F464435

General Info

Members Datasets Scaffolds Average Seq Length
566 312 1132 132

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0039669|Ga0495598_0039669_818_1357
Length 152
Sequence MRRGRDGVFQDRSLERLNMSTRSVIKTFALWELLLGMRVTLGTLFRRKVTISYPEEKTPQSSRFRGLHALRRYPNGEERCIACKLCEAVCPAAAITIDSDVSNDGTRRETRIHEYHMEHRGENIMTKDKLLAVGERYEAMINADKAADARYR

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
199 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
200 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
201 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
202 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 0
Rhizoplane 4.06
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0039669 3300046537 Bacteria 1370
2 JGI25406J46586_10004851 3300003203 Bacteria 6252
3 JGI25405J52794_10065432 3300003911 Bacteria 789
4 Ga0065707_10083091 3300005295 Bacteria 10527
5 Ga0070658_10761454 3300005327 Bacteria 841
6 Ga0070690_100066910 3300005330 Bacteria 2327
7 Ga0070690_100633784 3300005330 Bacteria 815
8 Ga0070690_100749357 3300005330 Bacteria 754
9 Ga0070670_100348977 3300005331 Bacteria 1300
10 Ga0070670_100852202 3300005331 Bacteria 824
11 Ga0070677_10011868 3300005333 Bacteria 3014
12 Ga0068869_100439323 3300005334 Bacteria 1080
13 Ga0070666_10005768 3300005335 Bacteria 7606
14 Ga0070666_10014311 3300005335 Bacteria 5050
15 Ga0070666_10060583 3300005335 Bacteria 2562
16 Ga0070680_100008101 3300005336 Bacteria 8022
17 Ga0070682_100013181 3300005337 Bacteria 4750
18 Ga0070682_100017252 3300005337 Bacteria 4207
19 Ga0070682_100904729 3300005337 Bacteria 725
20 Ga0068868_100092738 3300005338 Bacteria 2434
21 Ga0070689_100031699 3300005340 Bacteria 4018
22 Ga0070691_10583168 3300005341 Bacteria 658
23 Ga0070687_100209446 3300005343 Bacteria 1186
24 Ga0070669_100054669 3300005353 Bacteria 2924
25 Ga0070675_100088162 3300005354 Bacteria 2596
26 Ga0070671_100000211 3300005355 Bacteria 38816
27 Ga0070674_100107204 3300005356 Bacteria 2045
28 Ga0070674_100199383 3300005356 Bacteria 1544
29 Ga0070674_100240609 3300005356 Bacteria 1417
30 Ga0070674_101265950 3300005356 Bacteria 657
31 Ga0070673_100022812 3300005364 Bacteria 4563
32 Ga0070673_100979311 3300005364 Bacteria 787
33 Ga0070659_100690793 3300005366 Bacteria 882
34 Ga0070667_100000176 3300005367 Bacteria 79346
35 Ga0070667_100004044 3300005367 Bacteria 12402
36 Ga0070667_100043345 3300005367 Bacteria 3776
37 Ga0070667_100735979 3300005367 Bacteria 914
38 Ga0070713_100880757 3300005436 Bacteria 860
39 Ga0070701_10090751 3300005438 Bacteria 1673
40 Ga0070701_10314034 3300005438 Bacteria 967
41 Ga0070701_10557216 3300005438 Bacteria 753
42 Ga0070700_100026845 3300005441 Bacteria 3406
43 Ga0070700_100427247 3300005441 Bacteria 1002
44 Ga0070663_100149191 3300005455 Bacteria 1791
45 Ga0070662_100664876 3300005457 Bacteria 879
46 Ga0070681_10063093 3300005458 Bacteria 3678
47 Ga0070681_10489471 3300005458 Bacteria 1143
48 Ga0068867_101485890 3300005459 Bacteria 630
49 Ga0068867_101505752 3300005459 Bacteria 627
50 Ga0070685_10119325 3300005466 Bacteria 1636
51 Ga0070685_10409729 3300005466 Bacteria 941
52 Ga0070698_100494587 3300005471 Bacteria 1161
53 Ga0070679_100005267 3300005530 Bacteria 11971
54 Ga0070679_100012832 3300005530 Bacteria 8019
55 Ga0070679_100065053 3300005530 Bacteria 3635
56 Ga0070679_101185447 3300005530 Bacteria 709
57 Ga0068853_100148526 3300005539 Bacteria 2108
58 Ga0068853_100651310 3300005539 Bacteria 1003
59 Ga0070672_100130285 3300005543 Bacteria 2066
60 Ga0070686_100637427 3300005544 Bacteria 843
61 Ga0070686_100919546 3300005544 Bacteria 713
62 Ga0070695_100161281 3300005545 Bacteria 1574
63 Ga0070693_100094977 3300005547 Bacteria 1805
64 Ga0070665_100020945 3300005548 Bacteria 6571
65 Ga0070665_100022101 3300005548 Bacteria 6399
66 Ga0070665_100023155 3300005548 Bacteria 6256
67 Ga0070665_100094273 3300005548 Bacteria 2998
68 Ga0070665_100130179 3300005548 Bacteria 2519
69 Ga0070665_101444424 3300005548 Bacteria 697
70 Ga0070704_100038991 3300005549 Bacteria 3259
71 Ga0068855_100002075 3300005563 Bacteria 24814
72 Ga0068855_100030743 3300005563 Bacteria 6420
73 Ga0068855_100109312 3300005563 Bacteria 3175
74 Ga0068855_100130404 3300005563 Bacteria 2872
75 Ga0068857_100314708 3300005577 Bacteria 1445
76 Ga0068857_100684387 3300005577 Bacteria 974
77 Ga0068856_100053231 3300005614 Bacteria 3991
78 Ga0068856_100137635 3300005614 Bacteria 2448
79 Ga0070702_100073532 3300005615 Bacteria 2025
80 Ga0068852_100061881 3300005616 Bacteria 3254
81 Ga0068859_100002490 3300005617 Bacteria 18744
82 Ga0068859_100134938 3300005617 Bacteria 2540
83 Ga0068859_100156136 3300005617 Bacteria 2359
84 Ga0068859_100391496 3300005617 Bacteria 1485
85 Ga0068864_100261325 3300005618 Bacteria 1610
86 Ga0068866_10262636 3300005718 Bacteria 1062
87 Ga0068861_100151445 3300005719 Bacteria 1904
88 Ga0068861_100515504 3300005719 Bacteria 1083
89 Ga0068870_10015437 3300005840 Bacteria 3623
90 Ga0068870_10101667 3300005840 Bacteria 1626
91 Ga0068863_100007707 3300005841 Bacteria 10527
92 Ga0068863_100018700 3300005841 Bacteria 6630
93 Ga0068863_100048541 3300005841 Bacteria 4025
