300014745 Ga0157377_10059168 Ga0157377_100591682 139
333 3300014968 Ga0157379_10000639 Ga0157379_100006397 139
334 3300014968 Ga0157379_10009390 Ga0157379_1000939013 139
335 3300017792 Ga0163161_10000811 Ga0163161_100008119 139
336 3300017792 Ga0163161_10284256 Ga0163161_102842561 139
337 3300017792 Ga0163161_10454753 Ga0163161_104547531 139
338 3300021388 Ga0213875_10138389 Ga0213875_101383893 139
339 3300025284 Ga0209130_1000148 Ga0209130_100014858 139
340 3300025302 Ga0207426_1012161 Ga0207426_10121612 139
341 3300025315 Ga0207697_10028477 Ga0207697_100284773 139
342 3300025893 Ga0207682_10315678 Ga0207682_103156782 139
343 3300025898 Ga0207692_10001348 Ga0207692_100013487 139
344 3300025899 Ga0207642_10003100 Ga0207642_100031004 139
345 3300025900 Ga0207710_10001714 Ga0207710_100017147 139
346 3300025900 Ga0207710_10028626 Ga0207710_100286265 139
347 3300025901 Ga0207688_10005293 Ga0207688_1000529310 139
348 3300025903 Ga0207680_10027119 Ga0207680_100271193 139
349 3300025904 Ga0207647_10015318 Ga0207647_100153183 139
350 3300025905 Ga0207685_10191990 Ga0207685_101919902 139
351 3300025906 Ga0207699_10007512 Ga0207699_100075127 139
352 3300025907 Ga0207645_10001793 Ga0207645_100017933 139
353 3300025907 Ga0207645_10073473 Ga0207645_100734733 139
354 3300025909 Ga0207705_10455336 Ga0207705_104553362 139
355 3300025911 Ga0207654_10003238 Ga0207654_100032384 139
356 3300025913 Ga0207695_10067858 Ga0207695_100678587 139
357 3300025914 Ga0207671_10010988 Ga0207671_100109888 139
358 3300025915 Ga0207693_10000998 Ga0207693_1000099813 139
359 3300025915 Ga0207693_10079594 Ga0207693_100795941 139
360 3300025916 Ga0207663_10000837 Ga0207663_1000083714 139
361 3300025917 Ga0207660_10234578 Ga0207660_102345782 139
362 3300025918 Ga0207662_10170737 Ga0207662_101707373 139
363 3300025919 Ga0207657_10000516 Ga0207657_1000051629 139
364 3300025919 Ga0207657_10984135 Ga0207657_109841351 139
365 3300025920 Ga0207649_10002753 Ga0207649_100027536 139
366 3300025921 Ga0207652_10088431 Ga0207652_100884316 139
367 3300025923 Ga0207681_10003176 Ga0207681_100031767 139
368 3300025924 Ga0207694_10033863 Ga0207694_100338633 139
369 3300025925 Ga0207650_10014007 Ga0207650_100140073 139
370 3300025926 Ga0207659_10013897 Ga0207659_100138971 139
371 3300025927 Ga0207687_10012258 Ga0207687_100122588 139
372 3300025927 Ga0207687_11511370 Ga0207687_115113701 139
373 3300025928 Ga0207700_10104090 Ga0207700_101040902 139
374 3300025929 Ga0207664_10007339 Ga0207664_100073394 139
375 3300025931 Ga0207644_10012966 Ga0207644_100129662 139
376 3300025932 Ga0207690_10002745 Ga0207690_100027456 139
377 3300025933 Ga0207706_10002149 Ga0207706_100021495 139
378 3300025933 Ga0207706_10404893 Ga0207706_104048931 139
379 3300025934 Ga0207686_10497574 Ga0207686_104975741 139
380 3300025935 Ga0207709_10003398 Ga0207709_100033985 139
381 3300025936 Ga0207670_10002453 Ga0207670_100024536 139
382 3300025936 Ga0207670_10300231 Ga0207670_103002312 139
383 3300025937 Ga0207669_10392546 Ga0207669_103925461 139
384 3300025937 Ga0207669_10551640 Ga0207669_105516401 139
385 3300025938 Ga0207704_10007724 Ga0207704_100077243 139
386 3300025939 Ga0207665_10000327 Ga0207665_1000032720 139
