F464248

General Info

Members Datasets Scaffolds Average Seq Length
565 306 1130 219

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100219510|Ga0075435_1002195102
Length 238
Sequence MRRNLTKKRQSKGEERLSKIFILNFKNYFEVSGEQTLELALTAQKVVQKLKINLVISPPQPAIALVRKSVRIPVFCQHIDDAPVGQSTGFIVPDIVKTYGISGSLINHSEHRLDHKTIDNLVRRLRDLQMTSVVCTRTPEEVVKIARLKPDFIAIEPPELIGSGKAVSKESPQIISDSISSASKYSNCKIICGAGITDKNDVRTALQLGVEGILVASGIIKSTTWFEKIFELASAFSA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
165 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
166 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
167 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
172 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
212 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
217 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
218 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
248 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
249 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
250 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
251 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
252 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
253 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
254 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
255 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
256 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
259 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
268 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
269 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
270 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
271 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
276 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 5.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.72
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100219510 3300007076 Archaea 1614
2 JGI24740J21852_10040024 3300001979 Unclassified 1424
3 JGI24744J21845_10033251 3300002077 Archaea 982
4 JGI24033J26618_1004937 3300002155 Archaea 1455
5 JGI24742J22300_10016112 3300002244 Archaea 1260
6 Ga0006759J45824_1048715 3300003163 Archaea 1939
7 Ga0007417J51691_1057006 3300003544 Archaea 2096
8 Ga0032354_1047988 3300003693 Archaea 1980
9 Ga0058861_10075552 3300004800 Archaea 1775
10 Ga0058862_10181633 3300004803 Archaea 1652
11 Ga0070683_100112402 3300005329 Archaea 2570
12 Ga0070680_100086186 3300005336 Archaea 2596
13 Ga0070682_100019892 3300005337 Archaea 3943
14 Ga0070682_100069576 3300005337 Archaea 2248
15 Ga0068868_100073940 3300005338 Archaea 2721
16 Ga0068868_100755042 3300005338 Archaea 874
17 Ga0070692_10019074 3300005345 Archaea 3307
18 Ga0070674_100684834 3300005356 Archaea 875
19 Ga0070673_100127742 3300005364 Archaea 2129
20 Ga0070659_100089163 3300005366 Archaea 2471
21 Ga0070659_100356077 3300005366 Archaea 1229
22 Ga0070667_100000187 3300005367 Bacteria 74607
23 Ga0070667_100160267 3300005367 Bacteria 1981
24 Ga0070709_10002048 3300005434 Archaea 10945
25 Ga0070709_10335597 3300005434 Archaea 1113
26 Ga0070714_100008739 3300005435 Archaea 7918
27 Ga0070714_100191748 3300005435 Archaea 1865
28 Ga0070714_100362195 3300005435 Archaea 1363
29 Ga0070713_100031805 3300005436 Archaea 4207
30 Ga0070713_100253039 3300005436 Archaea 1607
31 Ga0070701_10285115 3300005438 Archaea 1010
32 Ga0070711_100000393 3300005439 Archaea 22532
33 Ga0070711_100017002 3300005439 Archaea 4625
34 Ga0070711_100018518 3300005439 Archaea 4449
35 Ga0070711_100026720 3300005439 Archaea 3785
36 Ga0070711_100032392 3300005439 Archaea 3475
37 Ga0070711_100057131 3300005439 Archaea 2701
38 Ga0070711_100563498 3300005439 Archaea 946
39 Ga0070705_100406237 3300005440 Archaea 1010
40 Ga0070700_100093531 3300005441 Archaea 1967
41 Ga0070700_100275352 3300005441 Archaea 1218
42 Ga0070694_100000188 3300005444 Archaea 32366
43 Ga0070694_100502589 3300005444 Archaea 965
44 Ga0070663_100055110 3300005455 Archaea 2844
45 Ga0070678_100118694 3300005456 Archaea 2082
46 Ga0070681_10006519 3300005458 Archaea 11359
47 Ga0070707_100019829 3300005468 Bacteria 6339
48 Ga0070707_100302694 3300005468 Archaea 1554
49 Ga0070707_100377460 3300005468 Unclassified 1377
50 Ga0070698_100002215 3300005471 Archaea 21514
51 Ga0070699_100078821 3300005518 Archaea 2869
52 Ga0070699_100279335 3300005518 Archaea 1496
53 Ga0070699_100579302 3300005518 Archaea 1022
54 Ga0070684_100029980 3300005535 Archaea 4617
55 Ga0070684_100038804 3300005535 Archaea 4093
56 Ga0070684_100225467 3300005535 Archaea 1710
57 Ga0070684_100257133 3300005535 Archaea 1597
58 Ga0070697_100113440 3300005536 Archaea 2261
59 Ga0070697_100671046 3300005536 Unclassified 913
60 Ga0070686_100119630 3300005544 Archaea 1806
61 Ga0070695_100702976 3300005545 Archaea 802
62 Ga0070696_100012104 3300005546 Archaea 5780
63 Ga0070696_100018931 3300005546 Archaea 4661
64 Ga0070696_100226401 3300005546 Archaea 1405
65 Ga0070696_100482764 3300005546 Archaea 983
66 Ga0070693_100022397 3300005547 Archaea 3359
67 Ga0070693_100033528 3300005547 Archaea 2835
68 Ga0070704_100000163 3300005549 Archaea 26253
69 Ga0070704_100490662 3300005549 Archaea 1064
70 Ga0068854_100120926 3300005578 Archaea 1988
71 Ga0068856_100012028 3300005614 Archaea 8384
72 Ga0068856_100109455 3300005614 Archaea 2759
73 Ga0070702_100013171 3300005615 Archaea 4168
74 Ga0068864_100142179 3300005618 Archaea 2166
75 Ga0068864_100609498 3300005618 Archaea 1060