94 Ga0068863_100139723 3300005841 Bacteria 2315
95 Ga0068863_100483917 3300005841 Bacteria 1217
96 Ga0068863_100907003 3300005841 Bacteria 882
97 Ga0068858_100001768 3300005842 Bacteria 22037
98 Ga0068858_100003825 3300005842 Bacteria 14883
99 Ga0068860_100006962 3300005843 Bacteria 11335
100 Ga0068860_100012570 3300005843 Bacteria 8334
101 Ga0068860_100017517 3300005843 Bacteria 6980
102 Ga0068860_100027936 3300005843 Bacteria 5433
103 Ga0068860_100351511 3300005843 Bacteria 1450
104 Ga0068862_100307369 3300005844 Bacteria 1460
105 Ga0068862_100312305 3300005844 Bacteria 1449
106 Ga0068862_100801203 3300005844 Bacteria 920
107 Ga0068862_101138734 3300005844 Bacteria 777
108 Ga0081455_10001496 3300005937 Bacteria 28888
109 Ga0081455_10003509 3300005937 Bacteria 18014
110 Ga0081539_10392654 3300005985 Bacteria 578
111 Ga0070712_100015088 3300006175 Bacteria 4967
112 Ga0097621_100075127 3300006237 Bacteria 2800
113 Ga0097621_100107080 3300006237 Bacteria 2358
114 Ga0097621_100718794 3300006237 Bacteria 921
115 Ga0068871_100020631 3300006358 Bacteria 5052
116 Ga0068871_100062046 3300006358 Bacteria 3054
117 Ga0068871_100108854 3300006358 Bacteria 2329
118 Ga0068871_101207143 3300006358 Bacteria 710
119 Ga0075428_100005214 3300006844 Bacteria 14448
120 Ga0075429_100300871 3300006880 Bacteria 1404
121 Ga0097620_100002490 3300006931 Bacteria 18744
122 Ga0097620_100134938 3300006931 Bacteria 2540
123 Ga0097620_100156134 3300006931 Bacteria 2359
124 Ga0097620_100391494 3300006931 Bacteria 1485
125 Ga0099794_10027978 3300007265 Bacteria 2618
126 Ga0099794_10063431 3300007265 Bacteria 1798
127 Ga0099795_10000128 3300007788 Bacteria 12772
128 Ga0099795_10002137 3300007788 Bacteria 4555
129 Ga0099795_10532247 3300007788 Bacteria 552
130 Ga0105240_10007091 3300009093 Bacteria 16338
131 Ga0105240_10051958 3300009093 Bacteria 5154
132 Ga0105240_10091344 3300009093 Bacteria 3720
133 Ga0105240_10139049 3300009093 Bacteria 2905
134 Ga0105240_10148590 3300009093 Bacteria 2793
135 Ga0105240_10833785 3300009093 Bacteria 996
136 Ga0111539_10006091 3300009094 Bacteria 15568
137 Ga0111539_11410039 3300009094 Bacteria 808
138 Ga0105247_10000088 3300009101 Bacteria 98964
139 Ga0105247_10050866 3300009101 Bacteria 2550
140 Ga0105247_10375554 3300009101 Bacteria 1006
141 Ga0105242_10056579 3300009176 Bacteria 3210
142 Ga0105248_10097725 3300009177 Bacteria 3308
143 Ga0105248_10119206 3300009177 Bacteria 2976
144 Ga0105248_10480764 3300009177 Bacteria 1400
145 Ga0105248_10631070 3300009177 Bacteria 1209
146 Ga0105237_10116469 3300009545 Bacteria 2665
147 Ga0105237_10268210 3300009545 Bacteria 1710
148 Ga0105237_10270931 3300009545 Bacteria 1701
149 Ga0105237_10443720 3300009545 Bacteria 1303
150 Ga0105238_10038989 3300009551 Bacteria 4821
151 Ga0105238_10059187 3300009551 Bacteria 3838
152 Ga0105238_10264239 3300009551 Bacteria 1701
153 Ga0105238_10961322 3300009551 Bacteria 874
154 Ga0105249_10051803 3300009553 Bacteria 3746
155 Ga0105249_10156282 3300009553 Bacteria 2200
156 Ga0105249_10249218 3300009553 Bacteria 1760
157 Ga0105249_11307287 3300009553 Bacteria 797
158 Ga0099796_10000281 3300010159 Bacteria 8025
159 Ga0099796_10005667 3300010159 Bacteria 3131
160 Ga0099796_10010161 3300010159 Bacteria 2578
161 Ga0105239_10119480 3300010375 Bacteria 2925
162 Ga0105239_10604243 3300010375 Bacteria 1251
163 Ga0105239_10980648 3300010375 Bacteria 971
164 Ga0157370_10008536 3300013104 Bacteria 11043
165 Ga0157370_11016370 3300013104 Bacteria 750
166 Ga0157369_10045917 3300013105 Bacteria 4749
167 Ga0157369_10116075 3300013105 Bacteria 2843
168 Ga0157369_10415130 3300013105 Bacteria 1395
169 Ga0157374_10005413 3300013296 Bacteria 10724
170 Ga0157374_10122696 3300013296 Bacteria 2509
171 Ga0157378_10132740 3300013297 Bacteria 2306
172 Ga0157378_11431921 3300013297 Bacteria 734
173 Ga0163162_10085353 3300013306 Bacteria 3234
174 Ga0163162_10141540 3300013306 Bacteria 2519
175 Ga0163162_10184029 3300013306 Bacteria 2216
176 Ga0157372_10861355 3300013307 Bacteria 1052
177 Ga0157375_10206328 3300013308 Bacteria 2121
178 Ga0157375_10488531 3300013308 Bacteria 1396
179 Ga0163163_11651394 3300014325 Bacteria 702
180 Ga0157380_10269963 3300014326 Bacteria 1550
181 Ga0157380_10624583 3300014326 Bacteria 1070
182 Ga0157380_10676688 3300014326 Bacteria 1033
183 Ga0157379_10001073 3300014968 Bacteria 22288
184 Ga0157379_10019046 3300014968 Bacteria 6059
185 Ga0157379_10139171 3300014968 Bacteria 2188
186 Ga0157379_10400835 3300014968 Bacteria 1261
187 Ga0157376_10191647 3300014969 Bacteria 1875
188 Ga0157376_10350343 3300014969 Bacteria 1413
189 Ga0157376_10719029 3300014969 Bacteria 1005
190 Ga0163161_10648722 3300017792 Bacteria 874
191 Ga0163161_10722796 3300017792 Bacteria 831
192 Ga0213873_10063140 3300021358 Bacteria 1007
193 Ga0213874_10241549 3300021377 Bacteria 663
194 Ga0213876_10503144 3300021384 Bacteria 645
195 Ga0207697_10273289 3300025315 Bacteria 749
196 Ga0207656_10257198 3300025321 Bacteria 857
197 Ga0207682_10003258 3300025893 Bacteria 7102
198 Ga0207692_10945523 3300025898 Bacteria 568
