F464147
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 564 | 363 | 519 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100159759|Ga0068857_1001597592 |
| Length | 330 |
| Sequence | MRPSLPGLDPRAAMTTSTRKRSIPRQRQPELERDIARSPSLGYEAPETGLVRCLAHGFPSPLVRWHFHEDYELHLITETSGKAFIGDWIGPFQPGHLVLCGPRLPHNWISLDVPEGGAAGRDRVIQFRHEPIEHAAAEIPELREVMQLLERARHGIEFFGMSQQAQTHWDAIKAARGVRRLGRFLECMADLAQCTDYRLLSSVQMQGAQGIEGDAQVDQINDIVNRITSNMAESISMSDVAAELGMSESRFSRFFRRSTGNSFTDFVNRVRINSACHLLMQTDHYVTDICYQVGFNNVANFNRRFLEIKGMTPSEFRKQADTRFGGGISS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 10 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 11 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 12 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 13 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 14 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 15 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 16 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 17 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 18 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 19 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 20 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 21 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 22 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 23 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 24 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 25 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 26 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 27 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 28 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 29 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 30 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 31 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 32 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 33 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 34 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 35 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 36 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 37 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 38 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 40 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 41 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 42 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 43 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 44 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 45 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 46 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 47 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 48 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 49 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 50 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 53 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 217 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 245 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 246 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 247 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 248 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 252 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 255 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 327 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 338 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 341 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 345 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 350 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 362 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 363 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.2 |
| Metatranscriptomes | 0 |
| Isolates | 7.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.96 |
| Nodule | 1.24 |
| Rhizoplane | 3.37 |
| Rhizosphere | 53.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014995 | 3300001979 | Bacteria | 2842 |
| 2 | JGI24739J22299_10013835 | 3300001989 | Bacteria | 2940 |
| 3 | JGI24739J22299_10043806 | 3300001989 | Bacteria | 1477 |
| 4 | JGI25154J39366_1001254 | 3300002738 | Bacteria | 9533 |
| 5 | JGI25157J39369_1000199 | 3300002741 | Bacteria | 50810 |
| 6 | JGI25150J39212_1001865 | 3300002774 | Bacteria | 5556 |
| 7 | JGI25159J45721_1006802 | 3300002987 | Bacteria | 3364 |
| 8 | JGI25159J45721_1010765 | 3300002987 | Bacteria | 2301 |
| 9 | JGI25159J45721_1011127 | 3300002987 | Bacteria | 2230 |
| 10 | JGI25151J46595_10002493 | 3300003187 | Bacteria | 10995 |
| 11 | rootL2_10062417 | 3300003322 | Bacteria | 1555 |
| 12 | Ga0055535_1000286 | 3300003761 | Bacteria | 53400 |
| 13 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 14 | Ga0055526_1006456 | 3300003771 | Bacteria | 6359 |
| 15 | Ga0055526_1018554 | 3300003771 | Bacteria | 2590 |
| 16 | Ga0055526_1020918 | 3300003771 | Bacteria | 2301 |
| 17 | Ga0055537_1001147 | 3300003773 | Bacteria | 11333 |
| 18 | Ga0055537_1017345 | 3300003773 | Bacteria | 1187 |
| 19 | Ga0055536_1007310 | 3300003781 | Bacteria | 4967 |
| 20 | Ga0055534_1001199 | 3300003784 | Bacteria | 10910 |
| 21 | Ga0055534_1004097 | 3300003784 | Bacteria | 4345 |
| 22 | Ga0055534_1008457 | 3300003784 | Bacteria | 2329 |
| 23 | Ga0055528_1036084 | 3300003790 | Bacteria | 1187 |
| 24 | Ga0055530_10003765 | 3300003791 | Bacteria | 8370 |
| 25 | Ga0055540_1003315 | 3300003792 | Bacteria | 7848 |
| 26 | Ga0055540_1032905 | 3300003792 | Bacteria | 1179 |
| 27 | Ga0055531_10004533 | 3300003794 | Bacteria | 8426 |
| 28 | Ga0055543_1001804 | 3300004625 | Bacteria | 7901 |
| 29 | Ga0055543_1003991 | 3300004625 | Bacteria | 4148 |
| 30 | Ga0065165_1001023 | 3300005262 | Bacteria | 33959 |
| 31 | Ga0065165_1013931 | 3300005262 | Bacteria | 3154 |
| 32 | Ga0065165_1023367 | 3300005262 | Bacteria | 2098 |
| 33 | Ga0065707_10087081 | 3300005295 | Bacteria | 5175 |
| 34 | Ga0070676_10296232 | 3300005328 | Bacteria | 1095 |
| 35 | Ga0070683_100202003 | 3300005329 | Bacteria | 1887 |
| 36 | Ga0070683_100311895 | 3300005329 | Bacteria | 1497 |
| 37 | Ga0070690_100024000 | 3300005330 | Bacteria | 3747 |
| 38 | Ga0068869_100297623 | 3300005334 | Bacteria | 1302 |
| 39 | Ga0068868_100322084 | 3300005338 | Bacteria | 1317 |
| 40 | Ga0070660_100025146 | 3300005339 | Bacteria | 4424 |
| 41 | Ga0070661_100129704 | 3300005344 | Bacteria | 1893 |
| 42 | Ga0070675_100133034 | 3300005354 | Bacteria | 2121 |
| 43 | Ga0070674_100122233 | 3300005356 | Bacteria | 1929 |
| 44 | Ga0070674_100264122 | 3300005356 | Bacteria | 1357 |
| 45 | Ga0070673_100093450 | 3300005364 | Bacteria | 2463 |
| 46 | Ga0070659_100076497 | 3300005366 | Bacteria | 2669 |
| 47 | Ga0070667_100036966 | 3300005367 | Bacteria | 4094 |
| 48 | Ga0070667_100141980 | 3300005367 | Bacteria | 2104 |
| 49 | Ga0070678_100025246 | 3300005456 | Bacteria | 3994 |
| 50 | Ga0070662_100010608 | 3300005457 | Bacteria | 6057 |
| 51 | Ga0070662_100112514 | 3300005457 | Bacteria | 2076 |
| 52 | Ga0068867_100004283 | 3300005459 | Bacteria | 10043 |
| 53 | Ga0070685_10115033 | 3300005466 | Bacteria | 1663 |
| 54 | Ga0070706_100000388 | 3300005467 | Bacteria | 52771 |
| 55 | Ga0070707_100071369 | 3300005468 | Bacteria | 3346 |
| 56 | Ga0070698_100421808 | 3300005471 | Bacteria | 1269 |
| 57 | Ga0070684_100404125 | 3300005535 | Bacteria | 1259 |
| 58 | Ga0070665_100016667 | 3300005548 | Bacteria | 7363 |
| 59 | Ga0070665_100155233 | 3300005548 | Bacteria | 2291 |
| 60 | Ga0068855_100019384 | 3300005563 | Bacteria | 8173 |
| 61 | Ga0068855_100391845 | 3300005563 | Bacteria | 1523 |
| 62 | Ga0070664_100003941 | 3300005564 | Bacteria | 11968 |
| 63 | Ga0070664_100047752 | 3300005564 | Bacteria | 3617 |
| 64 | Ga0070664_100443559 | 3300005564 | Bacteria | 1191 |
| 65 | Ga0068857_100000643 | 3300005577 | Bacteria | 25778 |
| 66 | Ga0068857_100159759 | 3300005577 | Bacteria | 2044 |
| 67 | Ga0068854_100018408 | 3300005578 | Bacteria | 4688 |
| 68 | Ga0068856_100011642 | 3300005614 | Bacteria | 8532 |
| 69 | Ga0068852_100026629 | 3300005616 | Bacteria | 4704 |
| 70 | Ga0068852_100031429 | 3300005616 | Bacteria | 4381 |
| 71 | Ga0068859_100039119 | 3300005617 | Bacteria | 4757 |
| 72 | Ga0068859_100264579 | 3300005617 | Bacteria | 1811 |
| 73 | Ga0068859_100796317 | 3300005617 | Bacteria | 1033 |
| 74 | Ga0068866_10039101 | 3300005718 | Bacteria | 2341 |
| 75 | Ga0068861_100003803 | 3300005719 | Bacteria | 10080 |
| 76 | Ga0068861_100020935 | 3300005719 | Bacteria | 4694 |
| 77 | Ga0068851_10008974 | 3300005834 | Bacteria | 4638 |
| 78 | Ga0068870_10208328 | 3300005840 | Bacteria | 1189 |
| 79 | Ga0068863_100329760 | 3300005841 | Bacteria | 1484 |
| 80 | Ga0068863_100368200 | 3300005841 | Bacteria | 1402 |
| 81 | Ga0068860_100019424 | 3300005843 | Bacteria | 6590 |
| 82 | Ga0068860_100201055 | 3300005843 | Bacteria | 1931 |
| 83 | Ga0068860_100625975 | 3300005843 | Bacteria | 1083 |
| 84 | Ga0068862_100027196 | 3300005844 | Bacteria | 4814 |
| 85 | Ga0068862_100050422 | 3300005844 | Bacteria | 3557 |
| 86 | Ga0068862_100061092 | 3300005844 | Bacteria | 3239 |
| 87 | Ga0075365_10014301 | 3300006038 | Bacteria | 4772 |
| 88 | Ga0075368_10074386 | 3300006042 | Bacteria | 1376 |
| 89 | Ga0075368_10086232 | 3300006042 | Bacteria | 1281 |
| 90 | Ga0075363_100015241 | 3300006048 | Bacteria | 3775 |
| 91 | Ga0075363_100021061 | 3300006048 | Bacteria | 3278 |
| 92 | Ga0075364_10034294 | 3300006051 | Bacteria | 3273 |
| 93 | Ga0075362_10024734 | 3300006177 | Bacteria | 2550 |
| 94 | Ga0075362_10029390 | 3300006177 | Bacteria | 2368 |
| 95 | Ga0075362_10035780 | 3300006177 | Bacteria | 2169 |