76 Ga0081455_10012595 3300005937 Archaea 8430
77 Ga0081455_10021678 3300005937 Archaea 6020
78 Ga0081455_10302583 3300005937 Archaea 1147
79 Ga0081455_10303331 3300005937 Archaea 1145
80 Ga0081538_10002416 3300005981 Archaea 18314
81 Ga0081538_10002449 3300005981 Archaea 18151
82 Ga0081538_10027613 3300005981 Archaea 3929
83 Ga0081538_10027748 3300005981 Archaea 3915
84 Ga0070717_10038242 3300006028 Archaea 3900
85 Ga0070715_10001193 3300006163 Archaea 7474
86 Ga0070716_100001093 3300006173 Archaea 11900
87 Ga0070716_100163668 3300006173 Unclassified 1444
88 Ga0070716_100495284 3300006173 Archaea 900
89 Ga0070712_100021451 3300006175 Archaea 4243
90 Ga0075428_100002390 3300006844 Archaea 20379
91 Ga0075428_100036339 3300006844 Archaea 5426
92 Ga0075430_100000144 3300006846 Archaea 45435
93 Ga0075430_100006543 3300006846 Bacteria 9828
94 Ga0075430_100017159 3300006846 Archaea 6164
95 Ga0075430_100019051 3300006846 Archaea 5839
96 Ga0075430_100167010 3300006846 Archaea 1831
97 Ga0075431_100000889 3300006847 Archaea 26346
98 Ga0075431_100014141 3300006847 Archaea 8069
99 Ga0075431_100057189 3300006847 Archaea 4023
100 Ga0075433_10077877 3300006852 Archaea 2921
101 Ga0075433_10115753 3300006852 Archaea 2379
102 Ga0075434_100002392 3300006871 Archaea 16465
103 Ga0075434_100005309 3300006871 Archaea 11722
104 Ga0075434_100052588 3300006871 Unclassified 4047
105 Ga0075429_100001388 3300006880 Archaea 19783
106 Ga0075429_100016875 3300006880 Archaea 6317
107 Ga0075429_100065015 3300006880 Archaea 3176
108 Ga0075429_100266671 3300006880 Unclassified 1500
109 Ga0075436_100085123 3300006914 Archaea 2194
110 Ga0075436_100196720 3300006914 Archaea 1427
111 Ga0075435_100006342 3300007076 Archaea 8356
112 Ga0075435_100027398 3300007076 Unclassified 4457
113 Ga0099794_10008806 3300007265 Bacteria 4206
114 Ga0099794_10092214 3300007265 Bacteria 1504
115 Ga0111539_10003551 3300009094 Archaea 20562
116 Ga0111539_10021758 3300009094 Archaea 7884
117 Ga0111539_10024710 3300009094 Archaea 7369
118 Ga0111539_10232296 3300009094 Archaea 2148
119 Ga0111539_10322778 3300009094 Archaea 1797
120 Ga0114129_10003144 3300009147 Archaea 23175
121 Ga0114129_10004729 3300009147 Archaea 19232
122 Ga0114129_10033089 3300009147 Archaea 7306
123 Ga0105241_10042036 3300009174 Archaea 3456
124 Ga0105242_10360434 3300009176 Archaea 1345
125 Ga0105242_10733752 3300009176 Archaea 970
126 Ga0105237_10126045 3300009545 Archaea 2555
127 Ga0105237_10374958 3300009545 Archaea 1427
128 Ga0105238_10596475 3300009551 Archaea 1112
129 Ga0105239_10007179 3300010375 Archaea 12813
130 Ga0105239_10026960 3300010375 Archaea 6324
131 Ga0105246_10013885 3300011119 Archaea 5055
132 Ga0105246_10177056 3300011119 Archaea 1639
133 Ga0157341_1002845 3300012494 Archaea 1172
134 Ga0157369_10034799 3300013105 Archaea 5525
135 Ga0157374_11236337 3300013296 Archaea 768
136 Ga0157378_10079610 3300013297 Archaea 2959
137 Ga0157378_10107341 3300013297 Archaea 2555
138 Ga0157372_10040639 3300013307 Archaea 5138
139 Ga0163163_10227228 3300014325 Archaea 1915
140 Ga0157380_10129044 3300014326 Archaea 2154
141 Ga0182008_10017210 3300014497 Archaea 3751
142 Ga0157377_10002233 3300014745 Archaea 8508
143 Ga0157377_10027476 3300014745 Archaea 3055
144 Ga0157377_10054459 3300014745 Unclassified 2265
145 Ga0157377_10360378 3300014745 Archaea 978
146 Ga0157376_10076849 3300014969 Archaea 2854
147 Ga0182006_1023035 3300015261 Archaea 2581
148 Ga0182007_10010157 3300015262 Unclassified 3737
149 Ga0197907_10160485 3300020069 Archaea 3337
150 Ga0206349_1281462 3300020075 Archaea 2380
151 Ga0206351_10488721 3300020077 Archaea 1968
152 Ga0206351_10755942 3300020077 Unclassified 1331
153 Ga0206352_10865422 3300020078 Archaea 1092
154 Ga0206350_10426237 3300020080 Archaea 1801
155 Ga0206350_11109503 3300020080 Archaea 1365
156 Ga0206354_10608992 3300020081 Archaea 2341
157 Ga0206353_11571214 3300020082 Archaea 1941
158 Ga0224712_10018486 3300022467 Archaea 2331
159 Ga0207692_10049651 3300025898 Archaea 2118
160 Ga0207692_10117969 3300025898 Archaea 1482
161 Ga0207688_10019921 3300025901 Archaea 3659
162 Ga0207647_10048193 3300025904 Archaea 2647
163 Ga0207685_10009548 3300025905 Archaea 2823
164 Ga0207699_10002122 3300025906 Archaea 9376
165 Ga0207699_10276798 3300025906 Archaea 1165
166 Ga0207699_10293756 3300025906 Archaea 1133
167 Ga0207684_10091625 3300025910 Unclassified 2591
168 Ga0207707_10005545 3300025912 Archaea 11034
169 Ga0207693_10000742 3300025915 Archaea 29399
170 Ga0207693_10064742 3300025915 Archaea 2863
171 Ga0207663_10001213 3300025916 Archaea 11898
172 Ga0207663_10009809 3300025916 Archaea 5069
173 Ga0207663_10033198 3300025916 Archaea 3072
174 Ga0207663_10044383 3300025916 Archaea 2728
175 Ga0207663_10505731 3300025916 Archaea 939
176 Ga0207646_10129134 3300025922 Archaea 2274
177 Ga0207694_10690827 3300025924 Archaea 860
178 Ga0207700_10013417 3300025928 Archaea 5330
179 Ga0207664_10369591 3300025929 Archaea 1272
180 Ga0207690_10121587 3300025932 Archaea 1898
181 Ga0207669_10162029 3300025937 Archaea 1581
182 Ga0207665_10000731 3300025939 Archaea 22136
183 Ga0207665_10013079 3300025939 Archaea 5453
184 Ga0207665_10161994 3300025939 Archaea 1610
185 Ga0207665_10225723 3300025939 Archaea 1375
186 Ga0207661_10050218 3300025944 Archaea 3322
187 Ga0207661_10141587 3300025944 Archaea 2070
188 Ga0207679_10336903 3300025945 Archaea 1311
189 Ga0207658_10000088 3300025986 Bacteria 100454