199 Ga0207710_10000200 3300025900 Bacteria 56100
200 Ga0207710_10099302 3300025900 Bacteria 1371
201 Ga0207710_10278002 3300025900 Bacteria 842
202 Ga0207710_10446526 3300025900 Bacteria 667
203 Ga0207680_10060822 3300025903 Bacteria 2301
204 Ga0207647_10077641 3300025904 Bacteria 1996
205 Ga0207643_10015548 3300025908 Bacteria 4143
206 Ga0207707_10000045 3300025912 Bacteria 122598
207 Ga0207707_10023452 3300025912 Bacteria 5397
208 Ga0207707_10033935 3300025912 Bacteria 4466
209 Ga0207707_10391072 3300025912 Bacteria 1195
210 Ga0207695_10005045 3300025913 Bacteria 17727
211 Ga0207695_10033031 3300025913 Bacteria 5653
212 Ga0207695_10058289 3300025913 Bacteria 4009
213 Ga0207695_10072893 3300025913 Bacteria 3501
214 Ga0207695_10236977 3300025913 Bacteria 1727
215 Ga0207671_10133165 3300025914 Bacteria 1909
216 Ga0207671_10785345 3300025914 Bacteria 756
217 Ga0207693_10036596 3300025915 Bacteria 3869
218 Ga0207663_10243448 3300025916 Bacteria 1320
219 Ga0207660_10019522 3300025917 Bacteria 4532
220 Ga0207660_10076925 3300025917 Bacteria 2441
221 Ga0207662_10098196 3300025918 Bacteria 1812
222 Ga0207649_10073230 3300025920 Bacteria 2194
223 Ga0207652_10003813 3300025921 Bacteria 12356
224 Ga0207652_10041713 3300025921 Bacteria 3903
225 Ga0207652_10442025 3300025921 Bacteria 1172
226 Ga0207681_10129522 3300025923 Bacteria 1863
227 Ga0207694_10054617 3300025924 Bacteria 3099
228 Ga0207650_10031942 3300025925 Bacteria 3807
229 Ga0207687_10023015 3300025927 Bacteria 4150
230 Ga0207700_10510627 3300025928 Bacteria 1064
231 Ga0207644_10002758 3300025931 Bacteria 11315
232 Ga0207670_10008577 3300025936 Bacteria 5778
233 Ga0207670_10547058 3300025936 Bacteria 945
234 Ga0207669_10063163 3300025937 Bacteria 2284
235 Ga0207669_10300605 3300025937 Bacteria 1219
236 Ga0207704_10270960 3300025938 Bacteria 1285
237 Ga0207691_10031501 3300025940 Bacteria 4948
238 Ga0207711_10026766 3300025941 Bacteria 4840
239 Ga0207711_10278632 3300025941 Bacteria 1540
240 Ga0207711_11512973 3300025941 Bacteria 614
241 Ga0207689_10044594 3300025942 Bacteria 3666
242 Ga0207689_10200479 3300025942 Bacteria 1647
243 Ga0207689_10226943 3300025942 Bacteria 1544
244 Ga0207667_10000887 3300025949 Bacteria 38097
245 Ga0207667_10001163 3300025949 Bacteria 33062
246 Ga0207667_10157124 3300025949 Bacteria 2340
247 Ga0207712_10205675 3300025961 Bacteria 1564
248 Ga0207712_10314735 3300025961 Bacteria 1289
249 Ga0207640_10354693 3300025981 Bacteria 1180
250 Ga0207658_10000236 3300025986 Bacteria 58435
251 Ga0207658_10013360 3300025986 Bacteria 5607
252 Ga0207658_10050545 3300025986 Bacteria 3060
253 Ga0207677_10057110 3300026023 Bacteria 2678
254 Ga0207677_10060644 3300026023 Bacteria 2616
255 Ga0207703_10000656 3300026035 Bacteria 34663
256 Ga0207703_10001996 3300026035 Bacteria 17999
257 Ga0207703_10200103 3300026035 Bacteria 1775
258 Ga0207703_10555680 3300026035 Bacteria 1083
259 Ga0207703_11021297 3300026035 Bacteria 793
260 Ga0207678_10111211 3300026067 Bacteria 2337
261 Ga0207708_10029406 3300026075 Bacteria 4165
262 Ga0207708_10192256 3300026075 Bacteria 1625
263 Ga0207708_11093031 3300026075 Bacteria 695
264 Ga0207702_10108144 3300026078 Bacteria 2467
265 Ga0207702_10195341 3300026078 Bacteria 1873
266 Ga0207702_12473850 3300026078 Bacteria 506
267 Ga0207641_10006280 3300026088 Bacteria 10048
268 Ga0207641_10013218 3300026088 Bacteria 6769
269 Ga0207641_10179721 3300026088 Bacteria 1937
270 Ga0207641_10228356 3300026088 Bacteria 1729
271 Ga0207648_10347308 3300026089 Bacteria 1337
272 Ga0207676_10081930 3300026095 Bacteria 2623
273 Ga0207676_10159217 3300026095 Bacteria 1954
274 Ga0207676_10570290 3300026095 Bacteria 1084
275 Ga0207674_10462059 3300026116 Bacteria 1227
276 Ga0207675_100031773 3300026118 Bacteria 4919
277 Ga0207675_100052091 3300026118 Bacteria 3820
278 Ga0207675_100100688 3300026118 Bacteria 2722
279 Ga0207675_100179336 3300026118 Bacteria 2028
280 Ga0209969_1006929 3300027360 Bacteria 1598
281 Ga0209179_1000062 3300027512 Bacteria 19549
282 Ga0209970_1029707 3300027614 Bacteria 947
283 Ga0209983_1004466 3300027665 Bacteria 2938
284 Ga0209588_1099526 3300027671 Bacteria 936
285 Ga0209974_10017051 3300027876 Bacteria 2410
286 Ga0207428_10015261 3300027907 Bacteria 6649
287 Ga0268266_10003011 3300028379 Bacteria 17313
288 Ga0268266_10041199 3300028379 Bacteria 3939
289 Ga0268266_10080112 3300028379 Bacteria 2845
290 Ga0268266_10088261 3300028379 Bacteria 2714
291 Ga0268266_10113954 3300028379 Bacteria 2398
292 Ga0268266_10483534 3300028379 Bacteria 1180
293 Ga0268266_11478265 3300028379 Bacteria 655
294 Ga0268265_10066670 3300028380 Bacteria 2783
295 Ga0268265_10222163 3300028380 Bacteria 1654
296 Ga0268265_11257228 3300028380 Bacteria 739
297 Ga0268265_11625036 3300028380 Bacteria 651
298 Ga0268264_10000142 3300028381 Bacteria 170046
299 Ga0268264_10036104 3300028381 Bacteria 4069
300 Ga0268264_10095058 3300028381 Bacteria 2578
301 Ga0265337_1078257 3300028556 Bacteria 906
302 Ga0265334_10000887 3300028573 Bacteria 14948
303 Ga0265318_10004262 3300028577 Bacteria 6976
304 Ga0307515_10132551 3300028794 Bacteria 2733
305 Ga0307515_10203513 3300028794 Bacteria 1848