| 96 | Ga0075367_10018219 | 3300006178 | Bacteria | 3870 |
| 97 | Ga0075367_10045095 | 3300006178 | Bacteria | 2587 |
| 98 | Ga0075367_10059629 | 3300006178 | Bacteria | 2273 |
| 99 | Ga0075366_10002902 | 3300006195 | Bacteria | 8904 |
| 100 | Ga0075366_10004500 | 3300006195 | Bacteria | 7478 |
| 101 | Ga0075366_10005751 | 3300006195 | Bacteria | 6732 |
| 102 | Ga0075366_10013970 | 3300006195 | Bacteria | 4580 |
| 103 | Ga0075366_10020940 | 3300006195 | Bacteria | 3799 |
| 104 | Ga0075366_10025007 | 3300006195 | Bacteria | 3485 |
| 105 | Ga0075366_10026682 | 3300006195 | Bacteria | 3384 |
| 106 | Ga0075370_10000635 | 3300006353 | Bacteria | 13598 |
| 107 | Ga0075370_10003110 | 3300006353 | Bacteria | 7834 |
| 108 | Ga0075370_10004190 | 3300006353 | Bacteria | 6962 |
| 109 | Ga0075370_10023580 | 3300006353 | Bacteria | 3390 |
| 110 | Ga0075370_10030426 | 3300006353 | Bacteria | 3012 |
| 111 | Ga0075370_10036768 | 3300006353 | Bacteria | 2751 |
| 112 | Ga0075370_10049246 | 3300006353 | Bacteria | 2388 |
| 113 | Ga0075370_10100417 | 3300006353 | Bacteria | 1674 |
| 114 | Ga0075370_10190108 | 3300006353 | Bacteria | 1210 |
| 115 | Ga0068865_100012454 | 3300006881 | Bacteria | 5353 |
| 116 | Ga0068865_100134829 | 3300006881 | Bacteria | 1854 |
| 117 | Ga0097620_100039122 | 3300006931 | Bacteria | 4757 |
| 118 | Ga0097620_100264589 | 3300006931 | Bacteria | 1811 |
| 119 | Ga0097620_100796298 | 3300006931 | Bacteria | 1033 |
| 120 | Ga0079104_1000016 | 3300006946 | Bacteria | 313865 |
| 121 | Ga0079104_1013872 | 3300006946 | Bacteria | 2462 |
| 122 | Ga0099826_10000498 | 3300006948 | Bacteria | 19180 |
| 123 | Ga0105244_10013907 | 3300009036 | Bacteria | 4675 |
| 124 | Ga0105250_10001094 | 3300009092 | Bacteria | 15299 |
| 125 | Ga0105240_10076158 | 3300009093 | Bacteria | 4137 |
| 126 | Ga0105240_10308219 | 3300009093 | Bacteria | 1809 |
| 127 | Ga0105245_10098769 | 3300009098 | Bacteria | 2698 |
| 128 | Ga0105245_10136482 | 3300009098 | Bacteria | 2306 |
| 129 | Ga0105245_10227316 | 3300009098 | Bacteria | 1803 |
| 130 | Ga0105245_10592584 | 3300009098 | Bacteria | 1134 |
| 131 | Ga0114129_10025979 | 3300009147 | Bacteria | 8293 |
| 132 | Ga0105243_10005637 | 3300009148 | Bacteria | 9747 |
| 133 | Ga0105243_10007314 | 3300009148 | Bacteria | 8491 |
| 134 | Ga0105243_10097271 | 3300009148 | Bacteria | 2436 |
| 135 | Ga0105243_10128360 | 3300009148 | Bacteria | 2148 |
| 136 | Ga0105242_10047066 | 3300009176 | Bacteria | 3501 |
| 137 | Ga0105242_10235149 | 3300009176 | Bacteria | 1644 |
| 138 | Ga0105237_10037619 | 3300009545 | Bacteria | 4889 |
| 139 | Ga0105237_10048563 | 3300009545 | Bacteria | 4266 |
| 140 | Ga0105237_10313130 | 3300009545 | Bacteria | 1573 |
| 141 | Ga0105238_10120658 | 3300009551 | Bacteria | 2601 |
| 142 | Ga0105249_10337813 | 3300009553 | Bacteria | 1522 |
| 143 | Ga0105239_10013427 | 3300010375 | Bacteria | 9100 |
| 144 | Ga0105239_10171788 | 3300010375 | Bacteria | 2424 |
| 145 | Ga0105239_10176307 | 3300010375 | Bacteria | 2391 |
| 146 | Ga0157373_10099715 | 3300013100 | Bacteria | 2044 |
| 147 | Ga0157371_10029559 | 3300013102 | Bacteria | 3961 |
| 148 | Ga0157370_10029709 | 3300013104 | Bacteria | 5360 |
| 149 | Ga0157370_10304179 | 3300013104 | Bacteria | 1472 |
| 150 | Ga0157369_10080034 | 3300013105 | Bacteria | 3499 |
| 151 | Ga0157369_10102395 | 3300013105 | Bacteria | 3052 |
| 152 | Ga0157378_10015862 | 3300013297 | Bacteria | 6597 |
| 153 | Ga0157378_10146509 | 3300013297 | Bacteria | 2197 |
| 154 | Ga0163162_10721334 | 3300013306 | Bacteria | 1118 |
| 155 | Ga0157372_10172260 | 3300013307 | Bacteria | 2504 |
| 156 | Ga0157372_10230769 | 3300013307 | Bacteria | 2146 |
| 157 | Ga0157375_10014275 | 3300013308 | Bacteria | 7081 |
| 158 | Ga0157375_10126005 | 3300013308 | Bacteria | 2676 |
| 159 | Ga0157375_10382629 | 3300013308 | Bacteria | 1574 |
| 160 | Ga0157375_10524596 | 3300013308 | Bacteria | 1347 |
| 161 | Ga0182008_10001323 | 3300014497 | Bacteria | 16876 |
| 162 | Ga0182008_10001893 | 3300014497 | Bacteria | 13569 |
| 163 | Ga0182008_10039147 | 3300014497 | Bacteria | 2370 |
| 164 | Ga0182008_10083166 | 3300014497 | Bacteria | 1576 |
| 165 | Ga0157379_10199818 | 3300014968 | Bacteria | 1808 |
| 166 | Ga0182006_1012165 | 3300015261 | Bacteria | 3769 |
| 167 | Ga0182007_10008063 | 3300015262 | Bacteria | 4351 |
| 168 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 169 | Ga0163161_10005510 | 3300017792 | Bacteria | 8773 |
| 170 | Ga0163161_10045327 | 3300017792 | Bacteria | 3171 |
| 171 | Ga0163161_10046136 | 3300017792 | Bacteria | 3143 |
| 172 | Ga0213872_10085291 | 3300021361 | Bacteria | 1416 |
| 173 | Ga0213876_10178945 | 3300021384 | Bacteria | 1128 |
| 174 | Ga0209436_114702 | 3300025208 | Bacteria | 1237 |
| 175 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 176 | Ga0209672_101674 | 3300025228 | Bacteria | 7189 |
| 177 | Ga0209147_100450 | 3300025229 | Bacteria | 25862 |
| 178 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 179 | Ga0207427_100844 | 3300025231 | Bacteria | 13690 |
| 180 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 181 | Ga0209258_100453 | 3300025242 | Bacteria | 45277 |
| 182 | Ga0209258_100808 | 3300025242 | Bacteria | 18236 |
| 183 | Ga0207425_1000715 | 3300025245 | Bacteria | 17861 |
| 184 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 185 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 186 | Ga0209677_100954 | 3300025253 | Bacteria | 14070 |
| 187 | Ga0209677_102445 | 3300025253 | Bacteria | 6985 |
| 188 | Ga0209677_104629 | 3300025253 | Bacteria | 3886 |
| 189 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 190 | Ga0209148_1007934 | 3300025254 | Bacteria | 2166 |
| 191 | Ga0209759_1000272 | 3300025256 | Bacteria | 73495 |
| 192 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 193 | Ga0209129_1005353 | 3300025258 | Bacteria | 4578 |
| 194 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 195 | Ga0209565_1000583 | 3300025263 | Bacteria | 24687 |
| 196 | Ga0209565_1001746 | 3300025263 | Bacteria | 8869 |
| 197 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 198 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 199 | Ga0209673_1002614 | 3300025273 | Bacteria | 12098 |
| 200 | Ga0209673_1002934 | 3300025273 | Bacteria | 10732 |
| 201 | Ga0209673_1020420 | 3300025273 | Bacteria | 2346 |
| 202 | Ga0209130_1000757 | 3300025284 | Bacteria | 28010 |
| 203 | Ga0209130_1002913 | 3300025284 | Bacteria | 7846 |
| 204 | Ga0209130_1007852 | 3300025284 | Bacteria | 3231 |
| 205 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 206 | Ga0209675_1006671 | 3300025291 | Bacteria | 4582 |
| 207 | Ga0209675_1008554 | 3300025291 | Bacteria | 3741 |
| 208 | Ga0209675_1008940 | 3300025291 | Bacteria | 3601 |
| 209 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 210 | Ga0209676_1000317 | 3300025292 | Bacteria | 94105 |
| 211 | Ga0209676_1000367 | 3300025292 | Bacteria | 84271 |
| 212 | Ga0209676_1003347 | 3300025292 | Bacteria | 9998 |
| 213 | Ga0209676_1020966 | 3300025292 | Bacteria | 2204 |
| 214 | Ga0209025_1000194 | 3300025294 | Bacteria | 148593 |
| 215 | Ga0209025_1001452 | 3300025294 | Bacteria | 31103 |
| 216 | Ga0209025_1001526 | 3300025294 | Bacteria | 29626 |
| 217 | Ga0209025_1010030 | 3300025294 | Bacteria | 6486 |
| 218 | Ga0209025_1015699 | 3300025294 | Bacteria | 4540 |
| 219 | Ga0209025_1019317 | 3300025294 | Bacteria | 3794 |
| 220 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 221 | Ga0209564_1000344 | 3300025295 | Bacteria | 88136 |
| 222 | Ga0209564_1001028 | 3300025295 | Bacteria | 34353 |
| 223 | Ga0209758_1000510 | 3300025297 | Bacteria | 62591 |
| 224 | Ga0209758_1012342 | 3300025297 | Bacteria | 4793 |
| 225 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 226 | Ga0209050_1000786 | 3300025298 | Bacteria | 45131 |
| 227 | Ga0209050_1006264 | 3300025298 | Bacteria | 7124 |
| 228 | Ga0209256_1000151 | 3300025299 | Bacteria | 145299 |
| 229 | Ga0209256_1000256 | 3300025299 | Bacteria | 94699 |
| 230 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 231 | Ga0207426_1000315 | 3300025302 | Bacteria | 94699 |
| 232 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 233 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 234 | Ga0209051_1000894 | 3300025303 | Bacteria | 29840 |
| 235 | Ga0209051_1001079 | 3300025303 | Bacteria | 25303 |
| 236 | Ga0209051_1001096 | 3300025303 | Bacteria | 24968 |
| 237 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 238 | Ga0209257_1004421 | 3300025304 | Bacteria | 10909 |
| 239 | Ga0209257_1004591 | 3300025304 | Bacteria | 10527 |
| 240 | Ga0209257_1011962 | 3300025304 | Bacteria | 4087 |
| 241 | Ga0207656_10001300 | 3300025321 | Bacteria | 8211 |
| 242 | Ga0207696_1016135 | 3300025711 | Bacteria | 2507 |
| 243 | Ga0207655_1003837 | 3300025728 | Bacteria | 10952 |
| 244 | Ga0207645_10238765 | 3300025907 | Bacteria | 1200 |
| 245 | Ga0207643_10181400 | 3300025908 | Bacteria | 1274 |
| 246 | Ga0207705_10144464 | 3300025909 | Bacteria | 1779 |
| 247 | Ga0207684_10006285 | 3300025910 | Bacteria | 10836 |
| 248 | Ga0207654_10100393 | 3300025911 | Bacteria | 1782 |
| 249 | Ga0207695_10073418 | 3300025913 | Bacteria | 3486 |
| 250 | Ga0207695_10085364 | 3300025913 | Bacteria | 3186 |
| 251 | Ga0207695_10238069 | 3300025913 | Bacteria | 1722 |
| 252 | Ga0207671_10030763 | 3300025914 | Bacteria | 4001 |
| 253 | Ga0207671_10102589 | 3300025914 | Bacteria | 2168 |
| 254 | Ga0207649_10199262 | 3300025920 | Bacteria | 1413 |
| 255 | Ga0207646_10044087 | 3300025922 | Bacteria | 4004 |
| 256 | Ga0207687_10058118 | 3300025927 | Bacteria | 2720 |