190 Ga0207677_10077133 3300026023 Archaea 2375
191 Ga0207677_10240530 3300026023 Archaea 1464
192 Ga0207708_10126618 3300026075 Archaea 1994
193 Ga0207708_10127849 3300026075 Archaea 1984
194 Ga0207702_10063398 3300026078 Archaea 3160
195 Ga0207702_11181620 3300026078 Archaea 759
196 Ga0207676_10393185 3300026095 Archaea 1294
197 Ga0207683_10032909 3300026121 Archaea 4504
198 Ga0207683_10212043 3300026121 Archaea 1763
199 Ga0207683_10483573 3300026121 Archaea 1143
200 Ga0209996_1024611 3300027395 Archaea 859
201 Ga0209982_1014801 3300027552 Archaea 1180
202 Ga0207428_10000142 3300027907 Archaea 97018
203 Ga0207428_10016046 3300027907 Archaea 6455
204 Ga0207428_10205980 3300027907 Archaea 1479
205 Ga0265326_10000049 3300028558 Archaea 68293
206 Ga0265326_10000052 3300028558 Archaea 67819
207 Ga0265334_10002344 3300028573 Archaea 8911
208 Ga0265334_10039866 3300028573 Archaea 1842
209 Ga0265323_10006445 3300028653 Archaea 4939
210 Ga0265323_10017897 3300028653 Bacteria 2747
211 Ga0265322_10000101 3300028654 Archaea 40002
212 Ga0265336_10000009 3300028666 Archaea 307432
213 Ga0265336_10000056 3300028666 Archaea 105723
214 Ga0265338_10000015 3300028800 Archaea 348812
215 Ga0265338_10000020 3300028800 Archaea 329350
216 Ga0265324_10000105 3300029957 Archaea 66830
217 Ga0265324_10000197 3300029957 Archaea 45991
218 Ga0265330_10000225 3300031235 Bacteria 43261
219 Ga0265330_10085321 3300031235 Archaea 1358
220 Ga0265332_10007509 3300031238 Archaea 4929
221 Ga0265332_10007802 3300031238 Archaea 4832
222 Ga0265332_10023017 3300031238 Archaea 2748
223 Ga0265328_10029015 3300031239 Archaea 2068
224 Ga0265320_10122734 3300031240 Archaea 1184
225 Ga0265325_10000409 3300031241 Archaea 30518
226 Ga0265329_10008879 3300031242 Archaea 3786
227 Ga0265340_10000050 3300031247 Archaea 54683
228 Ga0265340_10000093 3300031247 Archaea 42253
229 Ga0265339_10000072 3300031249 Archaea 88405
230 Ga0265339_10002474 3300031249 Archaea 13214
231 Ga0265331_10000062 3300031250 Archaea 167403
232 Ga0265331_10000226 3300031250 Archaea 67836
233 Ga0265316_10003273 3300031344 Archaea 16444
234 Ga0265316_10033669 3300031344 Unclassified 4170
235 Ga0265316_10089968 3300031344 Bacteria 2342
236 Ga0307408_100010987 3300031548 Archaea 5974
237 Ga0265314_10001075 3300031711 Archaea 31653
238 Ga0265314_10074164 3300031711 Archaea 2267
239 Ga0265342_10000411 3300031712 Bacteria 47063
240 Ga0265342_10052044 3300031712 Archaea 2441
241 Ga0307405_10124821 3300031731 Unclassified 1768
242 Ga0307405_10147229 3300031731 Archaea 1651
243 Ga0307413_10016986 3300031824 Archaea 3779
244 Ga0307413_10375125 3300031824 Archaea 1106
245 Ga0307413_10512420 3300031824 Archaea 965
246 Ga0307410_10128108 3300031852 Unclassified 1861
247 Ga0307406_10041948 3300031901 Archaea 2854
248 Ga0307406_10887207 3300031901 Archaea 758
249 Ga0307407_10015237 3300031903 Archaea 3792
250 Ga0307407_10059538 3300031903 Archaea 2225
251 Ga0307412_10117333 3300031911 Archaea 1911
252 Ga0307412_10323872 3300031911 Unclassified 1227
253 Ga0307412_10577733 3300031911 Archaea 948
254 Ga0307409_100012979 3300031995 Archaea 5336
255 Ga0307409_100228508 3300031995 Archaea 1685
256 Ga0307409_100714610 3300031995 Archaea 1002
257 Ga0307416_100044357 3300032002 Archaea 3490
258 Ga0307416_101240032 3300032002 Archaea 851
259 Ga0307416_101315755 3300032002 Archaea 828
260 Ga0307414_10238467 3300032004 Archaea 1504
261 Ga0307411_10001387 3300032005 Archaea 9828
262 Ga0307411_10047801 3300032005 Archaea 2768
263 Ga0307411_10141836 3300032005 Unclassified 1773
264 Ga0307411_10184791 3300032005 Archaea 1586
265 Ga0307415_100035771 3300032126 Archaea 3247
266 Ga0307415_100040078 3300032126 Archaea 3101
267 Ga0307415_100294362 3300032126 Unclassified 1341
268 Ga0373934_0016052 3300035086 Archaea 2845
269 Ga0373944_0123366 3300035089 Unclassified 895
270 Ga0373936_0080694 3300035113 Archaea 1354
271 Ga0373953_0012787 3300035117 Unclassified 2980
272 Ga0373954_0001570 3300035118 Archaea 9315
273 Ga0373956_0001243 3300035119 Archaea 10553
274 Ga0373957_0095867 3300035120 Bacteria 1183
275 Ga0373960_0051697 3300035121 Archaea 1222
276 Ga0373943_0207805 3300035170 Archaea 1086
277 Ga0373955_0001053 3300035172 Archaea 11745
278 Ga0373942_0035382 3300035207 Unclassified 1340
279 Ga0373924_0005606 3300035410 Unclassified 4452
280 Ga0373931_0264841 3300035691 Unclassified 1050
281 Ga0373935_0055187 3300035692 Archaea 2531
282 Ga0373927_0129833 3300035695 Archaea 1646
283 Ga0373933_0000099 3300035724 Archaea 54073
284 Ga0373947_0107246 3300035725 Archaea 1761
285 Ga0373937_0000283 3300036401 Archaea 48653
286 Ga0373925_0479424 3300037068 Archaea 1020
287 Ga0242419_000259 3300038698 Unclassified 2802
288 Ga0242422_01218 3300038699 Archaea 1775
289 Ga0242420_000068 3300038996 Archaea 10043
290 Ga0400489_73332 3300039093 Archaea 13984
291 Ga0436362_0492850 3300039453 Archaea 877
292 Ga0439439_0033551 3300041406 Archaea 1314
293 Ga0439461_0020427 3300041410 Archaea 1311
294 Ga0450920_011323 3300042122 Archaea 1662
295 Ga0450906_001973 3300042145 Unclassified 4488
296 Ga0451577_0111744 3300042876 Archaea 2445
297 Ga0451577_0515565 3300042876 Unclassified 1086
298 Ga0453684_0000013 3300044712 Archaea 1034059
299 Ga0453684_0000016 3300044712 Archaea 938453
300 Ga0453684_0000145 3300044712 Archaea 313029
301 Ga0453684_0014592 3300044712 Archaea 12544
302 Ga0453684_0017015 3300044712 Archaea 11296