306 Ga0265338_10020666 3300028800 Bacteria 6910
307 Ga0265338_10042444 3300028800 Bacteria 4235
308 Ga0307511_10004421 3300030521 Bacteria 14347
309 Ga0265330_10006528 3300031235 Bacteria 5767
310 Ga0265332_10024908 3300031238 Bacteria 2630
311 Ga0265332_10140681 3300031238 Bacteria 1011
312 Ga0265332_10173472 3300031238 Bacteria 900
313 Ga0265328_10025308 3300031239 Bacteria 2236
314 Ga0265328_10027532 3300031239 Bacteria 2130
315 Ga0265328_10305239 3300031239 Bacteria 615
316 Ga0265320_10016206 3300031240 Bacteria 4185
317 Ga0265325_10005887 3300031241 Bacteria 7513
318 Ga0265329_10002606 3300031242 Bacteria 8128
319 Ga0265340_10072010 3300031247 Bacteria 1637
320 Ga0265340_10092937 3300031247 Bacteria 1408
321 Ga0265331_10007497 3300031250 Bacteria 6308
322 Ga0265331_10054055 3300031250 Bacteria 1913
323 Ga0265316_10037551 3300031344 Bacteria 3908
324 Ga0265316_10108262 3300031344 Bacteria 2107
325 Ga0307513_10045584 3300031456 Bacteria 4791
326 Ga0307513_10050748 3300031456 Bacteria 4482
327 Ga0307513_10072053 3300031456 Bacteria 3603
328 Ga0307513_10240896 3300031456 Bacteria 1614
329 Ga0307513_10259121 3300031456 Bacteria 1530
330 Ga0307509_10000003 3300031507 Bacteria 577578
331 Ga0307509_10156231 3300031507 Bacteria 2187
332 Ga0307509_10234352 3300031507 Bacteria 1635
333 Ga0307408_100034517 3300031548 Bacteria 3543
334 Ga0307408_101134945 3300031548 Bacteria 726
335 Ga0265313_10029110 3300031595 Bacteria 2861
336 Ga0265314_10031754 3300031711 Bacteria 3893
337 Ga0316576_10011416 3300031727 Bacteria 5823
338 Ga0316576_10055512 3300031727 Bacteria 2891
339 Ga0316576_10520300 3300031727 Bacteria 874
340 Ga0307405_10031842 3300031731 Bacteria 3109
341 Ga0307413_10043698 3300031824 Bacteria 2642
342 Ga0307413_10945191 3300031824 Bacteria 735
343 Ga0307410_10049850 3300031852 Bacteria 2812
344 Ga0307410_10051095 3300031852 Bacteria 2784
345 Ga0307406_10230689 3300031901 Bacteria 1382
346 Ga0307406_10345275 3300031901 Bacteria 1161
347 Ga0307407_10809207 3300031903 Bacteria 713
348 Ga0307412_10108346 3300031911 Bacteria 1979
349 Ga0307412_10569311 3300031911 Bacteria 954
350 Ga0307409_100051576 3300031995 Bacteria 3149
351 Ga0307409_100225101 3300031995 Bacteria 1696
352 Ga0307416_100098925 3300032002 Bacteria 2531
353 Ga0307414_10165634 3300032004 Bacteria 1761
354 Ga0307414_11086919 3300032004 Bacteria 738
355 Ga0307411_10253350 3300032005 Bacteria 1385
356 Ga0307411_10608401 3300032005 Bacteria 940
357 Ga0307411_11583932 3300032005 Bacteria 604
358 Ga0307415_100005213 3300032126 Bacteria 6870
359 Ga0307415_100236415 3300032126 Bacteria 1475
360 Ga0307415_100826617 3300032126 Bacteria 848
361 Ga0307415_101204225 3300032126 Bacteria 714
362 Ga0307510_10000001 3300033180 Bacteria 1172244
363 Ga0373956_0262011 3300035119 Bacteria 822
364 Ga0316574_0001637 3300035398 Bacteria 10763
365 Ga0316574_0027407 3300035398 Bacteria 3432
366 Ga0373937_0039629 3300036401 Bacteria 4294
367 Ga0373937_0266529 3300036401 Bacteria 1616
368 Ga0316584_0409014 3300036712 Bacteria 965
369 Ga0316584_0442321 3300036712 Bacteria 921
370 Ga0373925_0964177 3300037068 Bacteria 703
371 Ga0395905_0719353 3300037471 Bacteria 901
372 Ga0436364_0060353 3300037853 Bacteria 623
373 Ga0436365_0891607 3300039437 Bacteria 3330
374 Ga0436365_1716422 3300039437 Bacteria 1559
375 Ga0436365_1863591 3300039437 Bacteria 9458
376 Ga0436360_0224806 3300039438 Bacteria 527
377 Ga0436361_0207937 3300039447 Bacteria 755
378 Ga0436361_0656221 3300039447 Bacteria 692
379 Ga0436363_0147279 3300039450 Bacteria 1299
380 Ga0436363_0388984 3300039450 Bacteria 708
381 Ga0436363_1607634 3300039450 Bacteria 1762
382 Ga0436362_0988947 3300039453 Bacteria 2867
383 Ga0451789_0695360 3300041443 Bacteria 1142
384 Ga0451791_0725208 3300041451 Bacteria 2049
385 Ga0451791_1379632 3300041451 Bacteria 768
386 Ga0451800_1686224 3300041459 Bacteria 1569
387 Ga0451802_1583551 3300041460 Bacteria 919
388 Ga0451807_0506058 3300041486 Bacteria 2342
389 Ga0451833_0267791 3300041491 Bacteria 691
390 Ga0451837_0947659 3300041494 Bacteria 788
391 Ga0439431_0121986 3300041997 Bacteria 727
392 Ga0439443_004179 3300042003 Bacteria 1864
393 Ga0439448_0041486 3300042005 Bacteria 1489
394 Ga0439454_004081 3300042011 Bacteria 1661
395 Ga0450923_059472 3300042125 Bacteria 831
396 Ga0450894_007261 3300042131 Bacteria 1430
397 Ga0450895_012350 3300042132 Bacteria 743
398 Ga0450896_002550 3300042133 Bacteria 2362
399 Ga0439446_0007690 3300042156 Bacteria 2841
400 Ga0450908_003579 3300042184 Bacteria 3025
401 Ga0439434_0025876 3300042435 Bacteria 1772
402 Ga0439435_0000245 3300042436 Bacteria 7822
403 Ga0439444_0000819 3300042437 Bacteria 3750
404 Ga0439444_0029091 3300042437 Bacteria 1027
405 Ga0439464_0007636 3300042439 Bacteria 2829
406 Ga0466972_0019166 3300044658 Bacteria 3422
407 Ga0466957_0298282 3300044842 Bacteria 1082
408 Ga0451576_0450650 3300045051 Bacteria 1351
409 Ga0495603_0099176 3300046455 Bacteria 1701
410 Ga0495591_019889 3300046458 Bacteria 2235
411 Ga0495629_0829057 3300046459 Bacteria 609
412 Ga0495638_0022812 3300046460 Bacteria 4104