387 3300025940 Ga0207691_10001520 Ga0207691_1000152028 139
388 3300025941 Ga0207711_10016399 Ga0207711_100163999 139
389 3300025941 Ga0207711_10134070 Ga0207711_101340704 139
390 3300025942 Ga0207689_10109799 Ga0207689_101097992 139
391 3300025944 Ga0207661_10036503 Ga0207661_100365033 139
392 3300025945 Ga0207679_10011510 Ga0207679_100115109 139
393 3300025949 Ga0207667_10048400 Ga0207667_100484003 139
394 3300025960 Ga0207651_10003086 Ga0207651_100030866 139
395 3300025961 Ga0207712_10008549 Ga0207712_100085496 139
396 3300025961 Ga0207712_10207549 Ga0207712_102075491 139
397 3300025972 Ga0207668_10000750 Ga0207668_100007505 139
398 3300025981 Ga0207640_10013632 Ga0207640_100136321 139
399 3300025986 Ga0207658_10015910 Ga0207658_100159108 139
400 3300025986 Ga0207658_10099507 Ga0207658_100995072 139
401 3300026023 Ga0207677_10001747 Ga0207677_100017479 139
402 3300026023 Ga0207677_10385929 Ga0207677_103859291 139
403 3300026035 Ga0207703_10016044 Ga0207703_100160447 139
404 3300026035 Ga0207703_10123674 Ga0207703_101236745 139
405 3300026035 Ga0207703_10211017 Ga0207703_102110172 139
406 3300026041 Ga0207639_10001489 Ga0207639_100014896 139
407 3300026067 Ga0207678_10001037 Ga0207678_1000103720 139
408 3300026067 Ga0207678_10087333 Ga0207678_100873333 139
409 3300026075 Ga0207708_10001427 Ga0207708_100014271 139
410 3300026075 Ga0207708_10043008 Ga0207708_100430082 139
411 3300026075 Ga0207708_11309830 Ga0207708_113098301 139
412 3300026078 Ga0207702_10260873 Ga0207702_102608733 139
413 3300026078 Ga0207702_10965549 Ga0207702_109655491 139
414 3300026088 Ga0207641_10007269 Ga0207641_100072699 139
415 3300026089 Ga0207648_10119341 Ga0207648_101193412 139
416 3300026089 Ga0207648_10157288 Ga0207648_101572884 139
417 3300026089 Ga0207648_10274667 Ga0207648_102746672 139
418 3300026095 Ga0207676_10505190 Ga0207676_105051902 139
419 3300026116 Ga0207674_10008428 Ga0207674_100084284 139
420 3300026118 Ga0207675_100001630 Ga0207675_10000163014 139
421 3300026118 Ga0207675_100061833 Ga0207675_1000618331 139
422 3300026118 Ga0207675_102274861 Ga0207675_1022748612 139
423 3300026121 Ga0207683_10000351 Ga0207683_1000035119 139
424 3300026142 Ga0207698_10011180 Ga0207698_100111806 139
425 3300027552 Ga0209982_1015127 Ga0209982_10151271 139
426 3300027907 Ga0207428_10000848 Ga0207428_100008483 139
427 3300027907 Ga0207428_10009164 Ga0207428_100091647 139
428 3300027907 Ga0207428_10314720 Ga0207428_103147201 139
429 3300028379 Ga0268266_10009645 Ga0268266_100096457 139
430 3300028379 Ga0268266_10098975 Ga0268266_100989752 139
431 3300028379 Ga0268266_10912769 Ga0268266_109127693 139
432 3300028380 Ga0268265_10082932 Ga0268265_100829325 139
433 3300028380 Ga0268265_10156047 Ga0268265_101560471 139
434 3300028381 Ga0268264_10007128 Ga0268264_100071286 139
435 3300028381 Ga0268264_10081525 Ga0268264_100815254 139
436 3300028381 Ga0268264_10487459 Ga0268264_104874591 139
437 3300028381 Ga0268264_11308790 Ga0268264_113087901 139
438 3300028381 Ga0268264_11313734 Ga0268264_113137341 139
439 3300028794 Ga0307515_10041543 Ga0307515_1004154312 139
440 3300032133 Ga0316583_10276920 Ga0316583_102769201 139