303 Ga0453684_0038282 3300044712 Archaea 6560
304 Ga0453684_0250993 3300044712 Archaea 2032
305 Ga0466960_0066226 3300044901 Archaea 1786
306 Ga0466958_0446451 3300045836 Archaea 837
307 Ga0466967_0614588 3300045976 Unclassified 1073
308 Ga0495592_0204105 3300046454 Archaea 1332
309 Ga0495651_0001178 3300046462 Archaea 20198
310 Ga0495653_0036901 3300046463 Archaea 3846
311 Ga0495652_0003635 3300046529 Archaea 15101
312 Ga0495640_0115305 3300046533 Archaea 1751
313 Ga0495587_0014490 3300046536 Unclassified 4943
314 Ga0495645_0311789 3300046543 Archaea 1024
315 Ga0495635_0059295 3300046663 Archaea 2632
316 Ga0495657_0042326 3300046675 Archaea 3111
317 Ga0495599_0010471 3300046678 Archaea 5673
318 Ga0495646_0059807 3300046680 Archaea 2274
319 Ga0495600_0165910 3300046809 Archaea 1426
320 Ga0495604_0087454 3300047317 Unclassified 2321
321 Ga0495674_0189684 3300047319 Archaea 1709
322 Ga0495675_0060702 3300047444 Unclassified 2396
323 Ga0495684_0441040 3300047471 Unclassified 907
324 Ga0495602_0002115 3300048088 Archaea 20011
325 Ga0496100_0040036 3300048903 Archaea 2979
326 Ga0496100_0054920 3300048903 Archaea 2600
327 Ga0496101_0118801 3300048904 Archaea 1997
328 Ga0496101_0256802 3300048904 Archaea 1362
329 Ga0496102_0062886 3300048905 Archaea 3398
330 Ga0496104_0050694 3300048907 Archaea 3917
331 Ga0496104_0354459 3300048907 Archaea 1380
332 Ga0496105_0106488 3300048908 Archaea 2315
333 Ga0496106_0013323 3300048909 Archaea 6070
334 Ga0496106_0018784 3300048909 Archaea 5121
335 Ga0496106_0025031 3300048909 Archaea 4440
336 Ga0496107_0055675 3300048910 Archaea 2856
337 Ga0496107_0057359 3300048910 Archaea 2815
338 Ga0496108_0117553 3300048911 Archaea 2278
339 Ga0496109_0164200 3300048912 Archaea 2081
340 Ga0496110_0099600 3300048913 Archaea 2605
341 Ga0496111_0057234 3300048914 Archaea 2822
342 Ga0496112_0164091 3300048915 Archaea 2187
343 Ga0496112_0166154 3300048915 Archaea 2173
344 Ga0496113_0464007 3300048916 Archaea 1017
345 Ga0496115_0100612 3300048918 Archaea 2370
346 Ga0501306_009632 3300049127 Archaea 1201
347 Ga0501343_005551 3300049132 Archaea 968
348 Ga0501290_009045 3300049513 Archaea 1265
349 Ga0501291_002059 3300049514 Archaea 2376
350 Ga0501291_008133 3300049514 Archaea 1441
351 Ga0501291_068826 3300049514 Archaea 682
352 Ga0501292_000653 3300049515 Archaea 4239
353 Ga0501297_002011 3300049520 Archaea 1934
354 Ga0501298_007648 3300049521 Unclassified 1796
355 Ga0501299_002695 3300049522 Unclassified 2483
356 Ga0501300_006512 3300049523 Archaea 1717
357 Ga0501321_006416 3300049537 Archaea 1195
358 Ga0501323_002169 3300049539 Archaea 1873
359 Ga0501325_003870 3300049541 Unclassified 1116
360 Ga0501325_004876 3300049541 Archaea 1046
361 Ga0501328_01255 3300049544 Archaea 987
362 Ga0501335_007899 3300049551 Archaea 991
363 Ga0501031_0003608 3300049568 Archaea 9953
364 Ga0501031_0009778 3300049568 Archaea 6244
365 Ga0501031_0050721 3300049568 Archaea 2703
366 Ga0501031_0141182 3300049568 Archaea 1574
367 Ga0501031_0154281 3300049568 Archaea 1501
368 Ga0501031_0222155 3300049568 Unclassified 1230
369 Ga0501032_0003802 3300049569 Archaea 11462
370 Ga0501032_0116888 3300049569 Archaea 1763
371 Ga0501032_0445048 3300049569 Archaea 830
372 Ga0501033_0023763 3300049570 Archaea 4623
373 Ga0501034_0004702 3300049571 Archaea 15115
374 Ga0501036_0000445 3300049572 Archaea 29485
375 Ga0501036_0005056 3300049572 Archaea 10676
376 Ga0501036_0018384 3300049572 Archaea 5855
377 Ga0501036_0082881 3300049572 Archaea 2710
378 Ga0501036_0254262 3300049572 Unclassified 1472
379 Ga0501037_0006473 3300049573 Archaea 8563
380 Ga0501037_0054693 3300049573 Archaea 2919
381 Ga0501037_0135613 3300049573 Archaea 1763
382 Ga0501037_0171699 3300049573 Archaea 1541
383 Ga0501037_0186187 3300049573 Archaea 1471
384 Ga0501038_0002480 3300049574 Archaea 17167
385 Ga0501038_0269755 3300049574 Unclassified 1342
386 Ga0501038_0411207 3300049574 Unclassified 1045
387 Ga0501039_0000212 3300049575 Archaea 42568
388 Ga0501039_0001730 3300049575 Archaea 16079
389 Ga0501039_0026129 3300049575 Archaea 4486
390 Ga0501039_0039514 3300049575 Unclassified 3644
391 Ga0501039_0139698 3300049575 Unclassified 1903
392 Ga0501039_0430444 3300049575 Archaea 1036
393 Ga0501040_0000133 3300049576 Archaea 39563
394 Ga0501040_0000480 3300049576 Archaea 23811
395 Ga0501040_0012728 3300049576 Archaea 5520
396 Ga0501040_0160644 3300049576 Archaea 1588
397 Ga0501041_0000166 3300049577 Archaea 29296
398 Ga0501041_0001799 3300049577 Archaea 12012
399 Ga0501041_0070490 3300049577 Archaea 2145
400 Ga0501041_0345845 3300049577 Unclassified 939
401 Ga0501041_0391025 3300049577 Archaea 880
402 Ga0501042_0000913 3300049578 Archaea 16547
403 Ga0501042_0010378 3300049578 Archaea 6242
404 Ga0501042_0013261 3300049578 Archaea 5610
405 Ga0501042_0016650 3300049578 Archaea 5052
406 Ga0501042_0018403 3300049578 Archaea 4835
407 Ga0501042_0019228 3300049578 Archaea 4740
408 Ga0501042_0042658 3300049578 Unclassified 3230
409 Ga0501042_0277329 3300049578 Archaea 1211
410 Ga0501043_0008596 3300049579 Archaea 8047
411 Ga0501043_0044630 3300049579 Unclassified 3486
412 Ga0501046_0120223 3300049580 Archaea 1999
413 Ga0501046_0223953 3300049580 Archaea 1392
414 Ga0501047_0014604 3300049581 Archaea 7472
415 Ga0501048_0000224 3300049582 Archaea 37245
416 Ga0501048_0015526 3300049582 Archaea 5626
417 Ga0501048_0024790 3300049582 Unclassified 4375
418 Ga0501048_0026370 3300049582 Archaea 4231