| 257 | Ga0207687_10144215 | 3300025927 | Bacteria | 1810 |
| 258 | Ga0207687_10386795 | 3300025927 | Bacteria | 1147 |
| 259 | Ga0207644_10137219 | 3300025931 | Bacteria | 1880 |
| 260 | Ga0207690_10016847 | 3300025932 | Bacteria | 4453 |
| 261 | Ga0207706_10006170 | 3300025933 | Bacteria | 11129 |
| 262 | Ga0207686_10047616 | 3300025934 | Bacteria | 2651 |
| 263 | Ga0207686_10118135 | 3300025934 | Bacteria | 1800 |
| 264 | Ga0207709_10000117 | 3300025935 | Bacteria | 122667 |
| 265 | Ga0207709_10000587 | 3300025935 | Bacteria | 30442 |
| 266 | Ga0207709_10019655 | 3300025935 | Bacteria | 3801 |
| 267 | Ga0207669_10101506 | 3300025937 | Bacteria | 1903 |
| 268 | Ga0207669_10296435 | 3300025937 | Bacteria | 1227 |
| 269 | Ga0207704_10032479 | 3300025938 | Bacteria | 2955 |
| 270 | Ga0207691_10051737 | 3300025940 | Bacteria | 3754 |
| 271 | Ga0207711_10264924 | 3300025941 | Bacteria | 1580 |
| 272 | Ga0207689_10051455 | 3300025942 | Bacteria | 3396 |
| 273 | Ga0207689_10094734 | 3300025942 | Bacteria | 2452 |
| 274 | Ga0207689_10183674 | 3300025942 | Bacteria | 1725 |
| 275 | Ga0207689_10325431 | 3300025942 | Bacteria | 1276 |
| 276 | Ga0207661_10175879 | 3300025944 | Bacteria | 1866 |
| 277 | Ga0207679_10154489 | 3300025945 | Bacteria | 1872 |
| 278 | Ga0207679_10267782 | 3300025945 | Bacteria | 1460 |
| 279 | Ga0207667_10104617 | 3300025949 | Bacteria | 2920 |
| 280 | Ga0207667_10163905 | 3300025949 | Bacteria | 2286 |
| 281 | Ga0207667_10527990 | 3300025949 | Bacteria | 1195 |
| 282 | Ga0207651_10095847 | 3300025960 | Bacteria | 2186 |
| 283 | Ga0207712_10466021 | 3300025961 | Bacteria | 1074 |
| 284 | Ga0207658_10049045 | 3300025986 | Bacteria | 3100 |
| 285 | Ga0207658_10214692 | 3300025986 | Bacteria | 1615 |
| 286 | Ga0207677_10052699 | 3300026023 | Bacteria | 2765 |
| 287 | Ga0207677_10203707 | 3300026023 | Bacteria | 1575 |
| 288 | Ga0207677_10353751 | 3300026023 | Bacteria | 1232 |
| 289 | Ga0207703_10450961 | 3300026035 | Bacteria | 1201 |
| 290 | Ga0207639_10028052 | 3300026041 | Bacteria | 4106 |
| 291 | Ga0207639_10073052 | 3300026041 | Bacteria | 2688 |
| 292 | Ga0207678_10020544 | 3300026067 | Bacteria | 5789 |
| 293 | Ga0207678_10225758 | 3300026067 | Bacteria | 1603 |
| 294 | Ga0207702_10003218 | 3300026078 | Bacteria | 15082 |
| 295 | Ga0207648_10008269 | 3300026089 | Bacteria | 10104 |
| 296 | Ga0207648_10028772 | 3300026089 | Bacteria | 4926 |
| 297 | Ga0207648_10119908 | 3300026089 | Bacteria | 2313 |
| 298 | Ga0207674_10001652 | 3300026116 | Bacteria | 28693 |
| 299 | Ga0207674_10113483 | 3300026116 | Bacteria | 2683 |
| 300 | Ga0207675_100009803 | 3300026118 | Bacteria | 8966 |
| 301 | Ga0207675_100080204 | 3300026118 | Bacteria | 3060 |
| 302 | Ga0207683_10050234 | 3300026121 | Bacteria | 3652 |
| 303 | Ga0207683_10088143 | 3300026121 | Bacteria | 2761 |
| 304 | Ga0207698_10035164 | 3300026142 | Bacteria | 3662 |
| 305 | Ga0207698_10565782 | 3300026142 | Bacteria | 1116 |
| 306 | Ga0209281_1000017 | 3300027111 | Bacteria | 583251 |
| 307 | Ga0209970_1000287 | 3300027614 | Bacteria | 8341 |
| 308 | Ga0209282_1020331 | 3300027666 | Bacteria | 4206 |
| 309 | Ga0268266_10062898 | 3300028379 | Bacteria | 3204 |
| 310 | Ga0268265_10026776 | 3300028380 | Bacteria | 4105 |
| 311 | Ga0268264_10372947 | 3300028381 | Bacteria | 1364 |
| 312 | Ga0268264_10388760 | 3300028381 | Bacteria | 1338 |
| 313 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 314 | Ga0307515_10000137 | 3300028794 | Bacteria | 173516 |
| 315 | Ga0307515_10000221 | 3300028794 | Bacteria | 141099 |
| 316 | Ga0307515_10000777 | 3300028794 | Bacteria | 73454 |
| 317 | Ga0307515_10070037 | 3300028794 | Bacteria | 4781 |
| 318 | Ga0307515_10108747 | 3300028794 | Bacteria | 3263 |
| 319 | Ga0265324_10001932 | 3300029957 | Bacteria | 11118 |
| 320 | Ga0316176_1070259 | 3300030732 | Bacteria | 1599 |
| 321 | Ga0314311_1074579 | 3300030733 | Bacteria | 5783 |
| 322 | Ga0265327_10000640 | 3300031251 | Bacteria | 56812 |
| 323 | Ga0265327_10008506 | 3300031251 | Bacteria | 7629 |
| 324 | Ga0307513_10000029 | 3300031456 | Bacteria | 191823 |
| 325 | Ga0307513_10001667 | 3300031456 | Bacteria | 31752 |
| 326 | Ga0307513_10071296 | 3300031456 | Bacteria | 3627 |
| 327 | Ga0307513_10074508 | 3300031456 | Bacteria | 3529 |
| 328 | Ga0307509_10169074 | 3300031507 | Bacteria | 2069 |
| 329 | Ga0307408_100000246 | 3300031548 | Bacteria | 56179 |
| 330 | Ga0307408_100009802 | 3300031548 | Bacteria | 6314 |
| 331 | Ga0307508_10000141 | 3300031616 | Bacteria | 85739 |
| 332 | Ga0307508_10238600 | 3300031616 | Bacteria | 1416 |
| 333 | Ga0307514_10035594 | 3300031649 | Bacteria | 3962 |
| 334 | Ga0307514_10200284 | 3300031649 | Bacteria | 1256 |
| 335 | Ga0307516_10000155 | 3300031730 | Bacteria | 85605 |
| 336 | Ga0307516_10001176 | 3300031730 | Bacteria | 36553 |
| 337 | Ga0307516_10001709 | 3300031730 | Bacteria | 30164 |
| 338 | Ga0307516_10004703 | 3300031730 | Bacteria | 16697 |
| 339 | Ga0307405_10009141 | 3300031731 | Bacteria | 5069 |
| 340 | Ga0307405_10112474 | 3300031731 | Bacteria | 1847 |
| 341 | Ga0307405_10128723 | 3300031731 | Bacteria | 1745 |
| 342 | Ga0307406_10001082 | 3300031901 | Bacteria | 15165 |
| 343 | Ga0307406_10006015 | 3300031901 | Bacteria | 6662 |
| 344 | Ga0307412_10107672 | 3300031911 | Bacteria | 1984 |
| 345 | Ga0307412_10131167 | 3300031911 | Bacteria | 1820 |
| 346 | Ga0307412_10155167 | 3300031911 | Bacteria | 1694 |
| 347 | Ga0307412_10383535 | 3300031911 | Bacteria | 1139 |
| 348 | Ga0307416_100008180 | 3300032002 | Bacteria | 6723 |
| 349 | Ga0307416_100088462 | 3300032002 | Bacteria | 2648 |
| 350 | Ga0307416_100376310 | 3300032002 | Bacteria | 1448 |
| 351 | Ga0307507_10094543 | 3300033179 | Bacteria | 2540 |
| 352 | Ga0373944_0045699 | 3300035089 | Bacteria | 1367 |
| 353 | Ga0373931_0008810 | 3300035691 | Bacteria | 4800 |
| 354 | Ga0373937_0044882 | 3300036401 | Bacteria | 4038 |
| 355 | Ga0373925_0012106 | 3300037068 | Bacteria | 6244 |
| 356 | Ga0395898_0140581 | 3300037466 | Bacteria | 2311 |
| 357 | Ga0395905_0004450 | 3300037471 | Bacteria | 14564 |
| 358 | Ga0395901_0010895 | 3300038443 | Bacteria | 9215 |
| 359 | Ga0436365_0179555 | 3300039437 | Bacteria | 1326 |
| 360 | Ga0436361_0064311 | 3300039447 | Bacteria | 6486 |
| 361 | Ga0436361_0276783 | 3300039447 | Bacteria | 2279 |
| 362 | Ga0436361_0691237 | 3300039447 | Bacteria | 8011 |
| 363 | Ga0436361_1092231 | 3300039447 | Bacteria | 4132 |
| 364 | Ga0439439_0001487 | 3300041406 | Bacteria | 4686 |
| 365 | Ga0439439_0017146 | 3300041406 | Bacteria | 1778 |
| 366 | Ga0451793_1648312 | 3300041452 | Bacteria | 2658 |
| 367 | Ga0451802_2098710 | 3300041460 | Bacteria | 1597 |
| 368 | Ga0451807_0108644 | 3300041486 | Bacteria | 1601 |
| 369 | Ga0451853_3940933 | 3300041512 | Bacteria | 1038 |
| 370 | Ga0439431_0016587 | 3300041997 | Bacteria | 1725 |
| 371 | Ga0439431_0043738 | 3300041997 | Bacteria | 1147 |
| 372 | Ga0439433_0004117 | 3300041999 | Bacteria | 3127 |
| 373 | Ga0439442_001303 | 3300042002 | Bacteria | 4959 |
| 374 | Ga0439445_0003027 | 3300042004 | Bacteria | 3764 |
| 375 | Ga0439432_028680 | 3300042006 | Bacteria | 1812 |
| 376 | Ga0439449_0000254 | 3300042007 | Bacteria | 19110 |
| 377 | Ga0439449_0006594 | 3300042007 | Bacteria | 4438 |
| 378 | Ga0439462_0022952 | 3300042015 | Bacteria | 1634 |
| 379 | Ga0450920_026994 | 3300042122 | Bacteria | 1122 |
| 380 | Ga0450906_001491 | 3300042145 | Bacteria | 5106 |
| 381 | Ga0450906_005561 | 3300042145 | Bacteria | 2584 |
| 382 | Ga0439434_0005516 | 3300042435 | Bacteria | 3696 |
| 383 | Ga0439434_0009062 | 3300042435 | Bacteria | 2925 |
| 384 | Ga0450918_010010 | 3300042531 | Bacteria | 1656 |
| 385 | Ga0450893_0002594 | 3300042532 | Bacteria | 2826 |
| 386 | Ga0466969_0004140 | 3300044656 | Bacteria | 7700 |
| 387 | Ga0466972_0001854 | 3300044658 | Bacteria | 10359 |
| 388 | Ga0466972_0079632 | 3300044658 | Bacteria | 1560 |
| 389 | Ga0453683_0001704 | 3300044673 | Bacteria | 18282 |
| 390 | Ga0466965_0024200 | 3300044683 | Bacteria | 2935 |
| 391 | Ga0466966_0083702 | 3300044684 | Bacteria | 1984 |
| 392 | Ga0466961_0038822 | 3300044693 | Bacteria | 3053 |
| 393 | Ga0466964_0005324 | 3300044706 | Bacteria | 4777 |
| 394 | Ga0453684_0384314 | 3300044712 | Bacteria | 1576 |
| 395 | Ga0466971_0038951 | 3300044719 | Bacteria | 2133 |
| 396 | Ga0466968_0048165 | 3300044735 | Bacteria | 1813 |
| 397 | Ga0466970_0022480 | 3300044765 | Bacteria | 3291 |
| 398 | Ga0466957_0037756 | 3300044842 | Bacteria | 2908 |
| 399 | Ga0466960_0034753 | 3300044901 | Bacteria | 2352 |
| 400 | Ga0466959_0009180 | 3300045049 | Bacteria | 7023 |
| 401 | Ga0451576_0005405 | 3300045051 | Bacteria | 16037 |
| 402 | Ga0466958_0008426 | 3300045836 | Bacteria | 5717 |
| 403 | Ga0495627_015346 | 3300046453 | Bacteria | 2646 |
| 404 | Ga0495592_0297626 | 3300046454 | Bacteria | 1050 |
| 405 | Ga0495629_0084603 | 3300046459 | Bacteria | 2213 |
| 406 | Ga0495638_0027538 | 3300046460 | Bacteria | 3678 |
| 407 | Ga0495651_0149998 | 3300046462 | Bacteria | 1682 |
| 408 | Ga0495650_0063482 | 3300046471 | Bacteria | 1472 |
| 409 | Ga0495580_0082501 | 3300046472 | Bacteria | 2241 |
| 410 | Ga0495639_0010835 | 3300046475 | Bacteria | 3927 |
| 411 | Ga0495585_0069617 | 3300046492 | Bacteria | 1920 |
| 412 | Ga0495606_0008149 | 3300046507 | Bacteria | 9177 |
| 413 | Ga0495608_0099213 | 3300046511 | Bacteria | 1879 |
| 414 | Ga0495616_0003991 | 3300046513 | Bacteria | 9382 |
| 415 | Ga0495620_0003885 | 3300046515 | Bacteria | 8525 |
| 416 | Ga0495628_0235432 | 3300046516 | Bacteria | 1371 |