413 Ga0495638_0054270 3300046460 Bacteria 2492
414 Ga0495639_0151301 3300046475 Bacteria 1120
415 Ga0495594_0081141 3300046499 Bacteria 1811
416 Ga0495583_0029575 3300046506 Bacteria 2679
417 Ga0495606_0273394 3300046507 Bacteria 927
418 Ga0495616_0006284 3300046513 Bacteria 7209
419 Ga0495630_0194831 3300046517 Bacteria 1546
420 Ga0495630_0432784 3300046517 Bacteria 1008
421 Ga0495632_0256115 3300046519 Bacteria 784
422 Ga0495644_0008333 3300046523 Bacteria 3993
423 Ga0495642_0142088 3300046528 Bacteria 1036
424 Ga0495621_0116426 3300046539 Bacteria 1029
425 Ga0495645_0225594 3300046543 Bacteria 1258
426 Ga0495656_0114819 3300046615 Bacteria 1264
427 Ga0495611_0127959 3300046648 Bacteria 1185
428 Ga0495625_0018896 3300046660 Bacteria 5365
429 Ga0495625_0156292 3300046660 Bacteria 1530
430 Ga0495625_0677773 3300046660 Bacteria 611
431 Ga0495657_0252218 3300046675 Bacteria 1062
432 Ga0495647_0003040 3300046681 Bacteria 5344
433 Ga0495658_0018711 3300046683 Bacteria 3606
434 Ga0495613_0121101 3300046689 Bacteria 1879
435 Ga0495670_0028987 3300046691 Bacteria 2746
436 Ga0495649_0079609 3300046694 Bacteria 1752
437 Ga0495581_0641467 3300047315 Bacteria 614
438 Ga0495604_0322756 3300047317 Bacteria 1032
439 Ga0495676_0540395 3300047321 Bacteria 762
440 Ga0495680_0216528 3300047322 Bacteria 1369
441 Ga0495687_027925 3300047443 Bacteria 2633
442 Ga0495681_0023934 3300047470 Bacteria 3230
443 Ga0495602_0594504 3300048088 Bacteria 762
444 Ga0495615_0062533 3300048090 Bacteria 986
445 Ga0496100_0103869 3300048903 Bacteria 1963
446 Ga0496100_1193102 3300048903 Bacteria 600
447 Ga0496101_0674951 3300048904 Bacteria 816
448 Ga0496102_0012836 3300048905 Bacteria 7251
449 Ga0496102_0087574 3300048905 Bacteria 2877
450 Ga0496103_0135292 3300048906 Bacteria 1575
451 Ga0496104_0078340 3300048907 Bacteria 3149
452 Ga0496105_0099665 3300048908 Bacteria 2399
453 Ga0496108_0052076 3300048911 Bacteria 3429
454 Ga0496109_0128475 3300048912 Bacteria 2364
455 Ga0496109_1562882 3300048912 Bacteria 594
456 Ga0496110_0220521 3300048913 Bacteria 1724
457 Ga0496111_0015412 3300048914 Bacteria 5245
458 Ga0496112_0133590 3300048915 Bacteria 2452
459 Ga0496112_0807012 3300048915 Bacteria 863
460 Ga0496112_1170133 3300048915 Bacteria 686
461 Ga0496114_0539466 3300048917 Bacteria 1031
462 Ga0496116_0018632 3300048919 Bacteria 5341
463 Ga0496117_0000341 3300048920 Bacteria 82537
464 Ga0496118_0000040 3300048921 Bacteria 304516
465 Ga0496118_0036775 3300048921 Bacteria 3952
466 Ga0496118_0055373 3300048921 Bacteria 2994
467 Ga0496119_0236253 3300048922 Bacteria 928
468 Ga0496120_0000997 3300048923 Bacteria 38249
469 Ga0496120_0413481 3300048923 Bacteria 593
470 Ga0496121_0000461 3300048924 Bacteria 79954
471 Ga0496124_0033917 3300048927 Bacteria 4486
472 Ga0496125_0004912 3300048928 Bacteria 15136
473 Ga0496125_0009052 3300048928 Bacteria 10309
474 Ga0496125_0086132 3300048928 Bacteria 2377
475 Ga0496126_0030986 3300048929 Bacteria 5058
476 Ga0496126_0060488 3300048929 Bacteria 3406
477 Ga0501031_0056726 3300049568 Bacteria 2552
478 Ga0501032_0048703 3300049569 Bacteria 2861
479 Ga0501033_0099613 3300049570 Bacteria 2122
480 Ga0501033_0555801 3300049570 Bacteria 790
481 Ga0501034_0643057 3300049571 Bacteria 963
482 Ga0501034_0747320 3300049571 Bacteria 874
483 Ga0501036_0082774 3300049572 Bacteria 2713
484 Ga0501036_0559321 3300049572 Bacteria 950
485 Ga0501037_0271475 3300049573 Bacteria 1183
486 Ga0501038_0048168 3300049574 Bacteria 3689
487 Ga0501038_0142796 3300049574 Bacteria 1957
488 Ga0501038_0271896 3300049574 Bacteria 1336
489 Ga0501039_0002347 3300049575 Bacteria 14083
490 Ga0501039_0021827 3300049575 Bacteria 4912
491 Ga0501039_0061599 3300049575 Bacteria 2906
492 Ga0501040_0015468 3300049576 Bacteria 5042
493 Ga0501040_0138494 3300049576 Bacteria 1713
494 Ga0501040_0505899 3300049576 Bacteria 871
495 Ga0501041_0006421 3300049577 Bacteria 6882
496 Ga0501041_0020338 3300049577 Bacteria 3968
497 Ga0501041_0022911 3300049577 Bacteria 3742
498 Ga0501041_0869494 3300049577 Bacteria 579
499 Ga0501042_0025147 3300049578 Bacteria 4181
500 Ga0501042_0049658 3300049578 Bacteria 2993
501 Ga0501042_0393566 3300049578 Bacteria 1004
502 Ga0501043_0483007 3300049579 Bacteria 927
503 Ga0501046_0041052 3300049580 Bacteria 3693
504 Ga0501046_0098204 3300049580 Bacteria 2249
505 Ga0501048_0016004 3300049582 Bacteria 5531
506 Ga0501048_0056231 3300049582 Bacteria 2792
507 Ga0501048_0073222 3300049582 Bacteria 2418
508 Ga0501048_0441410 3300049582 Bacteria 932
509 Ga0501067_0582081 3300049583 Bacteria 627
510 Ga0501068_0043614 3300049584 Bacteria 2699
511 Ga0501068_0334522 3300049584 Bacteria 972
512 Ga0501069_0204030 3300049585 Bacteria 1146
513 Ga0501070_0182643 3300049586 Bacteria 1726
514 Ga0501071_0004887 3300049587 Bacteria 8545
515 Ga0501071_0006895 3300049587 Bacteria 7408
516 Ga0501071_0282215 3300049587 Bacteria 1257
517 Ga0501071_0452486 3300049587 Bacteria 983
518 Ga0501071_0967005 3300049587 Bacteria 657
519 Ga0501072_0020116 3300049588 Bacteria 5169
520 Ga0501072_0024717 3300049588 Bacteria 4676
521 Ga0501072_0056250 3300049588 Bacteria 3100