419 Ga0501068_0162141 3300049584 Archaea 1409
420 Ga0501070_0107794 3300049586 Archaea 2302
421 Ga0501070_0630783 3300049586 Archaea 852
422 Ga0501071_0000106 3300049587 Archaea 32406
423 Ga0501071_0009839 3300049587 Archaea 6383
424 Ga0501071_0010809 3300049587 Archaea 6122
425 Ga0501071_0031946 3300049587 Archaea 3735
426 Ga0501071_0185239 3300049587 Archaea 1560
427 Ga0501072_0000239 3300049588 Archaea 40354
428 Ga0501072_0001821 3300049588 Archaea 15868
429 Ga0501072_0022046 3300049588 Archaea 4942
430 Ga0501072_0109708 3300049588 Archaea 2196
431 Ga0501072_0268877 3300049588 Unclassified 1356
432 Ga0501072_0404137 3300049588 Unclassified 1083
433 Ga0501073_0031189 3300049589 Archaea 3804
434 Ga0501074_0054247 3300049590 Unclassified 2891
435 Ga0501074_0059843 3300049590 Archaea 2744
436 Ga0501074_0184676 3300049590 Archaea 1487
437 Ga0501075_0001017 3300049591 Archaea 17945
438 Ga0501075_0001884 3300049591 Archaea 13844
439 Ga0501075_0002162 3300049591 Archaea 13018
440 Ga0501075_0020034 3300049591 Archaea 4858
441 Ga0501075_0023173 3300049591 Archaea 4543
442 Ga0501076_0000515 3300049592 Archaea 24516
443 Ga0501076_0000585 3300049592 Archaea 23273
444 Ga0501076_0031254 3300049592 Unclassified 4151
445 Ga0501077_0004631 3300049593 Archaea 8354
446 Ga0501077_0036341 3300049593 Archaea 3137
447 Ga0501077_0062275 3300049593 Archaea 2367
448 Ga0501077_0143110 3300049593 Archaea 1517
449 Ga0501077_0248126 3300049593 Archaea 1132
450 Ga0501202_006991 3300049652 Archaea 2033
451 Ga0501202_103738 3300049652 Archaea 696
452 Ga0501206_021966 3300049653 Archaea 914
453 Ga0501209_000354 3300049656 Archaea 5611
454 Ga0501209_050380 3300049656 Archaea 1134
455 Ga0501214_000755 3300049659 Archaea 2319
456 Ga0501214_027073 3300049659 Archaea 765
457 Ga0501216_001973 3300049660 Archaea 2852
458 Ga0501217_006433 3300049661 Archaea 2495
459 Ga0501233_002375 3300049668 Archaea 3309
460 Ga0501233_033376 3300049668 Archaea 1175
461 Ga0501235_005380 3300049669 Archaea 2788
462 Ga0501252_020340 3300049682 Unclassified 863
463 Ga0501260_015685 3300049689 Archaea 793
464 Ga0501261_011010 3300049690 Archaea 1199
465 Ga0501219_003173 3300049703 Archaea 1202
466 Ga0501221_025175 3300049704 Archaea 1200
467 Ga0501225_0011554 3300049705 Archaea 2483
468 Ga0501234_005876 3300049707 Archaea 1917
469 Ga0501234_027270 3300049707 Archaea 918
470 Ga0501245_017874 3300049708 Archaea 1086
471 Ga0501079_0000307 3300049741 Archaea 30498
472 Ga0501079_0007035 3300049741 Archaea 8489
473 Ga0501079_0044095 3300049741 Unclassified 3442
474 Ga0501079_0067797 3300049741 Bacteria 2754
475 Ga0501079_0635606 3300049741 Archaea 840
476 Ga0501079_0693039 3300049741 Archaea 802
477 Ga0501080_0000679 3300049742 Archaea 27174
478 Ga0501080_0102404 3300049742 Archaea 2656
479 Ga0501080_0267026 3300049742 Archaea 1558
480 Ga0501081_0001507 3300049743 Bacteria 14297
481 Ga0501081_0018381 3300049743 Archaea 4642
482 Ga0501081_0025005 3300049743 Unclassified 4014
483 Ga0501081_0225605 3300049743 Archaea 1363
484 Ga0501081_1022026 3300049743 Unclassified 625
485 Ga0501083_0042816 3300049744 Archaea 3069
486 Ga0501265_020087 3300049762 Archaea 897
487 Ga0501268_088675 3300049765 Archaea 649
488 Ga0501276_001999 3300049773 Unclassified 1422
489 Ga0501279_019637 3300049775 Archaea 957
490 Ga0501283_018337 3300049779 Unclassified 1101
491 Ga0501035_0001748 3300049822 Archaea 21937
492 Ga0501035_0040878 3300049822 Archaea 4188
493 Ga0501035_0056094 3300049822 Unclassified 3517
494 Ga0501044_0001725 3300049823 Archaea 25583
495 Ga0501044_0205368 3300049823 Archaea 1927
496 Ga0501045_0000235 3300049824 Archaea 32144
497 Ga0501045_0003484 3300049824 Archaea 10765
498 Ga0501045_0010209 3300049824 Archaea 6572
499 Ga0501045_0057881 3300049824 Archaea 2837
500 Ga0501045_0083429 3300049824 Archaea 2357
501 Ga0501045_0097539 3300049824 Archaea 2174
502 Ga0501204_002074 3300049850 Archaea 2018
503 Ga0501212_034873 3300049851 Unclassified 820
504 nmdc:mga05p37_16076_c1 3300050507 Archaea 9008
505 nmdc:mga05p37_241301_c1 3300050507 Archaea 2173
506 nmdc:mga05p37_521_c1 3300050507 Archaea 42618
507 nmdc:mga05p37_58481_c1 3300050507 Archaea 4748
508 nmdc:mga05p37_6253_c1 3300050507 Archaea 14020
509 nmdc:mga09592_10607_c1 3300050508 Archaea 7503
510 nmdc:mga09592_108_c1 3300050508 Archaea 51560
511 nmdc:mga09592_16514_c1 3300050508 Archaea 6039
512 nmdc:mga0qj67_4639_c1 3300050509 Archaea 9971
513 nmdc:mga0qj67_5369_c1 3300050509 Archaea 9355
514 nmdc:mga0qj67_565_c1 3300050509 Archaea 25236
515 nmdc:mga06r32_17721_c2 3300050510 Archaea 4092
516 nmdc:mga06r32_4059_c1 3300050510 Archaea 13130
517 nmdc:mga06r32_4769_c1 3300050510 Archaea 12195
518 nmdc:mga08y16_10442_c1 3300050511 Archaea 9742
519 nmdc:mga08y16_416_c1 3300050511 Archaea 39145
520 nmdc:mga08y16_8723_c1 3300050511 Archaea 10633
521 nmdc:mga0n895_155447_c1 3300050512 Archaea 2318
522 nmdc:mga0n895_4320_c1 3300050512 Archaea 11645
523 nmdc:mga0n895_493952_c1 3300050512 Archaea 1233
524 nmdc:mga0rr50_215488_c1 3300050513 Archaea 1584
525 nmdc:mga0rr50_4441_c1 3300050513 Archaea 8253
526 nmdc:mga08x19_192149_c1 3300050514 Unclassified 1397
527 nmdc:mga0a205_99649_c1 3300050515 Unclassified 2804
528 Ga0495601_0092684 3300053077 Unclassified 1946
529 Ga0495612_0018720 3300053078 Unclassified 2774
530 Ga0495595_0038117 3300053084 Unclassified 2188
531 Ga0495619_0000113 3300053085 Archaea 60859
532 Ga0501084_0000317 3300054114 Archaea 36682