| 417 | Ga0495628_0356895 | 3300046516 | Bacteria | 1074 |
| 418 | Ga0495631_0003913 | 3300046518 | Bacteria | 8043 |
| 419 | Ga0495632_0039077 | 3300046519 | Bacteria | 2398 |
| 420 | Ga0495637_0011511 | 3300046520 | Bacteria | 4247 |
| 421 | Ga0495642_0047257 | 3300046528 | Bacteria | 1762 |
| 422 | Ga0495652_0258746 | 3300046529 | Bacteria | 1286 |
| 423 | Ga0495654_0029206 | 3300046530 | Bacteria | 2812 |
| 424 | Ga0495586_0119700 | 3300046535 | Bacteria | 1470 |
| 425 | Ga0495621_0013009 | 3300046539 | Bacteria | 2608 |
| 426 | Ga0495656_0000114 | 3300046615 | Bacteria | 31389 |
| 427 | Ga0495668_0033715 | 3300046616 | Bacteria | 2875 |
| 428 | Ga0495625_0000294 | 3300046660 | Bacteria | 77321 |
| 429 | Ga0495625_0008695 | 3300046660 | Bacteria | 8621 |
| 430 | Ga0495588_0024588 | 3300046674 | Bacteria | 2993 |
| 431 | Ga0495588_0077703 | 3300046674 | Bacteria | 1731 |
| 432 | Ga0495647_0005004 | 3300046681 | Bacteria | 4339 |
| 433 | Ga0495649_0000270 | 3300046694 | Bacteria | 46170 |
| 434 | Ga0495589_0026302 | 3300046794 | Bacteria | 2949 |
| 435 | Ga0495660_0037101 | 3300046810 | Bacteria | 2716 |
| 436 | Ga0495676_0020316 | 3300047321 | Bacteria | 5830 |
| 437 | Ga0495681_0040685 | 3300047470 | Bacteria | 2262 |
| 438 | Ga0495593_0009903 | 3300047673 | Bacteria | 5527 |
| 439 | Ga0496100_0029685 | 3300048903 | Bacteria | 3384 |
| 440 | Ga0496101_0003936 | 3300048904 | Bacteria | 9282 |
| 441 | Ga0496101_0257882 | 3300048904 | Bacteria | 1359 |
| 442 | Ga0496102_0007549 | 3300048905 | Bacteria | 9296 |
| 443 | Ga0496102_0021838 | 3300048905 | Bacteria | 5665 |
| 444 | Ga0496104_0001619 | 3300048907 | Bacteria | 19424 |
| 445 | Ga0496105_0003397 | 3300048908 | Bacteria | 11774 |
| 446 | Ga0496107_0035127 | 3300048910 | Bacteria | 3594 |
| 447 | Ga0496108_0065778 | 3300048911 | Bacteria | 3056 |
| 448 | Ga0496109_0136456 | 3300048912 | Bacteria | 2292 |
| 449 | Ga0496111_0071375 | 3300048914 | Bacteria | 2527 |
| 450 | Ga0496112_0376116 | 3300048915 | Bacteria | 1362 |
| 451 | Ga0496114_0094860 | 3300048917 | Bacteria | 2538 |
| 452 | Ga0496116_0023802 | 3300048919 | Bacteria | 4551 |
| 453 | Ga0496116_0144007 | 3300048919 | Bacteria | 1335 |
| 454 | Ga0496117_0010951 | 3300048920 | Bacteria | 8173 |
| 455 | Ga0496118_0017904 | 3300048921 | Bacteria | 6426 |
| 456 | Ga0496118_0058254 | 3300048921 | Bacteria | 2888 |
| 457 | Ga0496119_0012317 | 3300048922 | Bacteria | 6962 |
| 458 | Ga0496122_0083672 | 3300048925 | Bacteria | 2211 |
| 459 | Ga0496123_0014852 | 3300048926 | Bacteria | 6427 |
| 460 | Ga0496124_0093603 | 3300048927 | Bacteria | 2445 |
| 461 | Ga0496125_0052493 | 3300048928 | Bacteria | 3352 |
| 462 | Ga0496125_0079343 | 3300048928 | Bacteria | 2519 |
| 463 | Ga0496125_0108402 | 3300048928 | Bacteria | 2020 |
| 464 | Ga0496126_0060332 | 3300048929 | Bacteria | 3412 |
| 465 | Ga0501262_000138 | 3300049759 | Bacteria | 9065 |
| 466 | Ga0501265_004384 | 3300049762 | Bacteria | 1606 |
| 467 | nmdc:mga03n38_80013_c1 | 3300050490 | Bacteria | 1534 |
| 468 | nmdc:mga00v17_64072_c1 | 3300050491 | Bacteria | 2265 |
| 469 | nmdc:mga0yw44_245496_c1 | 3300050492 | Bacteria | 1191 |
| 470 | nmdc:mga0k408_12512_c1 | 3300050493 | Bacteria | 4639 |
| 471 | nmdc:mga0k408_19510_c1 | 3300050493 | Bacteria | 3790 |
| 472 | nmdc:mga0k408_250046_c1 | 3300050493 | Bacteria | 1059 |
| 473 | nmdc:mga0k408_32098_c1 | 3300050493 | Bacteria | 3000 |
| 474 | nmdc:mga0k408_66920_c1 | 3300050493 | Bacteria | 2093 |
| 475 | nmdc:mga06z11_83836_c1 | 3300050494 | Bacteria | 1716 |
| 476 | nmdc:mga06z11_8825_c1 | 3300050494 | Bacteria | 4222 |
| 477 | nmdc:mga07m45_125706_c1 | 3300050496 | Bacteria | 1483 |
| 478 | nmdc:mga07m45_141133_c1 | 3300050496 | Bacteria | 1395 |
| 479 | nmdc:mga07m45_210645_c1 | 3300050496 | Bacteria | 1131 |
| 480 | nmdc:mga07m45_37567_c1 | 3300050496 | Bacteria | 2701 |
| 481 | nmdc:mga07m45_47327_c1 | 3300050496 | Bacteria | 2418 |
| 482 | nmdc:mga07m45_5751_c1 | 3300050496 | Bacteria | 6205 |
| 483 | nmdc:mga07m45_966_c2 | 3300050496 | Bacteria | 8224 |
| 484 | nmdc:mga05p37_42453_c1 | 3300050507 | Bacteria | 5587 |
| 485 | nmdc:mga0sz30_112190_c1 | 3300050516 | Bacteria | 1195 |
| 486 | Ga0495601_0111487 | 3300053077 | Bacteria | 1772 |
| 487 | Ga0500610_0072486 | 3300053079 | Bacteria | 1796 |
| 488 | Ga0500635_0000243 | 3300053080 | Bacteria | 23803 |
| 489 | Ga0500643_017857 | 3300053087 | Bacteria | 2365 |
| 490 | Ga0500644_0003211 | 3300053088 | Bacteria | 4045 |
| 491 | Ga0500651_0000057 | 3300053093 | Bacteria | 72615 |
| 492 | Ga0500566_0099850 | 3300053094 | Bacteria | 1593 |
| 493 | Ga0500650_0019041 | 3300053098 | Bacteria | 2989 |
| 494 | Ga0500555_038217 | 3300053103 | Bacteria | 1343 |
| 495 | Ga0500562_028761 | 3300053108 | Bacteria | 1461 |
| 496 | Ga0500571_000038 | 3300053110 | Bacteria | 41284 |
| 497 | Ga0500593_000984 | 3300053117 | Bacteria | 10398 |
| 498 | Ga0500593_006723 | 3300053117 | Bacteria | 4618 |
| 499 | Ga0500594_0000390 | 3300053118 | Bacteria | 9816 |
| 500 | Ga0500607_005933 | 3300053121 | Bacteria | 7854 |
| 501 | Ga0500607_039435 | 3300053121 | Bacteria | 2564 |
| 502 | Ga0500608_016963 | 3300053122 | Bacteria | 3300 |
| 503 | Ga0500628_001932 | 3300053129 | Bacteria | 3485 |
| 504 | Ga0500655_001260 | 3300053133 | Bacteria | 4809 |
| 505 | Ga0500658_0000408 | 3300053134 | Bacteria | 18668 |
| 506 | Ga0500658_0001506 | 3300053134 | Bacteria | 9333 |
| 507 | Ga0500658_0015246 | 3300053134 | Bacteria | 2851 |
| 508 | Ga0500559_0006861 | 3300053136 | Bacteria | 5103 |
| 509 | Ga0500568_0007904 | 3300053139 | Bacteria | 5176 |
| 510 | Ga0500574_038913 | 3300053141 | Bacteria | 1318 |
| 511 | Ga0500586_044798 | 3300053145 | Bacteria | 1512 |
| 512 | Ga0500616_0011515 | 3300053153 | Bacteria | 5216 |
| 513 | Ga0500616_0032745 | 3300053153 | Bacteria | 2840 |
| 514 | Ga0500627_0002652 | 3300053158 | Bacteria | 5358 |
| 515 | Ga0500634_0027640 | 3300053161 | Bacteria | 3091 |
| 516 | Ga0500638_003779 | 3300053162 | Bacteria | 5694 |
| 517 | Ga0500625_038758 | 3300053729 | Bacteria | 2249 |
| 518 | Ga0500661_002140 | 3300055283 | Bacteria | 3727 |
| 519 | Ga0466962_0031832 | 3300061719 | Bacteria | 2525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053153 | Ga0500616_0032745 | Ga0500616_0032745_2022_2828 | 264 |
| 2 | 3300036401 | Ga0373937_0044882 | Ga0373937_0044882_144_1082 | 288 |
| 3 | 3300046459 | Ga0495629_0084603 | Ga0495629_0084603_568_1506 | 288 |
| 4 | 3300046681 | Ga0495647_0005004 | Ga0495647_0005004_2132_3070 | 288 |
| 5 | 3300053077 | Ga0495601_0111487 | Ga0495601_0111487_124_1062 | 288 |
| 6 | 3300025711 | Ga0207696_1016135 | Ga0207696_10161352 | 289 |
| 7 | 3300046454 | Ga0495592_0297626 | Ga0495592_0297626_92_1030 | 290 |
| 8 | 3300009148 | Ga0105243_10005637 | Ga0105243_100056379 | 297 |
| 9 | 3300025292 | Ga0209676_1000367 | Ga0209676_100036773 | 297 |
| 10 | 3300025303 | Ga0209051_1001096 | Ga0209051_100109621 | 297 |
| 11 | 3300025304 | Ga0209257_1011962 | Ga0209257_10119622 | 297 |
| 12 | 3300025935 | Ga0207709_10000587 | Ga0207709_100005873 | 297 |
| 13 | 3300031731 | Ga0307405_10009141 | Ga0307405_100091413 | 297 |
| 14 | 3300031731 | Ga0307405_10112474 | Ga0307405_101124742 | 297 |
| 15 | 3300014497 | Ga0182008_10001323 | Ga0182008_100013234 | 298 |
| 16 | 3300041997 | Ga0439431_0043738 | Ga0439431_0043738_82_1020 | 299 |
| 17 | 3300031911 | Ga0307412_10383535 | Ga0307412_103835351 | 301 |
| 18 | 3300009553 | Ga0105249_10337813 | Ga0105249_103378131 | 302 |
| 19 | 3300013306 | Ga0163162_10721334 | Ga0163162_107213341 | 302 |
| 20 | 3300042435 | Ga0439434_0005516 | Ga0439434_0005516_1856_2764 | 302 |
| 21 | 3300041997 | Ga0439431_0016587 | Ga0439431_0016587_60_1004 | 303 |
| 22 | 3300026067 | Ga0207678_10225758 | Ga0207678_102257581 | 304 |
| 23 | 3300031507 | Ga0307509_10169074 | Ga0307509_101690741 | 304 |
| 24 | 3300035691 | Ga0373931_0008810 | Ga0373931_0008810_3018_3944 | 304 |
| 25 | 3300042015 | Ga0439462_0022952 | Ga0439462_0022952_215_1204 | 304 |
| 26 | 3300046492 | Ga0495585_0069617 | Ga0495585_0069617_220_1146 | 304 |
| 27 | iso_pu_bacteria | 2831864461 | 2831869180 | 304 |
| 28 | 3300002738 | JGI25154J39366_1001254 | JGI25154J39366_10012545 | 305 |
| 29 | 3300002741 | JGI25157J39369_1000199 | JGI25157J39369_10001997 | 305 |
| 30 | 3300005329 | Ga0070683_100311895 | Ga0070683_1003118952 | 305 |
| 31 | 3300005330 | Ga0070690_100024000 | Ga0070690_1000240003 | 305 |
| 32 | 3300005339 | Ga0070660_100025146 | Ga0070660_1000251467 | 305 |
| 33 | 3300005364 | Ga0070673_100093450 | Ga0070673_1000934502 | 305 |
| 34 | 3300005563 | Ga0068855_100019384 | Ga0068855_1000193843 | 305 |
| 35 | 3300005563 | Ga0068855_100391845 | Ga0068855_1003918452 | 305 |
| 36 | 3300005578 | Ga0068854_100018408 | Ga0068854_1000184084 | 305 |
| 37 | 3300005614 | Ga0068856_100011642 | Ga0068856_1000116427 | 305 |
| 38 | 3300005719 | Ga0068861_100020935 | Ga0068861_1000209353 | 305 |
| 39 | 3300005843 | Ga0068860_100201055 | Ga0068860_1002010552 | 305 |
| 40 | 3300006195 | Ga0075366_10025007 | Ga0075366_100250072 | 305 |
| 41 | 3300006353 | Ga0075370_10000635 | Ga0075370_100006356 | 305 |
| 42 | 3300009176 | Ga0105242_10047066 | Ga0105242_100470663 | 305 |
| 43 | 3300009545 | Ga0105237_10048563 | Ga0105237_100485633 | 305 |
| 44 | 3300009545 | Ga0105237_10313130 | Ga0105237_103131302 | 305 |
| 45 | 3300009551 | Ga0105238_10120658 | Ga0105238_101206581 | 305 |
| 46 | 3300013105 | Ga0157369_10080034 | Ga0157369_100800343 | 305 |
| 47 | 3300013307 | Ga0157372_10172260 | Ga0157372_101722602 | 305 |
| 48 | 3300013308 | Ga0157375_10524596 | Ga0157375_105245962 | 305 |