441 3300034820 Ga0373959_0018780 Ga0373959_0018780_442_861 139
442 3300035086 Ga0373934_0395611 Ga0373934_0395611_136_555 139
443 3300035088 Ga0373940_0163197 Ga0373940_0163197_41_460 139
444 3300035090 Ga0373949_0016771 Ga0373949_0016771_982_1401 139
445 3300035092 Ga0373952_0050653 Ga0373952_0050653_157_576 139
446 3300035112 Ga0373932_0015228 Ga0373932_0015228_1221_1640 139
447 3300035114 Ga0373939_0007872 Ga0373939_0007872_1849_2268 139
448 3300035115 Ga0373941_0212663 Ga0373941_0212663_59_484 139
449 3300035121 Ga0373960_0021175 Ga0373960_0021175_1017_1436 139
450 3300035691 Ga0373931_0117931 Ga0373931_0117931_536_961 139
451 3300035691 Ga0373931_0127847 Ga0373931_0127847_932_1351 139
452 3300037312 Ga0395899_0817820 Ga0395899_0817820_111_530 139
453 3300037418 Ga0395900_0033099 Ga0395900_0033099_791_1210 139
454 3300037466 Ga0395898_0012412 Ga0395898_0012412_4020_4439 139
455 3300037471 Ga0395905_0004050 Ga0395905_0004050_5322_5741 139
456 3300037853 Ga0436364_0106943 Ga0436364_0106943_268_708 139
457 3300038443 Ga0395901_0024398 Ga0395901_0024398_2326_2745 139
458 3300038996 Ga0242420_016057 Ga0242420_016057_440_859 139
459 3300039437 Ga0436365_0298347 Ga0436365_0298347_574_993 139
460 3300042876 Ga0451577_0103421 Ga0451577_0103421_22_441 139
461 3300044712 Ga0453684_0064854 Ga0453684_0064854_1692_2111 139
462 3300045051 Ga0451576_0021118 Ga0451576_0021118_426_845 139
463 3300046455 Ga0495603_0095535 Ga0495603_0095535_557_982 139
464 3300046491 Ga0495584_0221712 Ga0495584_0221712_94_519 139
465 3300046525 Ga0495663_0084891 Ga0495663_0084891_57_482 139
466 3300046664 Ga0495659_0221145 Ga0495659_0221145_39_464 139
467 3300048903 Ga0496100_0004200 Ga0496100_0004200_5117_5536 139
468 3300048903 Ga0496100_0167650 Ga0496100_0167650_1054_1479 139
469 3300048904 Ga0496101_0060595 Ga0496101_0060595_1458_1877 139
470 3300048905 Ga0496102_0043736 Ga0496102_0043736_2065_2484 139
471 3300048905 Ga0496102_0206610 Ga0496102_0206610_607_1032 139
472 3300048906 Ga0496103_0033024 Ga0496103_0033024_1937_2356 139
473 3300048906 Ga0496103_0451697 Ga0496103_0451697_205_630 139
474 3300048907 Ga0496104_0009183 Ga0496104_0009183_3686_4105 139
475 3300048908 Ga0496105_0009909 Ga0496105_0009909_1937_2356 139
476 3300048909 Ga0496106_0007965 Ga0496106_0007965_1937_2356 139
477 3300048909 Ga0496106_0538295 Ga0496106_0538295_243_668 139
478 3300048910 Ga0496107_0009229 Ga0496107_0009229_1300_1719 139
479 3300048910 Ga0496107_0201197 Ga0496107_0201197_126_551 139
480 3300048911 Ga0496108_0009910 Ga0496108_0009910_3615_4034 139
481 3300048912 Ga0496109_0054964 Ga0496109_0054964_1276_1695 139
482 3300048912 Ga0496109_0615727 Ga0496109_0615727_94_519 139
483 3300048913 Ga0496110_0043061 Ga0496110_0043061_1937_2356 139
484 3300048913 Ga0496110_0236520 Ga0496110_0236520_420_845 139
485 3300048914 Ga0496111_0005813 Ga0496111_0005813_3920_4339 139
486 3300048915 Ga0496112_0008663 Ga0496112_0008663_4031_4450 139
487 3300048915 Ga0496112_0343241 Ga0496112_0343241_608_1027 139
488 3300048916 Ga0496113_0004893 Ga0496113_0004893_3960_4379 139
489 3300048916 Ga0496113_0084581 Ga0496113_0084581_1499_1918 139
490 3300048916 Ga0496113_0443418 Ga0496113_0443418_435_860 139