533 Ga0501084_0003148 3300054114 Archaea 13345
534 Ga0501084_0008709 3300054114 Archaea 8392
535 Ga0501084_0063990 3300054114 Archaea 3079
536 Ga0501084_0077335 3300054114 Unclassified 2790
537 Ga0501084_0117363 3300054114 Archaea 2237
538 Ga0590071_009656 3300059421 Archaea 2265
539 Ga0590071_020815 3300059421 Archaea 1546
540 Ga0590074_001143 3300059423 Unclassified 4182
541 Ga0590075_001812 3300059424 Archaea 5220
542 Ga0590075_002488 3300059424 Archaea 4411
543 Ga0590077_009895 3300059426 Archaea 1960
544 Ga0590077_033304 3300059426 Archaea 1131
545 Ga0587093_003202 3300059478 Unclassified 1588
546 Ga0587066_003206 3300059490 Archaea 1901
547 Ga0587070_003380 3300059491 Archaea 1914
548 Ga0587073_0020974 3300059492 Unclassified 1252
549 Ga0587083_0011856 3300059505 Archaea 1449
550 Ga0587088_024800 3300059508 Unclassified 1030
551 Ga0587089_013153 3300059509 Unclassified 1067
552 Ga0587109_005296 3300059624 Archaea 1843
553 Ga0587067_009253 3300059640 Archaea 1464
554 Ga0587076_039776 3300059645 Unclassified 874
555 Ga0501082_0001455 3300060353 Bacteria 20801
556 Ga0501082_0002098 3300060353 Archaea 17559
557 Ga0501082_0003869 3300060353 Archaea 13074
558 Ga0501082_0009920 3300060353 Archaea 8210
559 Ga0501082_0181188 3300060353 Archaea 1832
560 Ga0501082_0779497 3300060353 Archaea 836
561 Ga0530510_0000987 3300061734 Archaea 18845
562 Ga0530510_0008849 3300061734 Archaea 7046
563 Ga0530510_0011410 3300061734 Archaea 6233
564 Ga0530510_0065734 3300061734 Bacteria 2628
565 Ga0530510_0075732 3300061734 Archaea 2444
566 Ga0075435_100219510
567 JGI24740J21852_10040024
568 JGI24744J21845_10033251
569 JGI24033J26618_1004937
570 JGI24742J22300_10016112
571 Ga0006759J45824_1048715
572 Ga0007417J51691_1057006
573 Ga0032354_1047988
574 Ga0058861_10075552
575 Ga0058862_10181633
576 Ga0070683_100112402
577 Ga0070680_100086186
578 Ga0070682_100019892
579 Ga0070682_100069576
580 Ga0068868_100073940
581 Ga0068868_100755042
582 Ga0070692_10019074
583 Ga0070674_100684834
584 Ga0070673_100127742
585 Ga0070659_100089163
586 Ga0070659_100356077
587 Ga0070667_100000187
588 Ga0070667_100160267
589 Ga0070709_10002048
590 Ga0070709_10335597
591 Ga0070714_100008739
592 Ga0070714_100191748
593 Ga0070714_100362195
594 Ga0070713_100031805
595 Ga0070713_100253039
596 Ga0070701_10285115
597 Ga0070711_100000393
598 Ga0070711_100017002
599 Ga0070711_100018518
600 Ga0070711_100026720
601 Ga0070711_100032392
602 Ga0070711_100057131
603 Ga0070711_100563498
604 Ga0070705_100406237
605 Ga0070700_100093531
606 Ga0070700_100275352
607 Ga0070694_100000188
608 Ga0070694_100502589
609 Ga0070663_100055110
610 Ga0070678_100118694
611 Ga0070681_10006519
612 Ga0070707_100019829
613 Ga0070707_100302694
614 Ga0070707_100377460
615 Ga0070698_100002215
616 Ga0070699_100078821
617 Ga0070699_100279335
618 Ga0070699_100579302
619 Ga0070684_100029980
620 Ga0070684_100038804
621 Ga0070684_100225467
622 Ga0070684_100257133
623 Ga0070697_100113440
624 Ga0070697_100671046
625 Ga0070686_100119630
626 Ga0070695_100702976
627 Ga0070696_100012104
628 Ga0070696_100018931
629 Ga0070696_100226401
630 Ga0070696_100482764
631 Ga0070693_100022397
632 Ga0070693_100033528
633 Ga0070704_100000163
634 Ga0070704_100490662
635 Ga0068854_100120926
636 Ga0068856_100012028
637 Ga0068856_100109455
638 Ga0070702_100013171
639 Ga0068864_100142179
640 Ga0068864_100609498
641 Ga0081455_10012595
642 Ga0081455_10021678
643 Ga0081455_10302583
644 Ga0081455_10303331
645 Ga0081538_10002416
646 Ga0081538_10002449
647 Ga0081538_10027613
648 Ga0081538_10027748
649 Ga0070717_10038242
650 Ga0070715_10001193
651 Ga0070716_100001093
652 Ga0070716_100163668
653 Ga0070716_100495284
654 Ga0070712_100021451
655 Ga0075428_100002390
656 Ga0075428_100036339
657 Ga0075430_100000144
658 Ga0075430_100006543
659 Ga0075430_100017159
660 Ga0075430_100019051
661 Ga0075430_100167010
662 Ga0075431_100000889
663 Ga0075431_100014141
664 Ga0075431_100057189
665 Ga0075433_10077877
666 Ga0075433_10115753
667 Ga0075434_100002392
668 Ga0075434_100005309
669 Ga0075434_100052588
670 Ga0075429_100001388
671 Ga0075429_100016875
672 Ga0075429_100065015
673 Ga0075429_100266671
674 Ga0075436_100085123
675 Ga0075436_100196720
676 Ga0075435_100006342
677 Ga0075435_100027398
678 Ga0099794_10008806
679 Ga0099794_10092214
680 Ga0111539_10003551
681 Ga0111539_10021758
682 Ga0111539_10024710
683 Ga0111539_10232296
684 Ga0111539_10322778
685 Ga0114129_10003144
686 Ga0114129_10004729
687 Ga0114129_10033089
688 Ga0105241_10042036
689 Ga0105242_10360434
690 Ga0105242_10733752
691 Ga0105237_10126045
692 Ga0105237_10374958
693 Ga0105238_10596475
694 Ga0105239_10007179
695 Ga0105239_10026960
696 Ga0105246_10013885
697 Ga0105246_10177056
698 Ga0157341_1002845
699 Ga0157369_10034799
700 Ga0157374_11236337
701 Ga0157378_10079610
702 Ga0157378_10107341
703 Ga0157372_10040639
704 Ga0163163_10227228
705 Ga0157380_10129044
706 Ga0182008_10017210
707 Ga0157377_10002233
708 Ga0157377_10027476
709 Ga0157377_10054459
710 Ga0157377_10360378
711 Ga0157376_10076849
712 Ga0182006_1023035
713 Ga0182007_10010157
714 Ga0197907_10160485
715 Ga0206349_1281462
716 Ga0206351_10488721
717 Ga0206351_10755942
718 Ga0206352_10865422
719 Ga0206350_10426237
720 Ga0206350_11109503
721 Ga0206354_10608992
722 Ga0206353_11571214
723 Ga0224712_10018486
724 Ga0207692_10049651
725 Ga0207692_10117969
726 Ga0207688_10019921
727 Ga0207647_10048193
728 Ga0207685_10009548