| 49 | 3300021361 | Ga0213872_10085291 | Ga0213872_100852912 | 305 |
| 50 | 3300025226 | Ga0209674_100064 | Ga0209674_1000647 | 305 |
| 51 | 3300025230 | Ga0209563_100099 | Ga0209563_1000997 | 305 |
| 52 | 3300025231 | Ga0207427_100844 | Ga0207427_1008447 | 305 |
| 53 | 3300025242 | Ga0209258_100453 | Ga0209258_10045334 | 305 |
| 54 | 3300025242 | Ga0209258_100808 | Ga0209258_10080812 | 305 |
| 55 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060237 | 305 |
| 56 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049235 | 305 |
| 57 | 3300025253 | Ga0209677_100954 | Ga0209677_1009549 | 305 |
| 58 | 3300025253 | Ga0209677_102445 | Ga0209677_1024455 | 305 |
| 59 | 3300025253 | Ga0209677_104629 | Ga0209677_1046292 | 305 |
| 60 | 3300025254 | Ga0209148_1007934 | Ga0209148_10079342 | 305 |
| 61 | 3300025256 | Ga0209759_1000272 | Ga0209759_100027266 | 305 |
| 62 | 3300025272 | Ga0209455_1000157 | Ga0209455_10001577 | 305 |
| 63 | 3300025907 | Ga0207645_10238765 | Ga0207645_102387652 | 305 |
| 64 | 3300025909 | Ga0207705_10144464 | Ga0207705_101444642 | 305 |
| 65 | 3300025911 | Ga0207654_10100393 | Ga0207654_101003932 | 305 |
| 66 | 3300025913 | Ga0207695_10073418 | Ga0207695_100734182 | 305 |
| 67 | 3300025914 | Ga0207671_10102589 | Ga0207671_101025892 | 305 |
| 68 | 3300025932 | Ga0207690_10016847 | Ga0207690_100168472 | 305 |
| 69 | 3300025934 | Ga0207686_10047616 | Ga0207686_100476163 | 305 |
| 70 | 3300025942 | Ga0207689_10094734 | Ga0207689_100947342 | 305 |
| 71 | 3300025944 | Ga0207661_10175879 | Ga0207661_101758792 | 305 |
| 72 | 3300025949 | Ga0207667_10104617 | Ga0207667_101046174 | 305 |
| 73 | 3300025949 | Ga0207667_10527990 | Ga0207667_105279901 | 305 |
| 74 | 3300025960 | Ga0207651_10095847 | Ga0207651_100958472 | 305 |
| 75 | 3300026023 | Ga0207677_10203707 | Ga0207677_102037071 | 305 |
| 76 | 3300026078 | Ga0207702_10003218 | Ga0207702_100032187 | 305 |
| 77 | 3300028381 | Ga0268264_10388760 | Ga0268264_103887601 | 305 |
| 78 | 3300028666 | Ga0265336_10000040 | Ga0265336_10000040127 | 305 |
| 79 | 3300029957 | Ga0265324_10001932 | Ga0265324_100019325 | 305 |
| 80 | 3300031616 | Ga0307508_10238600 | Ga0307508_102386002 | 305 |
| 81 | 3300031730 | Ga0307516_10001176 | Ga0307516_1000117633 | 305 |
| 82 | 3300037466 | Ga0395898_0140581 | Ga0395898_0140581_510_1439 | 305 |
| 83 | 3300038443 | Ga0395901_0010895 | Ga0395901_0010895_5706_6635 | 305 |
| 84 | 3300039447 | Ga0436361_0064311 | Ga0436361_0064311_534_1460 | 305 |
| 85 | 3300039447 | Ga0436361_0276783 | Ga0436361_0276783_112_1038 | 305 |
| 86 | 3300039447 | Ga0436361_0691237 | Ga0436361_0691237_4304_5227 | 305 |
| 87 | 3300039447 | Ga0436361_1092231 | Ga0436361_1092231_1576_2502 | 305 |
| 88 | 3300041512 | Ga0451853_3940933 | Ga0451853_3940933_43_969 | 305 |
| 89 | 3300044656 | Ga0466969_0004140 | Ga0466969_0004140_6253_7179 | 305 |
| 90 | 3300044658 | Ga0466972_0079632 | Ga0466972_0079632_225_1160 | 305 |
| 91 | 3300044683 | Ga0466965_0024200 | Ga0466965_0024200_590_1516 | 305 |
| 92 | 3300044684 | Ga0466966_0083702 | Ga0466966_0083702_368_1294 | 305 |
| 93 | 3300044693 | Ga0466961_0038822 | Ga0466961_0038822_1126_2052 | 305 |
| 94 | 3300044706 | Ga0466964_0005324 | Ga0466964_0005324_3161_4087 | 305 |
| 95 | 3300044719 | Ga0466971_0038951 | Ga0466971_0038951_698_1624 | 305 |
| 96 | 3300044735 | Ga0466968_0048165 | Ga0466968_0048165_519_1445 | 305 |
| 97 | 3300044765 | Ga0466970_0022480 | Ga0466970_0022480_2340_3266 | 305 |
| 98 | 3300044842 | Ga0466957_0037756 | Ga0466957_0037756_730_1656 | 305 |
| 99 | 3300044901 | Ga0466960_0034753 | Ga0466960_0034753_595_1518 | 305 |
| 100 | 3300045049 | Ga0466959_0009180 | Ga0466959_0009180_1799_2725 | 305 |
| 101 | 3300045836 | Ga0466958_0008426 | Ga0466958_0008426_4294_5220 | 305 |
| 102 | 3300046462 | Ga0495651_0149998 | Ga0495651_0149998_570_1496 | 305 |
| 103 | 3300046471 | Ga0495650_0063482 | Ga0495650_0063482_516_1445 | 305 |
| 104 | 3300046475 | Ga0495639_0010835 | Ga0495639_0010835_652_1581 | 305 |
| 105 | 3300046507 | Ga0495606_0008149 | Ga0495606_0008149_3978_4907 | 305 |
| 106 | 3300046511 | Ga0495608_0099213 | Ga0495608_0099213_284_1213 | 305 |
| 107 | 3300046529 | Ga0495652_0258746 | Ga0495652_0258746_121_1050 | 305 |
| 108 | 3300046616 | Ga0495668_0033715 | Ga0495668_0033715_600_1529 | 305 |
| 109 | 3300046694 | Ga0495649_0000270 | Ga0495649_0000270_6168_7097 | 305 |
| 110 | 3300046794 | Ga0495589_0026302 | Ga0495589_0026302_353_1282 | 305 |
| 111 | 3300050496 | nmdc:mga07m45_5751_c1 | nmdc:mga07m45_5751_c1_1371_2297 | 305 |
| 112 | 3300053080 | Ga0500635_0000243 | Ga0500635_0000243_6980_7906 | 305 |
| 113 | 3300055283 | Ga0500661_002140 | Ga0500661_002140_1020_1949 | 305 |
| 114 | 3300061719 | Ga0466962_0031832 | Ga0466962_0031832_1501_2427 | 305 |
| 115 | iso_pu_bacteria | 2585428062 | 2587754344 | 305 |
| 116 | iso_pu_bacteria | 2721755523 | 2722881879 | 305 |
| 117 | iso_pu_bacteria | 2839138175 | 2839144825 | 305 |
| 118 | iso_pu_bacteria | 2842747753 | 2842751914 | 305 |
| 119 | iso_pu_bacteria | 2919704043 | 2919705269 | 305 |
| 120 | 3300025294 | Ga0209025_1001452 | Ga0209025_100145223 | 306 |
| 121 | 3300025933 | Ga0207706_10006170 | Ga0207706_1000617010 | 306 |
| 122 | 3300044658 | Ga0466972_0001854 | Ga0466972_0001854_5919_6869 | 306 |
| 123 | iso_pu_bacteria | 2885192300 | 2885192398 | 306 |
| 124 | iso_pu_bacteria | 2932422444 | 2932423907 | 306 |
| 125 | 3300009147 | Ga0114129_10025979 | Ga0114129_100259796 | 307 |
| 126 | 3300028794 | Ga0307515_10108747 | Ga0307515_101087472 | 307 |
| 127 | 3300031730 | Ga0307516_10000155 | Ga0307516_1000015552 | 307 |
| 128 | 3300031730 | Ga0307516_10000155 | Ga0307516_1000015556 | 307 |
| 129 | 3300031911 | Ga0307412_10155167 | Ga0307412_101551672 | 307 |
| 130 | 3300044712 | Ga0453684_0384314 | Ga0453684_0384314_277_1266 | 307 |
| 131 | 3300050507 | nmdc:mga05p37_42453_c1 | nmdc:mga05p37_42453_c1_3970_4902 | 307 |
| 132 | 3300003771 | Ga0055526_1006456 | Ga0055526_10064563 | 308 |
| 133 | 3300004625 | Ga0055543_1001804 | Ga0055543_10018045 | 308 |
| 134 | 3300005262 | Ga0065165_1001023 | Ga0065165_100102317 | 308 |
| 135 | 3300005338 | Ga0068868_100322084 | Ga0068868_1003220842 | 308 |
| 136 | 3300005354 | Ga0070675_100133034 | Ga0070675_1001330342 | 308 |
| 137 | 3300005367 | Ga0070667_100141980 | Ga0070667_1001419802 | 308 |
| 138 | 3300005457 | Ga0070662_100112514 | Ga0070662_1001125142 | 308 |
| 139 | 3300005466 | Ga0070685_10115033 | Ga0070685_101150332 | 308 |
| 140 | 3300005467 | Ga0070706_100000388 | Ga0070706_10000038817 | 308 |
| 141 | 3300005468 | Ga0070707_100071369 | Ga0070707_1000713696 | 308 |
| 142 | 3300005471 | Ga0070698_100421808 | Ga0070698_1004218081 | 308 |
| 143 | 3300005577 | Ga0068857_100000643 | Ga0068857_1000006435 | 308 |
| 144 | 3300005616 | Ga0068852_100026629 | Ga0068852_1000266295 | 308 |
| 145 | 3300005617 | Ga0068859_100039119 | Ga0068859_1000391192 | 308 |
| 146 | 3300005617 | Ga0068859_100796317 | Ga0068859_1007963171 | 308 |
| 147 | 3300005840 | Ga0068870_10208328 | Ga0068870_102083281 | 308 |
| 148 | 3300005841 | Ga0068863_100329760 | Ga0068863_1003297601 | 308 |
| 149 | 3300005843 | Ga0068860_100625975 | Ga0068860_1006259751 | 308 |
| 150 | 3300006042 | Ga0075368_10074386 | Ga0075368_100743862 | 308 |
| 151 | 3300006177 | Ga0075362_10035780 | Ga0075362_100357802 | 308 |
| 152 | 3300006178 | Ga0075367_10018219 | Ga0075367_100182194 | 308 |
| 153 | 3300006195 | Ga0075366_10013970 | Ga0075366_100139704 | 308 |
| 154 | 3300006353 | Ga0075370_10004190 | Ga0075370_100041904 | 308 |
| 155 | 3300006353 | Ga0075370_10023580 | Ga0075370_100235803 | 308 |
| 156 | 3300006931 | Ga0097620_100039122 | Ga0097620_1000391222 | 308 |
| 157 | 3300006931 | Ga0097620_100796298 | Ga0097620_1007962981 | 308 |
| 158 | 3300006946 | Ga0079104_1000016 | Ga0079104_100001667 | 308 |
| 159 | 3300009092 | Ga0105250_10001094 | Ga0105250_1000109410 | 308 |
| 160 | 3300009093 | Ga0105240_10076158 | Ga0105240_100761584 | 308 |
| 161 | 3300009093 | Ga0105240_10308219 | Ga0105240_103082192 | 308 |
| 162 | 3300009098 | Ga0105245_10098769 | Ga0105245_100987692 | 308 |
| 163 | 3300009098 | Ga0105245_10136482 | Ga0105245_101364822 | 308 |
| 164 | 3300009098 | Ga0105245_10227316 | Ga0105245_102273162 | 308 |
| 165 | 3300009148 | Ga0105243_10007314 | Ga0105243_100073145 | 308 |
| 166 | 3300009176 | Ga0105242_10235149 | Ga0105242_102351492 | 308 |
| 167 | 3300009545 | Ga0105237_10037619 | Ga0105237_100376195 | 308 |
| 168 | 3300010375 | Ga0105239_10013427 | Ga0105239_100134275 | 308 |
| 169 | 3300013297 | Ga0157378_10146509 | Ga0157378_101465092 | 308 |
| 170 | 3300013308 | Ga0157375_10014275 | Ga0157375_100142753 | 308 |
| 171 | 3300013308 | Ga0157375_10382629 | Ga0157375_103826292 | 308 |
| 172 | 3300021384 | Ga0213876_10178945 | Ga0213876_101789452 | 308 |
| 173 | 3300025273 | Ga0209673_1020420 | Ga0209673_10204202 | 308 |
| 174 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008597 | 308 |
| 175 | 3300025908 | Ga0207643_10181400 | Ga0207643_101814002 | 308 |
| 176 | 3300025910 | Ga0207684_10006285 | Ga0207684_1000628513 | 308 |
| 177 | 3300025913 | Ga0207695_10085364 | Ga0207695_100853644 | 308 |
| 178 | 3300025913 | Ga0207695_10238069 | Ga0207695_102380692 | 308 |
| 179 | 3300025914 | Ga0207671_10030763 | Ga0207671_100307632 | 308 |
| 180 | 3300025922 | Ga0207646_10044087 | Ga0207646_100440873 | 308 |
| 181 | 3300025927 | Ga0207687_10058118 | Ga0207687_100581182 | 308 |
| 182 | 3300025927 | Ga0207687_10144215 | Ga0207687_101442152 | 308 |
| 183 | 3300025934 | Ga0207686_10118135 | Ga0207686_101181353 | 308 |
| 184 | 3300025935 | Ga0207709_10000117 | Ga0207709_1000011785 | 308 |