522 Ga0501073_0745813 3300049589 Bacteria 675
523 Ga0501074_0184460 3300049590 Bacteria 1488
524 Ga0501075_0011703 3300049591 Bacteria 6217
525 Ga0501075_0188877 3300049591 Bacteria 1571
526 Ga0501075_0627929 3300049591 Bacteria 819
527 Ga0501076_0009161 3300049592 Bacteria 7294
528 Ga0501076_0264315 3300049592 Bacteria 1409
529 Ga0501076_0309541 3300049592 Bacteria 1295
530 Ga0501076_0954275 3300049592 Bacteria 707
531 Ga0501076_1064713 3300049592 Bacteria 666
532 Ga0501077_0056979 3300049593 Bacteria 2481
533 Ga0501079_0016989 3300049741 Bacteria 5557
534 Ga0501079_0138217 3300049741 Bacteria 1897
535 Ga0501079_0232547 3300049741 Bacteria 1440
536 Ga0501080_0052228 3300049742 Bacteria 3804
537 Ga0501080_0075019 3300049742 Bacteria 3146
538 Ga0501081_0013108 3300049743 Bacteria 5451
539 Ga0501083_0896798 3300049744 Bacteria 577
540 Ga0501035_0337934 3300049822 Bacteria 1262
541 Ga0501035_0667435 3300049822 Bacteria 841
542 Ga0501045_0000225 3300049824 Bacteria 32621
543 Ga0501045_0098675 3300049824 Bacteria 2161
544 nmdc:mga05p37_276778_c1 3300050507 Bacteria 2003
545 nmdc:mga06r32_1066235_c1 3300050510 Bacteria 758
546 nmdc:mga08y16_142719_c1 3300050511 Bacteria 2490
547 Ga0495612_0508699 3300053078 Bacteria 553
548 Ga0500644_0437607 3300053088 Bacteria 572
549 Ga0500583_0377994 3300053092 Bacteria 682
550 Ga0500651_0176496 3300053093 Bacteria 1270
551 Ga0500651_0502805 3300053093 Bacteria 668
552 Ga0500651_0705017 3300053093 Bacteria 539
553 Ga0500556_0001072 3300053104 Bacteria 13870
554 Ga0500658_0447946 3300053134 Bacteria 588
555 Ga0500568_0111310 3300053139 Bacteria 1023
556 Ga0500589_294330 3300053147 Bacteria 577
557 Ga0500616_0000569 3300053153 Bacteria 45203
558 Ga0500616_0051765 3300053153 Bacteria 2162
559 Ga0500616_0149359 3300053153 Bacteria 1083
560 Ga0500637_0017200 3300053178 Bacteria 3867
561 Ga0500611_104311 3300053727 Bacteria 738
562 Ga0501084_0035091 3300054114 Bacteria 4192
563 Ga0501084_0580761 3300054114 Bacteria 947
564 Ga0501082_0008631 3300060353 Bacteria 8786
565 Ga0501082_0153059 3300060353 Bacteria 2004
566 Ga0530510_0013730 3300061734 Bacteria 5700
567 Ga0495598_0039669
568 JGI25406J46586_10004851
569 JGI25405J52794_10065432
570 Ga0065707_10083091
571 Ga0070658_10761454
572 Ga0070690_100066910
573 Ga0070690_100633784
574 Ga0070690_100749357
575 Ga0070670_100348977
576 Ga0070670_100852202
577 Ga0070677_10011868
578 Ga0068869_100439323
579 Ga0070666_10005768
580 Ga0070666_10014311
581 Ga0070666_10060583
582 Ga0070680_100008101
583 Ga0070682_100013181
584 Ga0070682_100017252
585 Ga0070682_100904729
586 Ga0068868_100092738
587 Ga0070689_100031699
588 Ga0070691_10583168
589 Ga0070687_100209446
590 Ga0070669_100054669
591 Ga0070675_100088162
592 Ga0070671_100000211
593 Ga0070674_100107204
594 Ga0070674_100199383
595 Ga0070674_100240609
596 Ga0070674_101265950
597 Ga0070673_100022812
598 Ga0070673_100979311
599 Ga0070659_100690793
600 Ga0070667_100000176
601 Ga0070667_100004044
602 Ga0070667_100043345
603 Ga0070667_100735979
604 Ga0070713_100880757
605 Ga0070701_10090751
606 Ga0070701_10314034
607 Ga0070701_10557216
608 Ga0070700_100026845
609 Ga0070700_100427247
610 Ga0070663_100149191
611 Ga0070662_100664876
612 Ga0070681_10063093
613 Ga0070681_10489471
614 Ga0068867_101485890
615 Ga0068867_101505752
616 Ga0070685_10119325
617 Ga0070685_10409729
618 Ga0070698_100494587
619 Ga0070679_100005267
620 Ga0070679_100012832
621 Ga0070679_100065053
622 Ga0070679_101185447
623 Ga0068853_100148526
624 Ga0068853_100651310
625 Ga0070672_100130285
626 Ga0070686_100637427
627 Ga0070686_100919546
628 Ga0070695_100161281
629 Ga0070693_100094977
630 Ga0070665_100020945
631 Ga0070665_100022101
632 Ga0070665_100023155
633 Ga0070665_100094273
634 Ga0070665_100130179
635 Ga0070665_101444424
636 Ga0070704_100038991
637 Ga0068855_100002075
638 Ga0068855_100030743
639 Ga0068855_100109312
640 Ga0068855_100130404
641 Ga0068857_100314708
642 Ga0068857_100684387
643 Ga0068856_100053231
644 Ga0068856_100137635
645 Ga0070702_100073532
646 Ga0068852_100061881
647 Ga0068859_100002490
648 Ga0068859_100134938
649 Ga0068859_100156136
650 Ga0068859_100391496
651 Ga0068864_100261325
652 Ga0068866_10262636
653 Ga0068861_100151445
654 Ga0068861_100515504
655 Ga0068870_10015437
656 Ga0068870_10101667
657 Ga0068863_100007707
658 Ga0068863_100018700
659 Ga0068863_100048541
660 Ga0068863_100139723
661 Ga0068863_100483917
662 Ga0068863_100907003
663 Ga0068858_100001768
664 Ga0068858_100003825
665 Ga0068860_100006962
666 Ga0068860_100012570
667 Ga0068860_100017517
668 Ga0068860_100027936
669 Ga0068860_100351511
670 Ga0068862_100307369
671 Ga0068862_100312305
672 Ga0068862_100801203
673 Ga0068862_101138734
674 Ga0081455_10001496
675 Ga0081455_10003509
676 Ga0081539_10392654
677 Ga0070712_100015088
678 Ga0097621_100075127
679 Ga0097621_100107080
680 Ga0097621_100718794
681 Ga0068871_100020631
682 Ga0068871_100062046
683 Ga0068871_100108854
684 Ga0068871_101207143
685 Ga0075428_100005214
686 Ga0075429_100300871
687 Ga0097620_100002490
688 Ga0097620_100134938
689 Ga0097620_100156134
690 Ga0097620_100391494
691 Ga0099794_10027978
692 Ga0099794_10063431