729 Ga0207699_10002122
730 Ga0207699_10276798
731 Ga0207699_10293756
732 Ga0207684_10091625
733 Ga0207707_10005545
734 Ga0207693_10000742
735 Ga0207693_10064742
736 Ga0207663_10001213
737 Ga0207663_10009809
738 Ga0207663_10033198
739 Ga0207663_10044383
740 Ga0207663_10505731
741 Ga0207646_10129134
742 Ga0207694_10690827
743 Ga0207700_10013417
744 Ga0207664_10369591
745 Ga0207690_10121587
746 Ga0207669_10162029
747 Ga0207665_10000731
748 Ga0207665_10013079
749 Ga0207665_10161994
750 Ga0207665_10225723
751 Ga0207661_10050218
752 Ga0207661_10141587
753 Ga0207679_10336903
754 Ga0207658_10000088
755 Ga0207677_10077133
756 Ga0207677_10240530
757 Ga0207708_10126618
758 Ga0207708_10127849
759 Ga0207702_10063398
760 Ga0207702_11181620
761 Ga0207676_10393185
762 Ga0207683_10032909
763 Ga0207683_10212043
764 Ga0207683_10483573
765 Ga0209996_1024611
766 Ga0209982_1014801
767 Ga0207428_10000142
768 Ga0207428_10016046
769 Ga0207428_10205980
770 Ga0265326_10000049
771 Ga0265326_10000052
772 Ga0265334_10002344
773 Ga0265334_10039866
774 Ga0265323_10006445
775 Ga0265323_10017897
776 Ga0265322_10000101
777 Ga0265336_10000009
778 Ga0265336_10000056
779 Ga0265338_10000015
780 Ga0265338_10000020
781 Ga0265324_10000105
782 Ga0265324_10000197
783 Ga0265330_10000225
784 Ga0265330_10085321
785 Ga0265332_10007509
786 Ga0265332_10007802
787 Ga0265332_10023017
788 Ga0265328_10029015
789 Ga0265320_10122734
790 Ga0265325_10000409
791 Ga0265329_10008879
792 Ga0265340_10000050
793 Ga0265340_10000093
794 Ga0265339_10000072
795 Ga0265339_10002474
796 Ga0265331_10000062
797 Ga0265331_10000226
798 Ga0265316_10003273
799 Ga0265316_10033669
800 Ga0265316_10089968
801 Ga0307408_100010987
802 Ga0265314_10001075
803 Ga0265314_10074164
804 Ga0265342_10000411
805 Ga0265342_10052044
806 Ga0307405_10124821
807 Ga0307405_10147229
808 Ga0307413_10016986
809 Ga0307413_10375125
810 Ga0307413_10512420
811 Ga0307410_10128108
812 Ga0307406_10041948
813 Ga0307406_10887207
814 Ga0307407_10015237
815 Ga0307407_10059538
816 Ga0307412_10117333
817 Ga0307412_10323872
818 Ga0307412_10577733
819 Ga0307409_100012979
820 Ga0307409_100228508
821 Ga0307409_100714610
822 Ga0307416_100044357
823 Ga0307416_101240032
824 Ga0307416_101315755
825 Ga0307414_10238467
826 Ga0307411_10001387
827 Ga0307411_10047801
828 Ga0307411_10141836
829 Ga0307411_10184791
830 Ga0307415_100035771
831 Ga0307415_100040078
832 Ga0307415_100294362
833 Ga0373934_0016052
834 Ga0373944_0123366
835 Ga0373936_0080694
836 Ga0373953_0012787
837 Ga0373954_0001570
838 Ga0373956_0001243
839 Ga0373957_0095867
840 Ga0373960_0051697
841 Ga0373943_0207805
842 Ga0373955_0001053
843 Ga0373942_0035382
844 Ga0373924_0005606
845 Ga0373931_0264841
846 Ga0373935_0055187
847 Ga0373927_0129833
848 Ga0373933_0000099
849 Ga0373947_0107246
850 Ga0373937_0000283
851 Ga0373925_0479424
852 Ga0242419_000259
853 Ga0242422_01218
854 Ga0242420_000068
855 Ga0400489_73332
856 Ga0436362_0492850
857 Ga0439439_0033551
858 Ga0439461_0020427
859 Ga0450920_011323
860 Ga0450906_001973
861 Ga0451577_0111744
862 Ga0451577_0515565
863 Ga0453684_0000013
864 Ga0453684_0000016
865 Ga0453684_0000145
866 Ga0453684_0014592
867 Ga0453684_0017015
868 Ga0453684_0038282
869 Ga0453684_0250993
870 Ga0466960_0066226
871 Ga0466958_0446451
872 Ga0466967_0614588
873 Ga0495592_0204105
874 Ga0495651_0001178
875 Ga0495653_0036901
876 Ga0495652_0003635
877 Ga0495640_0115305
878 Ga0495587_0014490
879 Ga0495645_0311789
880 Ga0495635_0059295
881 Ga0495657_0042326
882 Ga0495599_0010471
883 Ga0495646_0059807
884 Ga0495600_0165910
885 Ga0495604_0087454
886 Ga0495674_0189684
887 Ga0495675_0060702
888 Ga0495684_0441040
889 Ga0495602_0002115
890 Ga0496100_0040036
891 Ga0496100_0054920
892 Ga0496101_0118801
893 Ga0496101_0256802
894 Ga0496102_0062886
895 Ga0496104_0050694
896 Ga0496104_0354459
897 Ga0496105_0106488
898 Ga0496106_0013323
899 Ga0496106_0018784
900 Ga0496106_0025031
901 Ga0496107_0055675
902 Ga0496107_0057359
903 Ga0496108_0117553
904 Ga0496109_0164200
905 Ga0496110_0099600
906 Ga0496111_0057234
907 Ga0496112_0164091
908 Ga0496112_0166154
909 Ga0496113_0464007
910 Ga0496115_0100612
911 Ga0501306_009632
912 Ga0501343_005551
913 Ga0501290_009045
914 Ga0501291_002059
915 Ga0501291_008133
916 Ga0501291_068826
917 Ga0501292_000653
918 Ga0501297_002011
919 Ga0501298_007648
920 Ga0501299_002695
921 Ga0501300_006512
922 Ga0501321_006416
923 Ga0501323_002169
924 Ga0501325_003870
925 Ga0501325_004876
926 Ga0501328_01255
927 Ga0501335_007899
928 Ga0501031_0003608
929 Ga0501031_0009778
930 Ga0501031_0050721
931 Ga0501031_0141182
932 Ga0501031_0154281
933 Ga0501031_0222155
934 Ga0501032_0003802
935 Ga0501032_0116888
936 Ga0501032_0445048
937 Ga0501033_0023763
938 Ga0501034_0004702
939 Ga0501036_0000445
940 Ga0501036_0005056
941 Ga0501036_0018384
942 Ga0501036_0082881
943 Ga0501036_0254262
944 Ga0501037_0006473
945 Ga0501037_0054693
946 Ga0501037_0135613
947 Ga0501037_0171699
948 Ga0501037_0186187
949 Ga0501038_0002480
950 Ga0501038_0269755
951 Ga0501038_0411207
952 Ga0501039_0000212
953 Ga0501039_0001730
954 Ga0501039_0026129
955 Ga0501039_0039514
956 Ga0501039_0139698
957 Ga0501039_0430444
958 Ga0501040_0000133
959 Ga0501040_0000480
960 Ga0501040_0012728
961 Ga0501040_0160644
962 Ga0501041_0000166
963 Ga0501041_0001799
964 Ga0501041_0070490
965 Ga0501041_0345845
966 Ga0501041_0391025
967 Ga0501042_0000913
968 Ga0501042_0010378
969 Ga0501042_0013261
970 Ga0501042_0016650