| 185 | 3300025941 | Ga0207711_10264924 | Ga0207711_102649243 | 308 |
| 186 | 3300025942 | Ga0207689_10051455 | Ga0207689_100514552 | 308 |
| 187 | 3300025942 | Ga0207689_10183674 | Ga0207689_101836742 | 308 |
| 188 | 3300025961 | Ga0207712_10466021 | Ga0207712_104660211 | 308 |
| 189 | 3300026023 | Ga0207677_10052699 | Ga0207677_100526992 | 308 |
| 190 | 3300026023 | Ga0207677_10353751 | Ga0207677_103537511 | 308 |
| 191 | 3300026067 | Ga0207678_10020544 | Ga0207678_100205443 | 308 |
| 192 | 3300026089 | Ga0207648_10028772 | Ga0207648_100287722 | 308 |
| 193 | 3300026116 | Ga0207674_10001652 | Ga0207674_100016525 | 308 |
| 194 | 3300026118 | Ga0207675_100080204 | Ga0207675_1000802042 | 308 |
| 195 | 3300026142 | Ga0207698_10035164 | Ga0207698_100351642 | 308 |
| 196 | 3300027111 | Ga0209281_1000017 | Ga0209281_100001777 | 308 |
| 197 | 3300028794 | Ga0307515_10070037 | Ga0307515_100700374 | 308 |
| 198 | 3300031548 | Ga0307408_100000246 | Ga0307408_10000024630 | 308 |
| 199 | 3300031730 | Ga0307516_10001709 | Ga0307516_100017098 | 308 |
| 200 | 3300031901 | Ga0307406_10001082 | Ga0307406_1000108216 | 308 |
| 201 | 3300032002 | Ga0307416_100376310 | Ga0307416_1003763102 | 308 |
| 202 | 3300037471 | Ga0395905_0004450 | Ga0395905_0004450_7026_7955 | 308 |
| 203 | 3300039437 | Ga0436365_0179555 | Ga0436365_0179555_174_1124 | 308 |
| 204 | 3300049762 | Ga0501265_004384 | Ga0501265_004384_208_1143 | 308 |
| 205 | 3300050493 | nmdc:mga0k408_32098_c1 | nmdc:mga0k408_32098_c1_1699_2634 | 308 |
| 206 | 3300050494 | nmdc:mga06z11_83836_c1 | nmdc:mga06z11_83836_c1_430_1365 | 308 |
| 207 | 3300050496 | nmdc:mga07m45_141133_c1 | nmdc:mga07m45_141133_c1_38_973 | 308 |
| 208 | 3300050496 | nmdc:mga07m45_37567_c1 | nmdc:mga07m45_37567_c1_1228_2163 | 308 |
| 209 | 3300050516 | nmdc:mga0sz30_112190_c1 | nmdc:mga0sz30_112190_c1_162_1097 | 308 |
| 210 | iso_pu_bacteria | 2643221628 | 2644161511 | 308 |
| 211 | iso_pu_bacteria | 2842677519 | 2842680535 | 308 |
| 212 | iso_pu_bacteria | 2904449895 | 2904450824 | 308 |
| 213 | iso_pu_bacteria | 2904456579 | 2904459673 | 308 |
| 214 | iso_pu_bacteria | 2919462493 | 2919462650 | 308 |
| 215 | iso_pu_bacteria | 2929520902 | 2929521772 | 308 |
| 216 | iso_pu_bacteria | 2945972063 | 2945973600 | 308 |
| 217 | 3300006042 | Ga0075368_10086232 | Ga0075368_100862321 | 309 |
| 218 | 3300006048 | Ga0075363_100021061 | Ga0075363_1000210612 | 309 |
| 219 | 3300006177 | Ga0075362_10024734 | Ga0075362_100247342 | 309 |
| 220 | 3300006178 | Ga0075367_10059629 | Ga0075367_100596292 | 309 |
| 221 | 3300006195 | Ga0075366_10005751 | Ga0075366_100057516 | 309 |
| 222 | 3300006353 | Ga0075370_10100417 | Ga0075370_101004171 | 309 |
| 223 | 3300025986 | Ga0207658_10214692 | Ga0207658_102146922 | 309 |
| 224 | 3300027614 | Ga0209970_1000287 | Ga0209970_10002875 | 309 |
| 225 | 3300028794 | Ga0307515_10000221 | Ga0307515_1000022167 | 309 |
| 226 | 3300028794 | Ga0307515_10000777 | Ga0307515_1000077716 | 309 |
| 227 | 3300031456 | Ga0307513_10001667 | Ga0307513_100016676 | 309 |
| 228 | 3300031456 | Ga0307513_10074508 | Ga0307513_100745083 | 309 |
| 229 | 3300031616 | Ga0307508_10000141 | Ga0307508_1000014118 | 309 |
| 230 | 3300031649 | Ga0307514_10035594 | Ga0307514_100355942 | 309 |
| 231 | 3300031649 | Ga0307514_10200284 | Ga0307514_102002842 | 309 |
| 232 | 3300031730 | Ga0307516_10004703 | Ga0307516_100047036 | 309 |
| 233 | 3300033179 | Ga0307507_10094543 | Ga0307507_100945432 | 309 |
| 234 | 3300041452 | Ga0451793_1648312 | Ga0451793_1648312_59_994 | 309 |
| 235 | 3300041460 | Ga0451802_2098710 | Ga0451802_2098710_505_1443 | 309 |
| 236 | 3300041486 | Ga0451807_0108644 | Ga0451807_0108644_306_1241 | 309 |
| 237 | 3300044673 | Ga0453683_0001704 | Ga0453683_0001704_6709_7647 | 309 |
| 238 | 3300045051 | Ga0451576_0005405 | Ga0451576_0005405_9700_10638 | 309 |
| 239 | 3300046519 | Ga0495632_0039077 | Ga0495632_0039077_1444_2379 | 309 |
| 240 | 3300046660 | Ga0495625_0008695 | Ga0495625_0008695_1692_2627 | 309 |
| 241 | 3300048905 | Ga0496102_0021838 | Ga0496102_0021838_2052_2987 | 309 |
| 242 | 3300050493 | nmdc:mga0k408_19510_c1 | nmdc:mga0k408_19510_c1_2766_3704 | 309 |
| 243 | 3300050493 | nmdc:mga0k408_66920_c1 | nmdc:mga0k408_66920_c1_777_1715 | 309 |
| 244 | 3300050494 | nmdc:mga06z11_8825_c1 | nmdc:mga06z11_8825_c1_814_1752 | 309 |
| 245 | 3300050496 | nmdc:mga07m45_125706_c1 | nmdc:mga07m45_125706_c1_531_1466 | 309 |
| 246 | 3300053134 | Ga0500658_0015246 | Ga0500658_0015246_585_1520 | 309 |
| 247 | iso_pu_bacteria | 2513020051 | 2513230030 | 309 |
| 248 | iso_pu_bacteria | 2643221658 | 2644324235 | 309 |
| 249 | iso_pu_bacteria | 2643221672 | 2644399467 | 309 |
| 250 | iso_pu_bacteria | 2643221683 | 2644465037 | 309 |
| 251 | iso_pu_bacteria | 2954767861 | 2954770785 | 309 |
| 252 | 3300002987 | JGI25159J45721_1011127 | JGI25159J45721_10111272 | 310 |
| 253 | 3300003322 | rootL2_10062417 | rootL2_100624172 | 310 |
| 254 | 3300003784 | Ga0055534_1008457 | Ga0055534_10084572 | 310 |
| 255 | 3300005328 | Ga0070676_10296232 | Ga0070676_102962321 | 310 |
| 256 | 3300005329 | Ga0070683_100202003 | Ga0070683_1002020032 | 310 |
| 257 | 3300005334 | Ga0068869_100297623 | Ga0068869_1002976232 | 310 |
| 258 | 3300005344 | Ga0070661_100129704 | Ga0070661_1001297042 | 310 |
| 259 | 3300005356 | Ga0070674_100122233 | Ga0070674_1001222332 | 310 |
| 260 | 3300005356 | Ga0070674_100264122 | Ga0070674_1002641222 | 310 |
| 261 | 3300005367 | Ga0070667_100036966 | Ga0070667_1000369663 | 310 |
| 262 | 3300005456 | Ga0070678_100025246 | Ga0070678_1000252464 | 310 |
| 263 | 3300005459 | Ga0068867_100004283 | Ga0068867_1000042839 | 310 |
| 264 | 3300005535 | Ga0070684_100404125 | Ga0070684_1004041251 | 310 |
| 265 | 3300005548 | Ga0070665_100016667 | Ga0070665_1000166674 | 310 |
| 266 | 3300005548 | Ga0070665_100155233 | Ga0070665_1001552333 | 310 |
| 267 | 3300005564 | Ga0070664_100003941 | Ga0070664_1000039418 | 310 |
| 268 | 3300005564 | Ga0070664_100443559 | Ga0070664_1004435592 | 310 |
| 269 | 3300005617 | Ga0068859_100264579 | Ga0068859_1002645792 | 310 |
| 270 | 3300005718 | Ga0068866_10039101 | Ga0068866_100391012 | 310 |
| 271 | 3300005719 | Ga0068861_100003803 | Ga0068861_1000038038 | 310 |
| 272 | 3300005841 | Ga0068863_100368200 | Ga0068863_1003682002 | 310 |
| 273 | 3300005843 | Ga0068860_100019424 | Ga0068860_1000194242 | 310 |
| 274 | 3300005844 | Ga0068862_100027196 | Ga0068862_1000271965 | 310 |
| 275 | 3300005844 | Ga0068862_100050422 | Ga0068862_1000504223 | 310 |
| 276 | 3300005844 | Ga0068862_100061092 | Ga0068862_1000610923 | 310 |
| 277 | 3300006195 | Ga0075366_10002902 | Ga0075366_100029026 | 310 |
| 278 | 3300006195 | Ga0075366_10026682 | Ga0075366_100266823 | 310 |
| 279 | 3300006353 | Ga0075370_10049246 | Ga0075370_100492461 | 310 |
| 280 | 3300006881 | Ga0068865_100012454 | Ga0068865_1000124545 | 310 |
| 281 | 3300006881 | Ga0068865_100134829 | Ga0068865_1001348292 | 310 |
| 282 | 3300006931 | Ga0097620_100264589 | Ga0097620_1002645892 | 310 |
| 283 | 3300009148 | Ga0105243_10128360 | Ga0105243_101283602 | 310 |
| 284 | 3300013297 | Ga0157378_10015862 | Ga0157378_100158623 | 310 |
| 285 | 3300013308 | Ga0157375_10126005 | Ga0157375_101260052 | 310 |
| 286 | 3300014497 | Ga0182008_10001893 | Ga0182008_100018933 | 310 |
| 287 | 3300014968 | Ga0157379_10199818 | Ga0157379_101998182 | 310 |
| 288 | 3300017792 | Ga0163161_10046136 | Ga0163161_100461363 | 310 |
| 289 | 3300025284 | Ga0209130_1002913 | Ga0209130_10029133 | 310 |
| 290 | 3300025291 | Ga0209675_1008940 | Ga0209675_10089403 | 310 |
| 291 | 3300025292 | Ga0209676_1020966 | Ga0209676_10209663 | 310 |
| 292 | 3300025920 | Ga0207649_10199262 | Ga0207649_101992622 | 310 |
| 293 | 3300025931 | Ga0207644_10137219 | Ga0207644_101372192 | 310 |
| 294 | 3300025937 | Ga0207669_10101506 | Ga0207669_101015062 | 310 |
| 295 | 3300025937 | Ga0207669_10296435 | Ga0207669_102964351 | 310 |
| 296 | 3300025938 | Ga0207704_10032479 | Ga0207704_100324793 | 310 |
| 297 | 3300025940 | Ga0207691_10051737 | Ga0207691_100517372 | 310 |
| 298 | 3300025942 | Ga0207689_10325431 | Ga0207689_103254312 | 310 |
| 299 | 3300025945 | Ga0207679_10154489 | Ga0207679_101544892 | 310 |
| 300 | 3300025986 | Ga0207658_10049045 | Ga0207658_100490453 | 310 |
| 301 | 3300026035 | Ga0207703_10450961 | Ga0207703_104509612 | 310 |
| 302 | 3300026089 | Ga0207648_10008269 | Ga0207648_100082693 | 310 |
| 303 | 3300026089 | Ga0207648_10119908 | Ga0207648_101199082 | 310 |
| 304 | 3300026118 | Ga0207675_100009803 | Ga0207675_1000098034 | 310 |
| 305 | 3300026121 | Ga0207683_10050234 | Ga0207683_100502343 | 310 |
| 306 | 3300026121 | Ga0207683_10088143 | Ga0207683_100881432 | 310 |
| 307 | 3300028379 | Ga0268266_10062898 | Ga0268266_100628982 | 310 |
| 308 | 3300028380 | Ga0268265_10026776 | Ga0268265_100267763 | 310 |
| 309 | 3300028381 | Ga0268264_10372947 | Ga0268264_103729472 | 310 |
| 310 | 3300028794 | Ga0307515_10000137 | Ga0307515_10000137169 | 310 |
| 311 | 3300031251 | Ga0265327_10000640 | Ga0265327_1000064016 | 310 |
| 312 | 3300031251 | Ga0265327_10008506 | Ga0265327_100085067 | 310 |
| 313 | 3300031731 | Ga0307405_10128723 | Ga0307405_101287232 | 310 |
| 314 | 3300032002 | Ga0307416_100088462 | Ga0307416_1000884622 | 310 |
| 315 | 3300035089 | Ga0373944_0045699 | Ga0373944_0045699_169_1107 | 310 |
| 316 | 3300041406 | Ga0439439_0001487 | Ga0439439_0001487_124_1062 | 310 |
| 317 | 3300041406 | Ga0439439_0017146 | Ga0439439_0017146_35_973 | 310 |
| 318 | 3300041999 | Ga0439433_0004117 | Ga0439433_0004117_762_1700 | 310 |