491 3300048917 Ga0496114_0005724 Ga0496114_0005724_5010_5429 139
492 3300048918 Ga0496115_0004344 Ga0496115_0004344_4723_5142 139
493 3300048918 Ga0496115_0579361 Ga0496115_0579361_30_455 139
494 3300048922 Ga0496119_0252665 Ga0496119_0252665_38_457 139
495 3300048926 Ga0496123_0038623 Ga0496123_0038623_774_1223 139
496 3300048926 Ga0496123_0189773 Ga0496123_0189773_200_649 139
497 3300049569 Ga0501032_0533074 Ga0501032_0533074_279_704 139
498 3300049570 Ga0501033_0048718 Ga0501033_0048718_585_1040 139
499 3300049570 Ga0501033_0056907 Ga0501033_0056907_1986_2411 139
500 3300049572 Ga0501036_1030803 Ga0501036_1030803_160_585 139
501 3300049574 Ga0501038_0068438 Ga0501038_0068438_2466_2921 139
502 3300049575 Ga0501039_0141278 Ga0501039_0141278_497_922 139
503 3300049576 Ga0501040_0060207 Ga0501040_0060207_2130_2555 139
504 3300049577 Ga0501041_0036276 Ga0501041_0036276_2082_2507 139
505 3300049577 Ga0501041_0338062 Ga0501041_0338062_192_611 139
506 3300049578 Ga0501042_0126366 Ga0501042_0126366_935_1360 139
507 3300049579 Ga0501043_0251695 Ga0501043_0251695_679_1104 139
508 3300049580 Ga0501046_0019989 Ga0501046_0019989_4362_4787 139
509 3300049580 Ga0501046_0248995 Ga0501046_0248995_587_1012 139
510 3300049582 Ga0501048_0047231 Ga0501048_0047231_97_522 139
511 3300049582 Ga0501048_1063668 Ga0501048_1063668_60_479 139
512 3300049584 Ga0501068_0019286 Ga0501068_0019286_1791_2216 139
513 3300049584 Ga0501068_0277657 Ga0501068_0277657_311_778 139
514 3300049584 Ga0501068_0324581 Ga0501068_0324581_457_912 139
515 3300049584 Ga0501068_1118321 Ga0501068_1118321_52_471 139
516 3300049585 Ga0501069_0820609 Ga0501069_0820609_133_552 139
517 3300049588 Ga0501072_0324826 Ga0501072_0324826_708_1148 139
518 3300049589 Ga0501073_0081763 Ga0501073_0081763_724_1149 139
519 3300049590 Ga0501074_0046656 Ga0501074_0046656_2630_3055 139
520 3300049590 Ga0501074_0070617 Ga0501074_0070617_29_454 139
521 3300049591 Ga0501075_0053501 Ga0501075_0053501_35_460 139
522 3300049591 Ga0501075_0117123 Ga0501075_0117123_10_465 139
523 3300049591 Ga0501075_0386604 Ga0501075_0386604_266_685 139
524 3300049592 Ga0501076_0129484 Ga0501076_0129484_1445_1870 139
525 3300049592 Ga0501076_0358212 Ga0501076_0358212_83_538 139
526 3300049593 Ga0501077_0110718 Ga0501077_0110718_238_663 139
527 3300049593 Ga0501077_0231486 Ga0501077_0231486_646_1071 139
528 3300049593 Ga0501077_0242933 Ga0501077_0242933_487_912 139
529 3300049741 Ga0501079_0010630 Ga0501079_0010630_5895_6350 139
530 3300049741 Ga0501079_0045265 Ga0501079_0045265_413_838 139
531 3300049741 Ga0501079_0208955 Ga0501079_0208955_1089_1508 139
532 3300049742 Ga0501080_0128641 Ga0501080_0128641_646_1071 139
533 3300049743 Ga0501081_0019065 Ga0501081_0019065_1475_1930 139
534 3300049743 Ga0501081_0221043 Ga0501081_0221043_244_669 139
535 3300049743 Ga0501081_0386577 Ga0501081_0386577_293_718 139
536 3300049743 Ga0501081_0924334 Ga0501081_0924334_23_451 139
537 3300049744 Ga0501083_0061110 Ga0501083_0061110_1101_1526 139
538 3300049744 Ga0501083_0181885 Ga0501083_0181885_409_864 139
539 3300049823 Ga0501044_0244631 Ga0501044_0244631_1188_1643 139
540 3300049824 Ga0501045_0313855 Ga0501045_0313855_83_508 139
541 3300050507 nmdc:mga05p37_310678_c1 nmdc:mga05p37_310678_c1_1345_1764 139
542 3300050507 nmdc:mga05p37_516393_c1 nmdc:mga05p37_516393_c1_34_480 139
543 3300050507 nmdc:mga05p37_879413_c1 nmdc:mga05p37_879413_c1_203_628 139
544 3300050508 nmdc:mga09592_612529_c1 nmdc:mga09592_612529_c1_307_732 139
545 3300050508 nmdc:mga09592_89845_c1 nmdc:mga09592_89845_c1_313_732 139
546 3300050510 nmdc:mga06r32_234051_c1 nmdc:mga06r32_234051_c1_878_1303 139
547 3300050510 nmdc:mga06r32_561355_c1 nmdc:mga06r32_561355_c1_204_623 139
548 3300050511 nmdc:mga08y16_102399_c1 nmdc:mga08y16_102399_c1_1893_2312 139
549 3300050511 nmdc:mga08y16_1871768_c1 nmdc:mga08y16_1871768_c1_104_523 139
550 3300050511 nmdc:mga08y16_456041_c1 nmdc:mga08y16_456041_c1_81_506 139
551 3300050511 nmdc:mga08y16_595696_c1 nmdc:mga08y16_595696_c1_245_664 139
552 3300050512 nmdc:mga0n895_487618_c1 nmdc:mga0n895_487618_c1_373_792 139
553 3300050512 nmdc:mga0n895_9664_c1 nmdc:mga0n895_9664_c1_7083_7502 139
554 3300050513 nmdc:mga0rr50_7289_c1 nmdc:mga0rr50_7289_c1_5464_5883 139
555 3300050513 nmdc:mga0rr50_7300_c1 nmdc:mga0rr50_7300_c1_3150_3569 139
556 3300050514 nmdc:mga08x19_265765_c1 nmdc:mga08x19_265765_c1_452_871 139
557 3300050515 nmdc:mga0a205_155332_c1 nmdc:mga0a205_155332_c1_1317_1736 139
558 3300050515 nmdc:mga0a205_43542_c1 nmdc:mga0a205_43542_c1_2097_2522 139
559 3300050515 nmdc:mga0a205_862_c1 nmdc:mga0a205_862_c1_5518_5937 139
560 3300050516 nmdc:mga0sz30_62281_c1 nmdc:mga0sz30_62281_c1_968_1417 139
561 3300053139 Ga0500568_0086419 Ga0500568_0086419_200_640 139
562 3300054114 Ga0501084_0007831 Ga0501084_0007831_7602_8057 139
563 3300054114 Ga0501084_0011362 Ga0501084_0011362_5265_5690 139
564 3300054114 Ga0501084_0225678 Ga0501084_0225678_502_927 139
565 3300060353 Ga0501082_0051224 Ga0501082_0051224_729_1154 139
566 3300060353 Ga0501082_0071386 Ga0501082_0071386_60_515 139
567 3300061734 Ga0530510_0133334 Ga0530510_0133334_415_840 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.9 1 120
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8958 1 121
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8886 1 121
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8873 1 122
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8804 1 122
ID Description Score Start End Superfamily
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8958 1 121 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8886 1 121 3.10.180.10
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8878 1 120 3.10.180.10
af_Q09751_155_302_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8571 1 121 3.10.180.10
af_Q948T6_1_150_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.854 1 121 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9987 82 139 GO:0016829
AF-A0A3C7W1R9-F1-model_v4 Lactoylglutathione lyase 0.9954 88 139 GO:0016829
AF-A0A534CJR0-F1-model_v4 Lactoylglutathione lyase 0.9818 82 139 GO:0016829
AF-A0A3B8WFH9-F1-model_v4 Lactoylglutathione lyase 0.9708 85 139 GO:0016829
AF-A0A812ITZ1-F1-model_v4 deleted 0.964 1 139

Feature Viewer

pLDDT pTM Quality
91.42 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map