971 Ga0501042_0018403
972 Ga0501042_0019228
973 Ga0501042_0042658
974 Ga0501042_0277329
975 Ga0501043_0008596
976 Ga0501043_0044630
977 Ga0501046_0120223
978 Ga0501046_0223953
979 Ga0501047_0014604
980 Ga0501048_0000224
981 Ga0501048_0015526
982 Ga0501048_0024790
983 Ga0501048_0026370
984 Ga0501068_0162141
985 Ga0501070_0107794
986 Ga0501070_0630783
987 Ga0501071_0000106
988 Ga0501071_0009839
989 Ga0501071_0010809
990 Ga0501071_0031946
991 Ga0501071_0185239
992 Ga0501072_0000239
993 Ga0501072_0001821
994 Ga0501072_0022046
995 Ga0501072_0109708
996 Ga0501072_0268877
997 Ga0501072_0404137
998 Ga0501073_0031189
999 Ga0501074_0054247
1000 Ga0501074_0059843
1001 Ga0501074_0184676
1002 Ga0501075_0001017
1003 Ga0501075_0001884
1004 Ga0501075_0002162
1005 Ga0501075_0020034
1006 Ga0501075_0023173
1007 Ga0501076_0000515
1008 Ga0501076_0000585
1009 Ga0501076_0031254
1010 Ga0501077_0004631
1011 Ga0501077_0036341
1012 Ga0501077_0062275
1013 Ga0501077_0143110
1014 Ga0501077_0248126
1015 Ga0501202_006991
1016 Ga0501202_103738
1017 Ga0501206_021966
1018 Ga0501209_000354
1019 Ga0501209_050380
1020 Ga0501214_000755
1021 Ga0501214_027073
1022 Ga0501216_001973
1023 Ga0501217_006433
1024 Ga0501233_002375
1025 Ga0501233_033376
1026 Ga0501235_005380
1027 Ga0501252_020340
1028 Ga0501260_015685
1029 Ga0501261_011010
1030 Ga0501219_003173
1031 Ga0501221_025175
1032 Ga0501225_0011554
1033 Ga0501234_005876
1034 Ga0501234_027270
1035 Ga0501245_017874
1036 Ga0501079_0000307
1037 Ga0501079_0007035
1038 Ga0501079_0044095
1039 Ga0501079_0067797
1040 Ga0501079_0635606
1041 Ga0501079_0693039
1042 Ga0501080_0000679
1043 Ga0501080_0102404
1044 Ga0501080_0267026
1045 Ga0501081_0001507
1046 Ga0501081_0018381
1047 Ga0501081_0025005
1048 Ga0501081_0225605
1049 Ga0501081_1022026
1050 Ga0501083_0042816
1051 Ga0501265_020087
1052 Ga0501268_088675
1053 Ga0501276_001999
1054 Ga0501279_019637
1055 Ga0501283_018337
1056 Ga0501035_0001748
1057 Ga0501035_0040878
1058 Ga0501035_0056094
1059 Ga0501044_0001725
1060 Ga0501044_0205368
1061 Ga0501045_0000235
1062 Ga0501045_0003484
1063 Ga0501045_0010209
1064 Ga0501045_0057881
1065 Ga0501045_0083429
1066 Ga0501045_0097539
1067 Ga0501204_002074
1068 Ga0501212_034873
1069 nmdc:mga05p37_16076_c1
1070 nmdc:mga05p37_241301_c1
1071 nmdc:mga05p37_521_c1
1072 nmdc:mga05p37_58481_c1
1073 nmdc:mga05p37_6253_c1
1074 nmdc:mga09592_10607_c1
1075 nmdc:mga09592_108_c1
1076 nmdc:mga09592_16514_c1
1077 nmdc:mga0qj67_4639_c1
1078 nmdc:mga0qj67_5369_c1
1079 nmdc:mga0qj67_565_c1
1080 nmdc:mga06r32_17721_c2
1081 nmdc:mga06r32_4059_c1
1082 nmdc:mga06r32_4769_c1
1083 nmdc:mga08y16_10442_c1
1084 nmdc:mga08y16_416_c1
1085 nmdc:mga08y16_8723_c1
1086 nmdc:mga0n895_155447_c1
1087 nmdc:mga0n895_4320_c1
1088 nmdc:mga0n895_493952_c1
1089 nmdc:mga0rr50_215488_c1
1090 nmdc:mga0rr50_4441_c1
1091 nmdc:mga08x19_192149_c1
1092 nmdc:mga0a205_99649_c1
1093 Ga0495601_0092684
1094 Ga0495612_0018720
1095 Ga0495595_0038117
1096 Ga0495619_0000113
1097 Ga0501084_0000317
1098 Ga0501084_0003148
1099 Ga0501084_0008709
1100 Ga0501084_0063990
1101 Ga0501084_0077335
1102 Ga0501084_0117363
1103 Ga0590071_009656
1104 Ga0590071_020815
1105 Ga0590074_001143
1106 Ga0590075_001812
1107 Ga0590075_002488
1108 Ga0590077_009895
1109 Ga0590077_033304
1110 Ga0587093_003202
1111 Ga0587066_003206
1112 Ga0587070_003380
1113 Ga0587073_0020974
1114 Ga0587083_0011856
1115 Ga0587088_024800
1116 Ga0587089_013153
1117 Ga0587109_005296
1118 Ga0587067_009253
1119 Ga0587076_039776
1120 Ga0501082_0001455
1121 Ga0501082_0002098
1122 Ga0501082_0003869
1123 Ga0501082_0009920
1124 Ga0501082_0181188
1125 Ga0501082_0779497
1126 Ga0530510_0000987
1127 Ga0530510_0008849
1128 Ga0530510_0011410
1129 Ga0530510_0065734
1130 Ga0530510_0075732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

19

233

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hg3-assembly1.cif.gz_A crystal structure of tetrameric tim from pyrococcus woesei. 0.9654 16 235
1w0m-assembly2.cif.gz_G triosephosphate isomerase from thermoproteus tenax 0.963 16 234
2h6r-assembly2.cif.gz_G crystal structure of triosephosphate isomerase (tim) from methanocaldococcus jannaschii 0.9594 19 231
2h6r-assembly1.cif.gz_D crystal structure of triosephosphate isomerase (tim) from methanocaldococcus jannaschii 0.9589 19 231
2h6r-assembly1.cif.gz_C crystal structure of triosephosphate isomerase (tim) from methanocaldococcus jannaschii 0.9572 19 231
ID Description Score Start End Superfamily
1w0mA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9624 16 234 3.20.20.70
2h6rC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9572 19 231 3.20.20.70
5cssA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9467 18 232 3.20.20.70
2h6rC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.939 19 231 3.20.20.70
5cssA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9339 18 232 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7J4DSC4-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9846 19 234 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A5B2Z4A3-F1-model_v4 Triose-phosphate isomerase (EC 5.3.1.1) 0.983 17 235 GO:0004807
GO:0005737
GO:0006094
GO:0006096
AF-A0A3N5UW36-F1-model_v4 Triose-phosphate isomerase (EC 5.3.1.1) 0.9815 111 233 GO:0004807
AF-A0A2D6V4P8-F1-model_v4 deleted 0.9773 19 234
AF-A0A3M0XGK3-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9768 20 235 GO:0004807
GO:0005737
GO:0006094
GO:0006096

Map