| 319 | 3300042002 | Ga0439442_001303 | Ga0439442_001303_3572_4510 | 310 |
| 320 | 3300042004 | Ga0439445_0003027 | Ga0439445_0003027_698_1636 | 310 |
| 321 | 3300042006 | Ga0439432_028680 | Ga0439432_028680_818_1756 | 310 |
| 322 | 3300042007 | Ga0439449_0000254 | Ga0439449_0000254_2103_3041 | 310 |
| 323 | 3300042007 | Ga0439449_0006594 | Ga0439449_0006594_466_1404 | 310 |
| 324 | 3300042145 | Ga0450906_001491 | Ga0450906_001491_797_1735 | 310 |
| 325 | 3300042435 | Ga0439434_0009062 | Ga0439434_0009062_1647_2585 | 310 |
| 326 | 3300042532 | Ga0450893_0002594 | Ga0450893_0002594_187_1125 | 310 |
| 327 | 3300046472 | Ga0495580_0082501 | Ga0495580_0082501_986_1930 | 310 |
| 328 | 3300046516 | Ga0495628_0235432 | Ga0495628_0235432_265_1206 | 310 |
| 329 | 3300046528 | Ga0495642_0047257 | Ga0495642_0047257_302_1243 | 310 |
| 330 | 3300046535 | Ga0495586_0119700 | Ga0495586_0119700_414_1352 | 310 |
| 331 | 3300046539 | Ga0495621_0013009 | Ga0495621_0013009_308_1249 | 310 |
| 332 | 3300046615 | Ga0495656_0000114 | Ga0495656_0000114_2450_3388 | 310 |
| 333 | 3300048903 | Ga0496100_0029685 | Ga0496100_0029685_1590_2531 | 310 |
| 334 | 3300048904 | Ga0496101_0003936 | Ga0496101_0003936_5474_6415 | 310 |
| 335 | 3300048905 | Ga0496102_0007549 | Ga0496102_0007549_4667_5608 | 310 |
| 336 | 3300048907 | Ga0496104_0001619 | Ga0496104_0001619_13186_14127 | 310 |
| 337 | 3300048908 | Ga0496105_0003397 | Ga0496105_0003397_5694_6635 | 310 |
| 338 | 3300048910 | Ga0496107_0035127 | Ga0496107_0035127_653_1594 | 310 |
| 339 | 3300048911 | Ga0496108_0065778 | Ga0496108_0065778_581_1522 | 310 |
| 340 | 3300048912 | Ga0496109_0136456 | Ga0496109_0136456_504_1445 | 310 |
| 341 | 3300048914 | Ga0496111_0071375 | Ga0496111_0071375_1081_2022 | 310 |
| 342 | 3300048915 | Ga0496112_0376116 | Ga0496112_0376116_173_1114 | 310 |
| 343 | 3300048917 | Ga0496114_0094860 | Ga0496114_0094860_331_1269 | 310 |
| 344 | 3300053088 | Ga0500644_0003211 | Ga0500644_0003211_2026_2964 | 310 |
| 345 | 3300053145 | Ga0500586_044798 | Ga0500586_044798_533_1471 | 310 |
| 346 | 3300053153 | Ga0500616_0011515 | Ga0500616_0011515_1112_2050 | 310 |
| 347 | iso_pu_bacteria | 2599185214 | 2599620677 | 310 |
| 348 | iso_pu_bacteria | 2599185226 | 2599673976 | 310 |
| 349 | iso_pu_bacteria | 2599185227 | 2599678707 | 310 |
| 350 | iso_pu_bacteria | 2599185229 | 2599690188 | 310 |
| 351 | iso_pu_bacteria | 2738541277 | 2738720525 | 310 |
| 352 | iso_pu_bacteria | 2738541307 | 2738884099 | 310 |
| 353 | iso_pu_bacteria | 2738543013 | 2739250197 | 310 |
| 354 | iso_pu_bacteria | 2738543019 | 2739279724 | 310 |
| 355 | iso_pu_bacteria | 2818991446 | 2819601204 | 310 |
| 356 | iso_pu_bacteria | 2831265667 | 2831271475 | 310 |
| 357 | iso_pu_bacteria | 2838054893 | 2838055379 | 310 |
| 358 | iso_pu_bacteria | 2885198086 | 2885201546 | 310 |
| 359 | iso_pu_bacteria | 2885211737 | 2885215743 | 310 |
| 360 | iso_pu_bacteria | 2899924645 | 2899927449 | 310 |
| 361 | iso_pu_bacteria | 2904541872 | 2904548071 | 310 |
| 362 | iso_pu_bacteria | 2928037797 | 2928042639 | 310 |
| 363 | iso_pu_bacteria | 2928044640 | 2928048934 | 310 |
| 364 | iso_pu_bacteria | 2928051484 | 2928055268 | 310 |
| 365 | iso_pu_bacteria | 2928064002 | 2928068696 | 310 |
| 366 | iso_pu_bacteria | 2928070936 | 2928073393 | 310 |
| 367 | iso_pu_bacteria | 2928084124 | 2928090051 | 310 |
| 368 | iso_pu_bacteria | 2929160207 | 2929161534 | 310 |
| 369 | iso_pu_bacteria | 2945909444 | 2945913998 | 310 |
| 370 | iso_pu_bacteria | 2945984333 | 2945990607 | 310 |
| 371 | 3300005295 | Ga0065707_10087081 | Ga0065707_100870815 | 311 |
| 372 | 3300015683 | Ga0183362_10001 | Ga0183362_10001701 | 311 |
| 373 | 3300031456 | Ga0307513_10071296 | Ga0307513_100712963 | 311 |
| 374 | 3300037068 | Ga0373925_0012106 | Ga0373925_0012106_949_1890 | 311 |
| 375 | 3300046516 | Ga0495628_0356895 | Ga0495628_0356895_99_1040 | 311 |
| 376 | 3300001989 | JGI24739J22299_10043806 | JGI24739J22299_100438062 | 312 |
| 377 | 3300003187 | JGI25151J46595_10002493 | JGI25151J46595_100024933 | 312 |
| 378 | 3300003773 | Ga0055537_1001147 | Ga0055537_10011479 | 312 |
| 379 | 3300003784 | Ga0055534_1001199 | Ga0055534_10011999 | 312 |
| 380 | 3300006038 | Ga0075365_10014301 | Ga0075365_100143013 | 312 |
| 381 | 3300006048 | Ga0075363_100015241 | Ga0075363_1000152412 | 312 |
| 382 | 3300006177 | Ga0075362_10029390 | Ga0075362_100293902 | 312 |
| 383 | 3300006178 | Ga0075367_10045095 | Ga0075367_100450952 | 312 |
| 384 | 3300006195 | Ga0075366_10004500 | Ga0075366_100045006 | 312 |
| 385 | 3300006195 | Ga0075366_10020940 | Ga0075366_100209402 | 312 |
| 386 | 3300006353 | Ga0075370_10003110 | Ga0075370_100031102 | 312 |
| 387 | 3300006353 | Ga0075370_10030426 | Ga0075370_100304262 | 312 |
| 388 | 3300006353 | Ga0075370_10036768 | Ga0075370_100367682 | 312 |
| 389 | 3300006946 | Ga0079104_1013872 | Ga0079104_10138722 | 312 |
| 390 | 3300006948 | Ga0099826_10000498 | Ga0099826_100004983 | 312 |
| 391 | 3300017792 | Ga0163161_10045327 | Ga0163161_100453273 | 312 |
| 392 | 3300025258 | Ga0209129_1005353 | Ga0209129_10053535 | 312 |
| 393 | 3300025263 | Ga0209565_1000098 | Ga0209565_100009826 | 312 |
| 394 | 3300025273 | Ga0209673_1000058 | Ga0209673_1000058225 | 312 |
| 395 | 3300025291 | Ga0209675_1000010 | Ga0209675_100001041 | 312 |
| 396 | 3300025294 | Ga0209025_1000194 | Ga0209025_100019435 | 312 |
| 397 | 3300025294 | Ga0209025_1015699 | Ga0209025_10156995 | 312 |
| 398 | 3300025303 | Ga0209051_1000894 | Ga0209051_100089426 | 312 |
| 399 | 3300027666 | Ga0209282_1020331 | Ga0209282_10203312 | 312 |
| 400 | 3300030732 | Ga0316176_1070259 | Ga0316176_10702592 | 312 |
| 401 | 3300030733 | Ga0314311_1074579 | Ga0314311_10745793 | 312 |
| 402 | 3300031548 | Ga0307408_100009802 | Ga0307408_1000098022 | 312 |
| 403 | 3300031901 | Ga0307406_10006015 | Ga0307406_100060155 | 312 |
| 404 | 3300031911 | Ga0307412_10131167 | Ga0307412_101311672 | 312 |
| 405 | 3300042122 | Ga0450920_026994 | Ga0450920_026994_64_1002 | 312 |
| 406 | 3300042145 | Ga0450906_005561 | Ga0450906_005561_564_1502 | 312 |
| 407 | 3300042531 | Ga0450918_010010 | Ga0450918_010010_371_1309 | 312 |
| 408 | 3300046660 | Ga0495625_0000294 | Ga0495625_0000294_73519_74457 | 312 |
| 409 | 3300049759 | Ga0501262_000138 | Ga0501262_000138_6198_7175 | 312 |
| 410 | 3300050490 | nmdc:mga03n38_80013_c1 | nmdc:mga03n38_80013_c1_84_1022 | 312 |
| 411 | 3300050491 | nmdc:mga00v17_64072_c1 | nmdc:mga00v17_64072_c1_125_1063 | 312 |
| 412 | 3300050492 | nmdc:mga0yw44_245496_c1 | nmdc:mga0yw44_245496_c1_211_1149 | 312 |
| 413 | 3300050493 | nmdc:mga0k408_12512_c1 | nmdc:mga0k408_12512_c1_359_1327 | 312 |
| 414 | 3300050493 | nmdc:mga0k408_250046_c1 | nmdc:mga0k408_250046_c1_48_986 | 312 |
| 415 | 3300050496 | nmdc:mga07m45_47327_c1 | nmdc:mga07m45_47327_c1_295_1233 | 312 |
| 416 | 3300050496 | nmdc:mga07m45_966_c2 | nmdc:mga07m45_966_c2_2468_3436 | 312 |
| 417 | 3300053079 | Ga0500610_0072486 | Ga0500610_0072486_667_1605 | 312 |
| 418 | 3300003781 | Ga0055536_1007310 | Ga0055536_10073104 | 313 |
| 419 | 3300003792 | Ga0055540_1003315 | Ga0055540_10033152 | 313 |
| 420 | 3300003794 | Ga0055531_10004533 | Ga0055531_100045337 | 313 |
| 421 | 3300005366 | Ga0070659_100076497 | Ga0070659_1000764972 | 313 |
| 422 | 3300005457 | Ga0070662_100010608 | Ga0070662_1000106084 | 313 |
| 423 | 3300005564 | Ga0070664_100047752 | Ga0070664_1000477522 | 313 |
| 424 | 3300005577 | Ga0068857_100159759 | Ga0068857_1001597592 | 313 |
| 425 | 3300005616 | Ga0068852_100031429 | Ga0068852_1000314294 | 313 |
| 426 | 3300006051 | Ga0075364_10034294 | Ga0075364_100342942 | 313 |
| 427 | 3300006353 | Ga0075370_10190108 | Ga0075370_101901082 | 313 |
| 428 | 3300009036 | Ga0105244_10013907 | Ga0105244_100139073 | 313 |
| 429 | 3300009098 | Ga0105245_10592584 | Ga0105245_105925841 | 313 |
| 430 | 3300009148 | Ga0105243_10097271 | Ga0105243_100972712 | 313 |
| 431 | 3300010375 | Ga0105239_10176307 | Ga0105239_101763072 | 313 |
| 432 | 3300014497 | Ga0182008_10039147 | Ga0182008_100391472 | 313 |
| 433 | 3300015261 | Ga0182006_1012165 | Ga0182006_10121652 | 313 |
| 434 | 3300015262 | Ga0182007_10008063 | Ga0182007_100080633 | 313 |
| 435 | 3300025292 | Ga0209676_1003347 | Ga0209676_10033473 | 313 |
| 436 | 3300025298 | Ga0209050_1000786 | Ga0209050_10007868 | 313 |
| 437 | 3300025303 | Ga0209051_1001079 | Ga0209051_10010793 | 313 |
| 438 | 3300025304 | Ga0209257_1004591 | Ga0209257_10045918 | 313 |
| 439 | 3300025728 | Ga0207655_1003837 | Ga0207655_10038372 | 313 |
| 440 | 3300025927 | Ga0207687_10386795 | Ga0207687_103867952 | 313 |
| 441 | 3300025935 | Ga0207709_10019655 | Ga0207709_100196552 | 313 |
| 442 | 3300025945 | Ga0207679_10267782 | Ga0207679_102677822 | 313 |
| 443 | 3300026041 | Ga0207639_10073052 | Ga0207639_100730523 | 313 |
| 444 | 3300026116 | Ga0207674_10113483 | Ga0207674_101134832 | 313 |
| 445 | 3300026142 | Ga0207698_10565782 | Ga0207698_105657822 | 313 |
| 446 | 3300031456 | Ga0307513_10000029 | Ga0307513_1000002978 | 313 |
| 447 | 3300048919 | Ga0496116_0023802 | Ga0496116_0023802_933_1886 | 313 |
| 448 | 3300048920 | Ga0496117_0010951 | Ga0496117_0010951_2411_3364 | 313 |
| 449 | 3300048921 | Ga0496118_0017904 | Ga0496118_0017904_1840_2793 | 313 |
| 450 | 3300048928 | Ga0496125_0079343 | Ga0496125_0079343_241_1194 | 313 |
| 451 | 3300048928 | Ga0496125_0108402 | Ga0496125_0108402_346_1299 | 313 |
| 452 | 3300050496 | nmdc:mga07m45_210645_c1 | nmdc:mga07m45_210645_c1_153_1106 | 313 |
| 453 | 3300053098 | Ga0500650_0019041 | Ga0500650_0019041_1762_2709 | 313 |
| 454 | 3300053117 | Ga0500593_000984 | Ga0500593_000984_1911_2858 | 313 |