693 Ga0099795_10000128
694 Ga0099795_10002137
695 Ga0099795_10532247
696 Ga0105240_10007091
697 Ga0105240_10051958
698 Ga0105240_10091344
699 Ga0105240_10139049
700 Ga0105240_10148590
701 Ga0105240_10833785
702 Ga0111539_10006091
703 Ga0111539_11410039
704 Ga0105247_10000088
705 Ga0105247_10050866
706 Ga0105247_10375554
707 Ga0105242_10056579
708 Ga0105248_10097725
709 Ga0105248_10119206
710 Ga0105248_10480764
711 Ga0105248_10631070
712 Ga0105237_10116469
713 Ga0105237_10268210
714 Ga0105237_10270931
715 Ga0105237_10443720
716 Ga0105238_10038989
717 Ga0105238_10059187
718 Ga0105238_10264239
719 Ga0105238_10961322
720 Ga0105249_10051803
721 Ga0105249_10156282
722 Ga0105249_10249218
723 Ga0105249_11307287
724 Ga0099796_10000281
725 Ga0099796_10005667
726 Ga0099796_10010161
727 Ga0105239_10119480
728 Ga0105239_10604243
729 Ga0105239_10980648
730 Ga0157370_10008536
731 Ga0157370_11016370
732 Ga0157369_10045917
733 Ga0157369_10116075
734 Ga0157369_10415130
735 Ga0157374_10005413
736 Ga0157374_10122696
737 Ga0157378_10132740
738 Ga0157378_11431921
739 Ga0163162_10085353
740 Ga0163162_10141540
741 Ga0163162_10184029
742 Ga0157372_10861355
743 Ga0157375_10206328
744 Ga0157375_10488531
745 Ga0163163_11651394
746 Ga0157380_10269963
747 Ga0157380_10624583
748 Ga0157380_10676688
749 Ga0157379_10001073
750 Ga0157379_10019046
751 Ga0157379_10139171
752 Ga0157379_10400835
753 Ga0157376_10191647
754 Ga0157376_10350343
755 Ga0157376_10719029
756 Ga0163161_10648722
757 Ga0163161_10722796
758 Ga0213873_10063140
759 Ga0213874_10241549
760 Ga0213876_10503144
761 Ga0207697_10273289
762 Ga0207656_10257198
763 Ga0207682_10003258
764 Ga0207692_10945523
765 Ga0207710_10000200
766 Ga0207710_10099302
767 Ga0207710_10278002
768 Ga0207710_10446526
769 Ga0207680_10060822
770 Ga0207647_10077641
771 Ga0207643_10015548
772 Ga0207707_10000045
773 Ga0207707_10023452
774 Ga0207707_10033935
775 Ga0207707_10391072
776 Ga0207695_10005045
777 Ga0207695_10033031
778 Ga0207695_10058289
779 Ga0207695_10072893
780 Ga0207695_10236977
781 Ga0207671_10133165
782 Ga0207671_10785345
783 Ga0207693_10036596
784 Ga0207663_10243448
785 Ga0207660_10019522
786 Ga0207660_10076925
787 Ga0207662_10098196
788 Ga0207649_10073230
789 Ga0207652_10003813
790 Ga0207652_10041713
791 Ga0207652_10442025
792 Ga0207681_10129522
793 Ga0207694_10054617
794 Ga0207650_10031942
795 Ga0207687_10023015
796 Ga0207700_10510627
797 Ga0207644_10002758
798 Ga0207670_10008577
799 Ga0207670_10547058
800 Ga0207669_10063163
801 Ga0207669_10300605
802 Ga0207704_10270960
803 Ga0207691_10031501
804 Ga0207711_10026766
805 Ga0207711_10278632
806 Ga0207711_11512973
807 Ga0207689_10044594
808 Ga0207689_10200479
809 Ga0207689_10226943
810 Ga0207667_10000887
811 Ga0207667_10001163
812 Ga0207667_10157124
813 Ga0207712_10205675
814 Ga0207712_10314735
815 Ga0207640_10354693
816 Ga0207658_10000236
817 Ga0207658_10013360
818 Ga0207658_10050545
819 Ga0207677_10057110
820 Ga0207677_10060644
821 Ga0207703_10000656
822 Ga0207703_10001996
823 Ga0207703_10200103
824 Ga0207703_10555680
825 Ga0207703_11021297
826 Ga0207678_10111211
827 Ga0207708_10029406
828 Ga0207708_10192256
829 Ga0207708_11093031
830 Ga0207702_10108144
831 Ga0207702_10195341
832 Ga0207702_12473850
833 Ga0207641_10006280
834 Ga0207641_10013218
835 Ga0207641_10179721
836 Ga0207641_10228356
837 Ga0207648_10347308
838 Ga0207676_10081930
839 Ga0207676_10159217
840 Ga0207676_10570290
841 Ga0207674_10462059
842 Ga0207675_100031773
843 Ga0207675_100052091
844 Ga0207675_100100688
845 Ga0207675_100179336
846 Ga0209969_1006929
847 Ga0209179_1000062
848 Ga0209970_1029707
849 Ga0209983_1004466
850 Ga0209588_1099526
851 Ga0209974_10017051
852 Ga0207428_10015261
853 Ga0268266_10003011
854 Ga0268266_10041199
855 Ga0268266_10080112
856 Ga0268266_10088261
857 Ga0268266_10113954
858 Ga0268266_10483534
859 Ga0268266_11478265
860 Ga0268265_10066670
861 Ga0268265_10222163
862 Ga0268265_11257228
863 Ga0268265_11625036
864 Ga0268264_10000142
865 Ga0268264_10036104
866 Ga0268264_10095058
867 Ga0265337_1078257
868 Ga0265334_10000887
869 Ga0265318_10004262
870 Ga0307515_10132551
871 Ga0307515_10203513
872 Ga0265338_10020666
873 Ga0265338_10042444
874 Ga0307511_10004421
875 Ga0265330_10006528
876 Ga0265332_10024908
877 Ga0265332_10140681
878 Ga0265332_10173472
879 Ga0265328_10025308
880 Ga0265328_10027532
881 Ga0265328_10305239
882 Ga0265320_10016206
883 Ga0265325_10005887
884 Ga0265329_10002606
885 Ga0265340_10072010
886 Ga0265340_10092937
887 Ga0265331_10007497
888 Ga0265331_10054055
889 Ga0265316_10037551
890 Ga0265316_10108262
891 Ga0307513_10045584
892 Ga0307513_10050748
893 Ga0307513_10072053
894 Ga0307513_10240896
895 Ga0307513_10259121
896 Ga0307509_10000003
897 Ga0307509_10156231
898 Ga0307509_10234352
899 Ga0307408_100034517
900 Ga0307408_101134945
901 Ga0265313_10029110
902 Ga0265314_10031754
903 Ga0316576_10011416
904 Ga0316576_10055512
905 Ga0316576_10520300
906 Ga0307405_10031842
907 Ga0307413_10043698
908 Ga0307413_10945191
909 Ga0307410_10049850
910 Ga0307410_10051095
911 Ga0307406_10230689
912 Ga0307406_10345275
913 Ga0307407_10809207
914 Ga0307412_10108346
915 Ga0307412_10569311
916 Ga0307409_100051576
917 Ga0307409_100225101
918 Ga0307416_100098925
919 Ga0307414_10165634
920 Ga0307414_11086919
921 Ga0307411_10253350
922 Ga0307411_10608401
923 Ga0307411_11583932
924 Ga0307415_100005213
925 Ga0307415_100236415
926 Ga0307415_100826617
927 Ga0307415_101204225
928 Ga0307510_10000001
929 Ga0373956_0262011
930 Ga0316574_0001637
931 Ga0316574_0027407
932 Ga0373937_0039629
933 Ga0373937_0266529
934 Ga0316584_0409014
935 Ga0316584_0442321
936 Ga0373925_0964177
937 Ga0395905_0719353
938 Ga0436364_0060353
939 Ga0436365_0891607
940 Ga0436365_1716422
941 Ga0436365_1863591
942 Ga0436360_0224806
943 Ga0436361_0207937
944 Ga0436361_0656221
945 Ga0436363_0147279
946 Ga0436363_0388984
947 Ga0436363_1607634
948 Ga0436362_0988947
949 Ga0451789_0695360
950 Ga0451791_0725208
951 Ga0451791_1379632
952 Ga0451800_1686224
953 Ga0451802_1583551
954 Ga0451807_0506058
955 Ga0451833_0267791
956 Ga0451837_0947659
957 Ga0439431_0121986
958 Ga0439443_004179
959 Ga0439448_0041486
960 Ga0439454_004081
961 Ga0450923_059472
962 Ga0450894_007261
963 Ga0450895_012350
964 Ga0450896_002550
965 Ga0439446_0007690
966 Ga0450908_003579
967 Ga0439434_0025876
968 Ga0439435_0000245
969 Ga0439444_0000819
970 Ga0439444_0029091
971 Ga0439464_0007636
972 Ga0466972_0019166
973 Ga0466957_0298282
974 Ga0451576_0450650
975 Ga0495603_0099176
976 Ga0495591_019889
977 Ga0495629_0829057
978 Ga0495638_0022812
979 Ga0495638_0054270
980 Ga0495639_0151301
981 Ga0495594_0081141
982 Ga0495583_0029575
983 Ga0495606_0273394
984 Ga0495616_0006284
985 Ga0495630_0194831
986 Ga0495630_0432784
987 Ga0495632_0256115
988 Ga0495644_0008333
989 Ga0495642_0142088
990 Ga0495621_0116426
991 Ga0495645_0225594
992 Ga0495656_0114819
993 Ga0495611_0127959
994 Ga0495625_0018896
995 Ga0495625_0156292
996 Ga0495625_0677773
997 Ga0495657_0252218
998 Ga0495647_0003040
999 Ga0495658_0018711
1000 Ga0495613_0121101
1001 Ga0495670_0028987
1002 Ga0495649_0079609
1003 Ga0495581_0641467
1004 Ga0495604_0322756
1005 Ga0495676_0540395
1006 Ga0495680_0216528
1007 Ga0495687_027925
1008 Ga0495681_0023934
1009 Ga0495602_0594504
1010 Ga0495615_0062533
1011 Ga0496100_0103869
1012 Ga0496100_1193102
1013 Ga0496101_0674951
1014 Ga0496102_0012836
1015 Ga0496102_0087574
1016 Ga0496103_0135292
1017 Ga0496104_0078340
1018 Ga0496105_0099665
1019 Ga0496108_0052076
1020 Ga0496109_0128475
1021 Ga0496109_1562882
1022 Ga0496110_0220521
1023 Ga0496111_0015412
1024 Ga0496112_0133590
1025 Ga0496112_0807012
1026 Ga0496112_1170133
1027 Ga0496114_0539466
1028 Ga0496116_0018632
1029 Ga0496117_0000341
1030 Ga0496118_0000040
1031 Ga0496118_0036775
1032 Ga0496118_0055373
1033 Ga0496119_0236253
1034 Ga0496120_0000997
1035 Ga0496120_0413481
1036 Ga0496121_0000461
1037 Ga0496124_0033917
1038 Ga0496125_0004912
1039 Ga0496125_0009052
1040 Ga0496125_0086132
1041 Ga0496126_0030986
1042 Ga0496126_0060488
1043 Ga0501031_0056726
1044 Ga0501032_0048703
1045 Ga0501033_0099613
1046 Ga0501033_0555801
1047 Ga0501034_0643057
1048 Ga0501034_0747320
1049 Ga0501036_0082774
1050 Ga0501036_0559321
1051 Ga0501037_0271475
1052 Ga0501038_0048168
1053 Ga0501038_0142796
1054 Ga0501038_0271896
1055 Ga0501039_0002347
1056 Ga0501039_0021827
1057 Ga0501039_0061599
1058 Ga0501040_0015468
1059 Ga0501040_0138494
1060 Ga0501040_0505899
1061 Ga0501041_0006421
1062 Ga0501041_0020338
1063 Ga0501041_0022911
1064 Ga0501041_0869494
1065 Ga0501042_0025147
1066 Ga0501042_0049658
1067 Ga0501042_0393566
1068 Ga0501043_0483007
1069 Ga0501046_0041052
1070 Ga0501046_0098204
1071 Ga0501048_0016004
1072 Ga0501048_0056231
1073 Ga0501048_0073222
1074 Ga0501048_0441410
1075 Ga0501067_0582081
1076 Ga0501068_0043614
1077 Ga0501068_0334522
1078 Ga0501069_0204030
1079 Ga0501070_0182643
1080 Ga0501071_0004887
1081 Ga0501071_0006895
1082 Ga0501071_0282215
1083 Ga0501071_0452486
1084 Ga0501071_0967005
1085 Ga0501072_0020116
1086 Ga0501072_0024717
1087 Ga0501072_0056250
1088 Ga0501073_0745813
1089 Ga0501074_0184460
1090 Ga0501075_0011703
1091 Ga0501075_0188877
1092 Ga0501075_0627929
1093 Ga0501076_0009161
1094 Ga0501076_0264315
1095 Ga0501076_0309541
1096 Ga0501076_0954275
1097 Ga0501076_1064713
1098 Ga0501077_0056979
1099 Ga0501079_0016989
1100 Ga0501079_0138217
1101 Ga0501079_0232547
1102 Ga0501080_0052228
1103 Ga0501080_0075019
1104 Ga0501081_0013108
1105 Ga0501083_0896798
1106 Ga0501035_0337934
1107 Ga0501035_0667435
1108 Ga0501045_0000225
1109 Ga0501045_0098675
1110 nmdc:mga05p37_276778_c1
1111 nmdc:mga06r32_1066235_c1
1112 nmdc:mga08y16_142719_c1
1113 Ga0495612_0508699
1114 Ga0500644_0437607
1115 Ga0500583_0377994
1116 Ga0500651_0176496
1117 Ga0500651_0502805
1118 Ga0500651_0705017
1119 Ga0500556_0001072
1120 Ga0500658_0447946
1121 Ga0500568_0111310
1122 Ga0500589_294330
1123 Ga0500616_0000569
1124 Ga0500616_0051765
1125 Ga0500616_0149359
1126 Ga0500637_0017200
1127 Ga0500611_104311
1128 Ga0501084_0035091
1129 Ga0501084_0580761
1130 Ga0501082_0008631
1131 Ga0501082_0153059
1132 Ga0530510_0013730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

76

96

0.96

PF12838

Fer4_7

4Fe-4S dicluster domain

79

126

0.81

Map