| 455 | 3300053122 | Ga0500608_016963 | Ga0500608_016963_2019_2972 | 313 |
| 456 | 3300053129 | Ga0500628_001932 | Ga0500628_001932_1178_2125 | 313 |
| 457 | 3300001979 | JGI24740J21852_10014995 | JGI24740J21852_100149953 | 314 |
| 458 | 3300001989 | JGI24739J22299_10013835 | JGI24739J22299_100138352 | 314 |
| 459 | 3300002774 | JGI25150J39212_1001865 | JGI25150J39212_10018652 | 314 |
| 460 | 3300002987 | JGI25159J45721_1006802 | JGI25159J45721_10068022 | 314 |
| 461 | 3300002987 | JGI25159J45721_1010765 | JGI25159J45721_10107651 | 314 |
| 462 | 3300003761 | Ga0055535_1000286 | Ga0055535_100028631 | 314 |
| 463 | 3300003762 | Ga0055542_1000080 | Ga0055542_100008031 | 314 |
| 464 | 3300003771 | Ga0055526_1018554 | Ga0055526_10185542 | 314 |
| 465 | 3300003771 | Ga0055526_1020918 | Ga0055526_10209182 | 314 |
| 466 | 3300003773 | Ga0055537_1017345 | Ga0055537_10173451 | 314 |
| 467 | 3300003784 | Ga0055534_1004097 | Ga0055534_10040972 | 314 |
| 468 | 3300003790 | Ga0055528_1036084 | Ga0055528_10360841 | 314 |
| 469 | 3300003791 | Ga0055530_10003765 | Ga0055530_100037652 | 314 |
| 470 | 3300003792 | Ga0055540_1032905 | Ga0055540_10329052 | 314 |
| 471 | 3300004625 | Ga0055543_1003991 | Ga0055543_10039913 | 314 |
| 472 | 3300005262 | Ga0065165_1013931 | Ga0065165_10139311 | 314 |
| 473 | 3300005262 | Ga0065165_1023367 | Ga0065165_10233672 | 314 |
| 474 | 3300005834 | Ga0068851_10008974 | Ga0068851_100089744 | 314 |
| 475 | 3300010375 | Ga0105239_10171788 | Ga0105239_101717882 | 314 |
| 476 | 3300013100 | Ga0157373_10099715 | Ga0157373_100997152 | 314 |
| 477 | 3300013102 | Ga0157371_10029559 | Ga0157371_100295592 | 314 |
| 478 | 3300013104 | Ga0157370_10029709 | Ga0157370_100297093 | 314 |
| 479 | 3300013104 | Ga0157370_10304179 | Ga0157370_103041792 | 314 |
| 480 | 3300013105 | Ga0157369_10102395 | Ga0157369_101023952 | 314 |
| 481 | 3300013307 | Ga0157372_10230769 | Ga0157372_102307692 | 314 |
| 482 | 3300014497 | Ga0182008_10083166 | Ga0182008_100831661 | 314 |
| 483 | 3300017792 | Ga0163161_10005510 | Ga0163161_100055103 | 314 |
| 484 | 3300025208 | Ga0209436_114702 | Ga0209436_1147022 | 314 |
| 485 | 3300025228 | Ga0209672_101674 | Ga0209672_1016745 | 314 |
| 486 | 3300025229 | Ga0209147_100450 | Ga0209147_1004502 | 314 |
| 487 | 3300025242 | Ga0209258_100093 | Ga0209258_10009380 | 314 |
| 488 | 3300025245 | Ga0207425_1000715 | Ga0207425_10007153 | 314 |
| 489 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071047 | 314 |
| 490 | 3300025258 | Ga0209129_1000024 | Ga0209129_100002423 | 314 |
| 491 | 3300025263 | Ga0209565_1000583 | Ga0209565_100058316 | 314 |
| 492 | 3300025263 | Ga0209565_1001746 | Ga0209565_10017463 | 314 |
| 493 | 3300025273 | Ga0209673_1002614 | Ga0209673_10026149 | 314 |
| 494 | 3300025273 | Ga0209673_1002934 | Ga0209673_10029349 | 314 |
| 495 | 3300025284 | Ga0209130_1000757 | Ga0209130_10007572 | 314 |
| 496 | 3300025284 | Ga0209130_1007852 | Ga0209130_10078523 | 314 |
| 497 | 3300025291 | Ga0209675_1006671 | Ga0209675_10066713 | 314 |
| 498 | 3300025291 | Ga0209675_1008554 | Ga0209675_10085542 | 314 |
| 499 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028329 | 314 |
| 500 | 3300025292 | Ga0209676_1000317 | Ga0209676_100031743 | 314 |
| 501 | 3300025294 | Ga0209025_1001526 | Ga0209025_10015263 | 314 |
| 502 | 3300025294 | Ga0209025_1010030 | Ga0209025_10100303 | 314 |
| 503 | 3300025294 | Ga0209025_1019317 | Ga0209025_10193172 | 314 |
| 504 | 3300025295 | Ga0209564_1000344 | Ga0209564_100034477 | 314 |
| 505 | 3300025295 | Ga0209564_1001028 | Ga0209564_100102829 | 314 |
| 506 | 3300025297 | Ga0209758_1000510 | Ga0209758_100051028 | 314 |
| 507 | 3300025297 | Ga0209758_1012342 | Ga0209758_10123424 | 314 |
| 508 | 3300025298 | Ga0209050_1000072 | Ga0209050_100007285 | 314 |
| 509 | 3300025298 | Ga0209050_1006264 | Ga0209050_10062646 | 314 |
| 510 | 3300025299 | Ga0209256_1000151 | Ga0209256_1000151101 | 314 |
| 511 | 3300025299 | Ga0209256_1000256 | Ga0209256_100025616 | 314 |
| 512 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049340 | 314 |
| 513 | 3300025302 | Ga0207426_1000315 | Ga0207426_100031516 | 314 |
| 514 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015258 | 314 |
| 515 | 3300025303 | Ga0209051_1000056 | Ga0209051_1000056142 | 314 |
| 516 | 3300025304 | Ga0209257_1000037 | Ga0209257_1000037487 | 314 |
| 517 | 3300025304 | Ga0209257_1004421 | Ga0209257_10044213 | 314 |
| 518 | 3300025321 | Ga0207656_10001300 | Ga0207656_100013005 | 314 |
| 519 | 3300025949 | Ga0207667_10163905 | Ga0207667_101639052 | 314 |
| 520 | 3300026041 | Ga0207639_10028052 | Ga0207639_100280522 | 314 |
| 521 | 3300031911 | Ga0307412_10107672 | Ga0307412_101076722 | 314 |
| 522 | 3300032002 | Ga0307416_100008180 | Ga0307416_1000081805 | 314 |
| 523 | 3300046453 | Ga0495627_015346 | Ga0495627_015346_253_1209 | 314 |
| 524 | 3300046460 | Ga0495638_0027538 | Ga0495638_0027538_293_1249 | 314 |
| 525 | 3300046513 | Ga0495616_0003991 | Ga0495616_0003991_2098_3054 | 314 |
| 526 | 3300046515 | Ga0495620_0003885 | Ga0495620_0003885_7413_8369 | 314 |
| 527 | 3300046518 | Ga0495631_0003913 | Ga0495631_0003913_4635_5591 | 314 |
| 528 | 3300046520 | Ga0495637_0011511 | Ga0495637_0011511_133_1089 | 314 |
| 529 | 3300046530 | Ga0495654_0029206 | Ga0495654_0029206_349_1305 | 314 |
| 530 | 3300046674 | Ga0495588_0024588 | Ga0495588_0024588_245_1201 | 314 |
| 531 | 3300046674 | Ga0495588_0077703 | Ga0495588_0077703_137_1096 | 314 |
| 532 | 3300046810 | Ga0495660_0037101 | Ga0495660_0037101_46_1002 | 314 |
| 533 | 3300047321 | Ga0495676_0020316 | Ga0495676_0020316_2754_3710 | 314 |
| 534 | 3300047470 | Ga0495681_0040685 | Ga0495681_0040685_727_1683 | 314 |
| 535 | 3300047673 | Ga0495593_0009903 | Ga0495593_0009903_3971_4927 | 314 |
| 536 | 3300048904 | Ga0496101_0257882 | Ga0496101_0257882_300_1256 | 314 |
| 537 | 3300048919 | Ga0496116_0144007 | Ga0496116_0144007_258_1202 | 314 |
| 538 | 3300048921 | Ga0496118_0058254 | Ga0496118_0058254_1578_2522 | 314 |
| 539 | 3300048922 | Ga0496119_0012317 | Ga0496119_0012317_3934_4890 | 314 |
| 540 | 3300048925 | Ga0496122_0083672 | Ga0496122_0083672_174_1130 | 314 |
| 541 | 3300048926 | Ga0496123_0014852 | Ga0496123_0014852_2417_3373 | 314 |
| 542 | 3300048927 | Ga0496124_0093603 | Ga0496124_0093603_20_964 | 314 |
| 543 | 3300048928 | Ga0496125_0052493 | Ga0496125_0052493_1687_2631 | 314 |
| 544 | 3300048929 | Ga0496126_0060332 | Ga0496126_0060332_1694_2650 | 314 |
| 545 | 3300053087 | Ga0500643_017857 | Ga0500643_017857_1023_1979 | 314 |
| 546 | 3300053093 | Ga0500651_0000057 | Ga0500651_0000057_63132_64088 | 314 |
| 547 | 3300053094 | Ga0500566_0099850 | Ga0500566_0099850_203_1159 | 314 |
| 548 | 3300053103 | Ga0500555_038217 | Ga0500555_038217_59_1015 | 314 |
| 549 | 3300053108 | Ga0500562_028761 | Ga0500562_028761_290_1246 | 314 |
| 550 | 3300053110 | Ga0500571_000038 | Ga0500571_000038_35788_36744 | 314 |
| 551 | 3300053117 | Ga0500593_006723 | Ga0500593_006723_1571_2527 | 314 |
| 552 | 3300053118 | Ga0500594_0000390 | Ga0500594_0000390_6820_7776 | 314 |
| 553 | 3300053121 | Ga0500607_005933 | Ga0500607_005933_4531_5487 | 314 |
| 554 | 3300053121 | Ga0500607_039435 | Ga0500607_039435_1339_2295 | 314 |
| 555 | 3300053133 | Ga0500655_001260 | Ga0500655_001260_2087_3043 | 314 |
| 556 | 3300053134 | Ga0500658_0000408 | Ga0500658_0000408_11072_12028 | 314 |
| 557 | 3300053134 | Ga0500658_0001506 | Ga0500658_0001506_6641_7597 | 314 |
| 558 | 3300053136 | Ga0500559_0006861 | Ga0500559_0006861_1082_2038 | 314 |
| 559 | 3300053139 | Ga0500568_0007904 | Ga0500568_0007904_1926_2882 | 314 |
| 560 | 3300053141 | Ga0500574_038913 | Ga0500574_038913_189_1145 | 314 |
| 561 | 3300053158 | Ga0500627_0002652 | Ga0500627_0002652_1551_2507 | 314 |
| 562 | 3300053161 | Ga0500634_0027640 | Ga0500634_0027640_1915_2871 | 314 |
| 563 | 3300053162 | Ga0500638_003779 | Ga0500638_003779_1812_2768 | 314 |
| 564 | 3300053729 | Ga0500625_038758 | Ga0500625_038758_1176_2132 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6swi-assembly1.cif.gz_A | the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus | 0.9359 | 213 | 307 |
| 3oou-assembly1.cif.gz_A | the structure of a protein with unkown function from listeria innocua | 0.9203 | 208 | 307 |
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.9063 | 199 | 312 |
| 3lsg-assembly1.cif.gz_A | the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 | 0.8761 | 199 | 305 |
| 3w6v-assembly1.cif.gz_A | crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna | 0.8753 | 199 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32677_219_275_1.10.10.60 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9742 | 259 | 312 | 1.10.10.60 |
| 3lsgA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9708 | 263 | 305 | 1.10.10.60 |
| 5suwA03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9683 | 250 | 308 | 1.10.10.60 |
| 1d5yD02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9667 | 259 | 306 | 1.10.10.60 |
| 3lsgB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9396 | 262 | 305 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I3UER9-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9696 | 213 | 308 |
GO:0003700
GO:0043565 |
| AF-A0A069SXS9-F1-model_v4 | deleted | 0.968 | 215 | 311 |
|
| AF-A0A1A3SUE6-F1-model_v4 | Transcriptional regulator | 0.9647 | 207 | 307 |
GO:0003700
GO:0043565 |
| AF-A0A2V2E0K2-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9553 | 209 | 311 |
GO:0000160
GO:0003700 GO:0043565 |
| AF-A0A807WU71-F1-model_v4 | deleted | 0.9546 | 201 | 309 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar