F464147

General Info

Members Datasets Scaffolds Average Seq Length
564 363 519 312

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100159759|Ga0068857_1001597592
Length 330
Sequence MRPSLPGLDPRAAMTTSTRKRSIPRQRQPELERDIARSPSLGYEAPETGLVRCLAHGFPSPLVRWHFHEDYELHLITETSGKAFIGDWIGPFQPGHLVLCGPRLPHNWISLDVPEGGAAGRDRVIQFRHEPIEHAAAEIPELREVMQLLERARHGIEFFGMSQQAQTHWDAIKAARGVRRLGRFLECMADLAQCTDYRLLSSVQMQGAQGIEGDAQVDQINDIVNRITSNMAESISMSDVAAELGMSESRFSRFFRRSTGNSFTDFVNRVRINSACHLLMQTDHYVTDICYQVGFNNVANFNRRFLEIKGMTPSEFRKQADTRFGGGISS

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2643221683 Variovorax sp. Root473 Isolate Unclassified
11 2721755523 Delftia sp. HK171 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543013 Variovorax sp. BT01 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2831864461 Roseateles noduli HZ7 Isolate Nodule
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842747753 Variovorax sp. R-72060 Isolate Unclassified
23 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
24 2885198086 Variovorax sp. 679 Isolate Unclassified
25 2885211737 Variovorax sp. 553 Isolate Unclassified
26 2899924645 Variovorax sp. 369 Isolate Unclassified
27 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
28 2904456579 Variovorax sp. 2002 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
32 2928037797 Variovorax sp. 1126 Isolate Unclassified
33 2928044640 Variovorax sp. 1128 Isolate Unclassified
34 2928051484 Variovorax sp. 1133 Isolate Unclassified
35 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
36 2928070936 Variovorax gossypii 1167 Isolate Unclassified
37 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
38 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
39 2929520902 Variovorax beijingensis 502 Isolate Unclassified
40 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
41 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
44 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
48 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
216 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
217 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
246 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
247 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
248 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
252 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
255 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
287 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
288 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
326 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
337 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
338 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
339 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
345 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
349 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
350 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
361 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
362 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
363 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0
Isolates 7.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.96
Nodule 1.24
Rhizoplane 3.37
Rhizosphere 53.72
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014995 3300001979 Bacteria 2842
2 JGI24739J22299_10013835 3300001989 Bacteria 2940
3 JGI24739J22299_10043806 3300001989 Bacteria 1477
4 JGI25154J39366_1001254 3300002738 Bacteria 9533
5 JGI25157J39369_1000199 3300002741 Bacteria 50810
6 JGI25150J39212_1001865 3300002774 Bacteria 5556
7 JGI25159J45721_1006802 3300002987 Bacteria 3364
8 JGI25159J45721_1010765 3300002987 Bacteria 2301
9 JGI25159J45721_1011127 3300002987 Bacteria 2230
10 JGI25151J46595_10002493 3300003187 Bacteria 10995
11 rootL2_10062417 3300003322 Bacteria 1555
12 Ga0055535_1000286 3300003761 Bacteria 53400
13 Ga0055542_1000080 3300003762 Bacteria 129634
14 Ga0055526_1006456 3300003771 Bacteria 6359
15 Ga0055526_1018554 3300003771 Bacteria 2590
16 Ga0055526_1020918 3300003771 Bacteria 2301
17 Ga0055537_1001147 3300003773 Bacteria 11333
18 Ga0055537_1017345 3300003773 Bacteria 1187
19 Ga0055536_1007310 3300003781 Bacteria 4967
20 Ga0055534_1001199 3300003784 Bacteria 10910
21 Ga0055534_1004097 3300003784 Bacteria 4345
22 Ga0055534_1008457 3300003784 Bacteria 2329
23 Ga0055528_1036084 3300003790 Bacteria 1187
24 Ga0055530_10003765 3300003791 Bacteria 8370
25 Ga0055540_1003315 3300003792 Bacteria 7848
26 Ga0055540_1032905 3300003792 Bacteria 1179
27 Ga0055531_10004533 3300003794 Bacteria 8426
28 Ga0055543_1001804 3300004625 Bacteria 7901
29 Ga0055543_1003991 3300004625 Bacteria 4148
30 Ga0065165_1001023 3300005262 Bacteria 33959
31 Ga0065165_1013931 3300005262 Bacteria 3154
32 Ga0065165_1023367 3300005262 Bacteria 2098
33 Ga0065707_10087081 3300005295 Bacteria 5175
34 Ga0070676_10296232 3300005328 Bacteria 1095
35 Ga0070683_100202003 3300005329 Bacteria 1887
36 Ga0070683_100311895 3300005329 Bacteria 1497
37 Ga0070690_100024000 3300005330 Bacteria 3747
38 Ga0068869_100297623 3300005334 Bacteria 1302
39 Ga0068868_100322084 3300005338 Bacteria 1317
40 Ga0070660_100025146 3300005339 Bacteria 4424
41 Ga0070661_100129704 3300005344 Bacteria 1893
42 Ga0070675_100133034 3300005354 Bacteria 2121
43 Ga0070674_100122233 3300005356 Bacteria 1929
44 Ga0070674_100264122 3300005356 Bacteria 1357
45 Ga0070673_100093450 3300005364 Bacteria 2463
46 Ga0070659_100076497 3300005366 Bacteria 2669
47 Ga0070667_100036966 3300005367 Bacteria 4094
48 Ga0070667_100141980 3300005367 Bacteria 2104
49 Ga0070678_100025246 3300005456 Bacteria 3994
50 Ga0070662_100010608 3300005457 Bacteria 6057
51 Ga0070662_100112514 3300005457 Bacteria 2076
52 Ga0068867_100004283 3300005459 Bacteria 10043
53 Ga0070685_10115033 3300005466 Bacteria 1663
54 Ga0070706_100000388 3300005467 Bacteria 52771
55 Ga0070707_100071369 3300005468 Bacteria 3346
56 Ga0070698_100421808 3300005471 Bacteria 1269
57 Ga0070684_100404125 3300005535 Bacteria 1259
58 Ga0070665_100016667 3300005548 Bacteria 7363
59 Ga0070665_100155233 3300005548 Bacteria 2291
60 Ga0068855_100019384 3300005563 Bacteria 8173
61 Ga0068855_100391845 3300005563 Bacteria 1523
62 Ga0070664_100003941 3300005564 Bacteria 11968
63 Ga0070664_100047752 3300005564 Bacteria 3617
64 Ga0070664_100443559 3300005564 Bacteria 1191
65 Ga0068857_100000643 3300005577 Bacteria 25778
66 Ga0068857_100159759 3300005577 Bacteria 2044
67 Ga0068854_100018408 3300005578 Bacteria 4688
68 Ga0068856_100011642 3300005614 Bacteria 8532
69 Ga0068852_100026629 3300005616 Bacteria 4704
70 Ga0068852_100031429 3300005616 Bacteria 4381
71 Ga0068859_100039119 3300005617 Bacteria 4757
72 Ga0068859_100264579 3300005617 Bacteria 1811
73 Ga0068859_100796317 3300005617 Bacteria 1033
74 Ga0068866_10039101 3300005718 Bacteria 2341
75 Ga0068861_100003803 3300005719 Bacteria 10080
76 Ga0068861_100020935 3300005719 Bacteria 4694
77 Ga0068851_10008974 3300005834 Bacteria 4638
78 Ga0068870_10208328 3300005840 Bacteria 1189
79 Ga0068863_100329760 3300005841 Bacteria 1484
80 Ga0068863_100368200 3300005841 Bacteria 1402
81 Ga0068860_100019424 3300005843 Bacteria 6590
82 Ga0068860_100201055 3300005843 Bacteria 1931
83 Ga0068860_100625975 3300005843 Bacteria 1083
84 Ga0068862_100027196 3300005844 Bacteria 4814
85 Ga0068862_100050422 3300005844 Bacteria 3557
86 Ga0068862_100061092 3300005844 Bacteria 3239
87 Ga0075365_10014301 3300006038 Bacteria 4772
88 Ga0075368_10074386 3300006042 Bacteria 1376
89 Ga0075368_10086232 3300006042 Bacteria 1281
90 Ga0075363_100015241 3300006048 Bacteria 3775
91 Ga0075363_100021061 3300006048 Bacteria 3278
92 Ga0075364_10034294 3300006051 Bacteria 3273
93 Ga0075362_10024734 3300006177 Bacteria 2550
94 Ga0075362_10029390 3300006177 Bacteria 2368
95 Ga0075362_10035780 3300006177 Bacteria 2169
96 Ga0075367_10018219 3300006178 Bacteria 3870
97 Ga0075367_10045095 3300006178 Bacteria 2587
98 Ga0075367_10059629 3300006178 Bacteria 2273
99 Ga0075366_10002902 3300006195 Bacteria 8904
100 Ga0075366_10004500 3300006195 Bacteria 7478
101 Ga0075366_10005751 3300006195 Bacteria 6732
102 Ga0075366_10013970 3300006195 Bacteria 4580
103 Ga0075366_10020940 3300006195 Bacteria 3799
104 Ga0075366_10025007 3300006195 Bacteria 3485
105 Ga0075366_10026682 3300006195 Bacteria 3384
106 Ga0075370_10000635 3300006353 Bacteria 13598
107 Ga0075370_10003110 3300006353 Bacteria 7834
108 Ga0075370_10004190 3300006353 Bacteria 6962
109 Ga0075370_10023580 3300006353 Bacteria 3390
110 Ga0075370_10030426 3300006353 Bacteria 3012
111 Ga0075370_10036768 3300006353 Bacteria 2751
112 Ga0075370_10049246 3300006353 Bacteria 2388
113 Ga0075370_10100417 3300006353 Bacteria 1674
114 Ga0075370_10190108 3300006353 Bacteria 1210
115 Ga0068865_100012454 3300006881 Bacteria 5353
116 Ga0068865_100134829 3300006881 Bacteria 1854
117 Ga0097620_100039122 3300006931 Bacteria 4757
118 Ga0097620_100264589 3300006931 Bacteria 1811
119 Ga0097620_100796298 3300006931 Bacteria 1033
120 Ga0079104_1000016 3300006946 Bacteria 313865
121 Ga0079104_1013872 3300006946 Bacteria 2462
122 Ga0099826_10000498 3300006948 Bacteria 19180
123 Ga0105244_10013907 3300009036 Bacteria 4675
124 Ga0105250_10001094 3300009092 Bacteria 15299
125 Ga0105240_10076158 3300009093 Bacteria 4137
126 Ga0105240_10308219 3300009093 Bacteria 1809
127 Ga0105245_10098769 3300009098 Bacteria 2698
128 Ga0105245_10136482 3300009098 Bacteria 2306
129 Ga0105245_10227316 3300009098 Bacteria 1803
130 Ga0105245_10592584 3300009098 Bacteria 1134
131 Ga0114129_10025979 3300009147 Bacteria 8293
132 Ga0105243_10005637 3300009148 Bacteria 9747
133 Ga0105243_10007314 3300009148 Bacteria 8491
134 Ga0105243_10097271 3300009148 Bacteria 2436
135 Ga0105243_10128360 3300009148 Bacteria 2148
136 Ga0105242_10047066 3300009176 Bacteria 3501
137 Ga0105242_10235149 3300009176 Bacteria 1644
138 Ga0105237_10037619 3300009545 Bacteria 4889
139 Ga0105237_10048563 3300009545 Bacteria 4266
140 Ga0105237_10313130 3300009545 Bacteria 1573
141 Ga0105238_10120658 3300009551 Bacteria 2601
142 Ga0105249_10337813 3300009553 Bacteria 1522
143 Ga0105239_10013427 3300010375 Bacteria 9100
144 Ga0105239_10171788 3300010375 Bacteria 2424
145 Ga0105239_10176307 3300010375 Bacteria 2391
146 Ga0157373_10099715 3300013100 Bacteria 2044
147 Ga0157371_10029559 3300013102 Bacteria 3961
148 Ga0157370_10029709 3300013104 Bacteria 5360
149 Ga0157370_10304179 3300013104 Bacteria 1472
150 Ga0157369_10080034 3300013105 Bacteria 3499
151 Ga0157369_10102395 3300013105 Bacteria 3052
152 Ga0157378_10015862 3300013297 Bacteria 6597
153 Ga0157378_10146509 3300013297 Bacteria 2197
154 Ga0163162_10721334 3300013306 Bacteria 1118
155 Ga0157372_10172260 3300013307 Bacteria 2504
156 Ga0157372_10230769 3300013307 Bacteria 2146
157 Ga0157375_10014275 3300013308 Bacteria 7081
158 Ga0157375_10126005 3300013308 Bacteria 2676
159 Ga0157375_10382629 3300013308 Bacteria 1574
160 Ga0157375_10524596 3300013308 Bacteria 1347
161 Ga0182008_10001323 3300014497 Bacteria 16876
162 Ga0182008_10001893 3300014497 Bacteria 13569
163 Ga0182008_10039147 3300014497 Bacteria 2370
164 Ga0182008_10083166 3300014497 Bacteria 1576
165 Ga0157379_10199818 3300014968 Bacteria 1808
166 Ga0182006_1012165 3300015261 Bacteria 3769
167 Ga0182007_10008063 3300015262 Bacteria 4351
168 Ga0183362_10001 3300015683 Bacteria 2046624
169 Ga0163161_10005510 3300017792 Bacteria 8773
170 Ga0163161_10045327 3300017792 Bacteria 3171
171 Ga0163161_10046136 3300017792 Bacteria 3143
172 Ga0213872_10085291 3300021361 Bacteria 1416
173 Ga0213876_10178945 3300021384 Bacteria 1128
174 Ga0209436_114702 3300025208 Bacteria 1237
175 Ga0209674_100064 3300025226 Bacteria 265769
176 Ga0209672_101674 3300025228 Bacteria 7189
177 Ga0209147_100450 3300025229 Bacteria 25862
178 Ga0209563_100099 3300025230 Bacteria 153336
179 Ga0207427_100844 3300025231 Bacteria 13690
180 Ga0209258_100093 3300025242 Bacteria 223559
181 Ga0209258_100453 3300025242 Bacteria 45277
182 Ga0209258_100808 3300025242 Bacteria 18236
183 Ga0207425_1000715 3300025245 Bacteria 17861
184 Ga0209646_1000060 3300025246 Bacteria 256386
185 Ga0209026_1000049 3300025250 Bacteria 255273
186 Ga0209677_100954 3300025253 Bacteria 14070
187 Ga0209677_102445 3300025253 Bacteria 6985
188 Ga0209677_104629 3300025253 Bacteria 3886
189 Ga0209148_1000007 3300025254 Bacteria 1592273
190 Ga0209148_1007934 3300025254 Bacteria 2166
191 Ga0209759_1000272 3300025256 Bacteria 73495
192 Ga0209129_1000024 3300025258 Bacteria 417268
193 Ga0209129_1005353 3300025258 Bacteria 4578
194 Ga0209565_1000098 3300025263 Bacteria 132021
195 Ga0209565_1000583 3300025263 Bacteria 24687
196 Ga0209565_1001746 3300025263 Bacteria 8869
197 Ga0209455_1000157 3300025272 Bacteria 119719
198 Ga0209673_1000058 3300025273 Bacteria 269028
199 Ga0209673_1002614 3300025273 Bacteria 12098
200 Ga0209673_1002934 3300025273 Bacteria 10732
201 Ga0209673_1020420 3300025273 Bacteria 2346
202 Ga0209130_1000757 3300025284 Bacteria 28010
203 Ga0209130_1002913 3300025284 Bacteria 7846
204 Ga0209130_1007852 3300025284 Bacteria 3231
205 Ga0209675_1000010 3300025291 Bacteria 541927
206 Ga0209675_1006671 3300025291 Bacteria 4582
207 Ga0209675_1008554 3300025291 Bacteria 3741
208 Ga0209675_1008940 3300025291 Bacteria 3601
209 Ga0209676_1000028 3300025292 Bacteria 559745
210 Ga0209676_1000317 3300025292 Bacteria 94105
211 Ga0209676_1000367 3300025292 Bacteria 84271
212 Ga0209676_1003347 3300025292 Bacteria 9998
213 Ga0209676_1020966 3300025292 Bacteria 2204
214 Ga0209025_1000194 3300025294 Bacteria 148593
215 Ga0209025_1001452 3300025294 Bacteria 31103
216 Ga0209025_1001526 3300025294 Bacteria 29626
217 Ga0209025_1010030 3300025294 Bacteria 6486
218 Ga0209025_1015699 3300025294 Bacteria 4540
219 Ga0209025_1019317 3300025294 Bacteria 3794
220 Ga0209564_1000008 3300025295 Bacteria 953227
221 Ga0209564_1000344 3300025295 Bacteria 88136
222 Ga0209564_1001028 3300025295 Bacteria 34353
223 Ga0209758_1000510 3300025297 Bacteria 62591
224 Ga0209758_1012342 3300025297 Bacteria 4793
225 Ga0209050_1000072 3300025298 Bacteria 293619
226 Ga0209050_1000786 3300025298 Bacteria 45131
227 Ga0209050_1006264 3300025298 Bacteria 7124
228 Ga0209256_1000151 3300025299 Bacteria 145299
229 Ga0209256_1000256 3300025299 Bacteria 94699
230 Ga0207426_1000049 3300025302 Bacteria 401954
231 Ga0207426_1000315 3300025302 Bacteria 94699
232 Ga0209051_1000015 3300025303 Bacteria 546798
233 Ga0209051_1000056 3300025303 Bacteria 271616
234 Ga0209051_1000894 3300025303 Bacteria 29840
235 Ga0209051_1001079 3300025303 Bacteria 25303
236 Ga0209051_1001096 3300025303 Bacteria 24968
237 Ga0209257_1000037 3300025304 Bacteria 612915
238 Ga0209257_1004421 3300025304 Bacteria 10909
239 Ga0209257_1004591 3300025304 Bacteria 10527
240 Ga0209257_1011962 3300025304 Bacteria 4087
241 Ga0207656_10001300 3300025321 Bacteria 8211
242 Ga0207696_1016135 3300025711 Bacteria 2507
243 Ga0207655_1003837 3300025728 Bacteria 10952
244 Ga0207645_10238765 3300025907 Bacteria 1200
245 Ga0207643_10181400 3300025908 Bacteria 1274
246 Ga0207705_10144464 3300025909 Bacteria 1779
247 Ga0207684_10006285 3300025910 Bacteria 10836
248 Ga0207654_10100393 3300025911 Bacteria 1782
249 Ga0207695_10073418 3300025913 Bacteria 3486
250 Ga0207695_10085364 3300025913 Bacteria 3186
251 Ga0207695_10238069 3300025913 Bacteria 1722
252 Ga0207671_10030763 3300025914 Bacteria 4001
253 Ga0207671_10102589 3300025914 Bacteria 2168
254 Ga0207649_10199262 3300025920 Bacteria 1413
255 Ga0207646_10044087 3300025922 Bacteria 4004
256 Ga0207687_10058118 3300025927 Bacteria 2720
257 Ga0207687_10144215 3300025927 Bacteria 1810
258 Ga0207687_10386795 3300025927 Bacteria 1147
259 Ga0207644_10137219 3300025931 Bacteria 1880
260 Ga0207690_10016847 3300025932 Bacteria 4453
261 Ga0207706_10006170 3300025933 Bacteria 11129
262 Ga0207686_10047616 3300025934 Bacteria 2651
263 Ga0207686_10118135 3300025934 Bacteria 1800
264 Ga0207709_10000117 3300025935 Bacteria 122667
265 Ga0207709_10000587 3300025935 Bacteria 30442
266 Ga0207709_10019655 3300025935 Bacteria 3801
267 Ga0207669_10101506 3300025937 Bacteria 1903
268 Ga0207669_10296435 3300025937 Bacteria 1227
269 Ga0207704_10032479 3300025938 Bacteria 2955
270 Ga0207691_10051737 3300025940 Bacteria 3754
271 Ga0207711_10264924 3300025941 Bacteria 1580
272 Ga0207689_10051455 3300025942 Bacteria 3396
273 Ga0207689_10094734 3300025942 Bacteria 2452
274 Ga0207689_10183674 3300025942 Bacteria 1725
275 Ga0207689_10325431 3300025942 Bacteria 1276
276 Ga0207661_10175879 3300025944 Bacteria 1866
277 Ga0207679_10154489 3300025945 Bacteria 1872
278 Ga0207679_10267782 3300025945 Bacteria 1460
279 Ga0207667_10104617 3300025949 Bacteria 2920
280 Ga0207667_10163905 3300025949 Bacteria 2286
281 Ga0207667_10527990 3300025949 Bacteria 1195
282 Ga0207651_10095847 3300025960 Bacteria 2186
283 Ga0207712_10466021 3300025961 Bacteria 1074
284 Ga0207658_10049045 3300025986 Bacteria 3100
285 Ga0207658_10214692 3300025986 Bacteria 1615
286 Ga0207677_10052699 3300026023 Bacteria 2765
287 Ga0207677_10203707 3300026023 Bacteria 1575
288 Ga0207677_10353751 3300026023 Bacteria 1232
289 Ga0207703_10450961 3300026035 Bacteria 1201
290 Ga0207639_10028052 3300026041 Bacteria 4106
291 Ga0207639_10073052 3300026041 Bacteria 2688
292 Ga0207678_10020544 3300026067 Bacteria 5789
293 Ga0207678_10225758 3300026067 Bacteria 1603
294 Ga0207702_10003218 3300026078 Bacteria 15082
295 Ga0207648_10008269 3300026089 Bacteria 10104
296 Ga0207648_10028772 3300026089 Bacteria 4926
297 Ga0207648_10119908 3300026089 Bacteria 2313
298 Ga0207674_10001652 3300026116 Bacteria 28693
299 Ga0207674_10113483 3300026116 Bacteria 2683
300 Ga0207675_100009803 3300026118 Bacteria 8966
301 Ga0207675_100080204 3300026118 Bacteria 3060
302 Ga0207683_10050234 3300026121 Bacteria 3652
303 Ga0207683_10088143 3300026121 Bacteria 2761
304 Ga0207698_10035164 3300026142 Bacteria 3662
305 Ga0207698_10565782 3300026142 Bacteria 1116
306 Ga0209281_1000017 3300027111 Bacteria 583251
307 Ga0209970_1000287 3300027614 Bacteria 8341
308 Ga0209282_1020331 3300027666 Bacteria 4206
309 Ga0268266_10062898 3300028379 Bacteria 3204
310 Ga0268265_10026776 3300028380 Bacteria 4105
311 Ga0268264_10372947 3300028381 Bacteria 1364
312 Ga0268264_10388760 3300028381 Bacteria 1338
313 Ga0265336_10000040 3300028666 Bacteria 138266
314 Ga0307515_10000137 3300028794 Bacteria 173516
315 Ga0307515_10000221 3300028794 Bacteria 141099
316 Ga0307515_10000777 3300028794 Bacteria 73454
317 Ga0307515_10070037 3300028794 Bacteria 4781
318 Ga0307515_10108747 3300028794 Bacteria 3263
319 Ga0265324_10001932 3300029957 Bacteria 11118
320 Ga0316176_1070259 3300030732 Bacteria 1599
321 Ga0314311_1074579 3300030733 Bacteria 5783
322 Ga0265327_10000640 3300031251 Bacteria 56812
323 Ga0265327_10008506 3300031251 Bacteria 7629
324 Ga0307513_10000029 3300031456 Bacteria 191823
325 Ga0307513_10001667 3300031456 Bacteria 31752
326 Ga0307513_10071296 3300031456 Bacteria 3627
327 Ga0307513_10074508 3300031456 Bacteria 3529
328 Ga0307509_10169074 3300031507 Bacteria 2069
329 Ga0307408_100000246 3300031548 Bacteria 56179
330 Ga0307408_100009802 3300031548 Bacteria 6314
331 Ga0307508_10000141 3300031616 Bacteria 85739
332 Ga0307508_10238600 3300031616 Bacteria 1416
333 Ga0307514_10035594 3300031649 Bacteria 3962
334 Ga0307514_10200284 3300031649 Bacteria 1256
335 Ga0307516_10000155 3300031730 Bacteria 85605
336 Ga0307516_10001176 3300031730 Bacteria 36553
337 Ga0307516_10001709 3300031730 Bacteria 30164
338 Ga0307516_10004703 3300031730 Bacteria 16697
339 Ga0307405_10009141 3300031731 Bacteria 5069
340 Ga0307405_10112474 3300031731 Bacteria 1847
341 Ga0307405_10128723 3300031731 Bacteria 1745
342 Ga0307406_10001082 3300031901 Bacteria 15165
343 Ga0307406_10006015 3300031901 Bacteria 6662
344 Ga0307412_10107672 3300031911 Bacteria 1984
345 Ga0307412_10131167 3300031911 Bacteria 1820
346 Ga0307412_10155167 3300031911 Bacteria 1694
347 Ga0307412_10383535 3300031911 Bacteria 1139
348 Ga0307416_100008180 3300032002 Bacteria 6723
349 Ga0307416_100088462 3300032002 Bacteria 2648
350 Ga0307416_100376310 3300032002 Bacteria 1448
351 Ga0307507_10094543 3300033179 Bacteria 2540
352 Ga0373944_0045699 3300035089 Bacteria 1367
353 Ga0373931_0008810 3300035691 Bacteria 4800
354 Ga0373937_0044882 3300036401 Bacteria 4038
355 Ga0373925_0012106 3300037068 Bacteria 6244
356 Ga0395898_0140581 3300037466 Bacteria 2311
357 Ga0395905_0004450 3300037471 Bacteria 14564
358 Ga0395901_0010895 3300038443 Bacteria 9215
359 Ga0436365_0179555 3300039437 Bacteria 1326
360 Ga0436361_0064311 3300039447 Bacteria 6486
361 Ga0436361_0276783 3300039447 Bacteria 2279
362 Ga0436361_0691237 3300039447 Bacteria 8011
363 Ga0436361_1092231 3300039447 Bacteria 4132
364 Ga0439439_0001487 3300041406 Bacteria 4686
365 Ga0439439_0017146 3300041406 Bacteria 1778
366 Ga0451793_1648312 3300041452 Bacteria 2658
367 Ga0451802_2098710 3300041460 Bacteria 1597
368 Ga0451807_0108644 3300041486 Bacteria 1601
369 Ga0451853_3940933 3300041512 Bacteria 1038
370 Ga0439431_0016587 3300041997 Bacteria 1725
371 Ga0439431_0043738 3300041997 Bacteria 1147
372 Ga0439433_0004117 3300041999 Bacteria 3127
373 Ga0439442_001303 3300042002 Bacteria 4959
374 Ga0439445_0003027 3300042004 Bacteria 3764
375 Ga0439432_028680 3300042006 Bacteria 1812
376 Ga0439449_0000254 3300042007 Bacteria 19110
377 Ga0439449_0006594 3300042007 Bacteria 4438
378 Ga0439462_0022952 3300042015 Bacteria 1634
379 Ga0450920_026994 3300042122 Bacteria 1122
380 Ga0450906_001491 3300042145 Bacteria 5106
381 Ga0450906_005561 3300042145 Bacteria 2584
382 Ga0439434_0005516 3300042435 Bacteria 3696
383 Ga0439434_0009062 3300042435 Bacteria 2925
384 Ga0450918_010010 3300042531 Bacteria 1656
385 Ga0450893_0002594 3300042532 Bacteria 2826
386 Ga0466969_0004140 3300044656 Bacteria 7700
387 Ga0466972_0001854 3300044658 Bacteria 10359
388 Ga0466972_0079632 3300044658 Bacteria 1560
389 Ga0453683_0001704 3300044673 Bacteria 18282
390 Ga0466965_0024200 3300044683 Bacteria 2935
391 Ga0466966_0083702 3300044684 Bacteria 1984
392 Ga0466961_0038822 3300044693 Bacteria 3053
393 Ga0466964_0005324 3300044706 Bacteria 4777
394 Ga0453684_0384314 3300044712 Bacteria 1576
395 Ga0466971_0038951 3300044719 Bacteria 2133
396 Ga0466968_0048165 3300044735 Bacteria 1813
397 Ga0466970_0022480 3300044765 Bacteria 3291
398 Ga0466957_0037756 3300044842 Bacteria 2908
399 Ga0466960_0034753 3300044901 Bacteria 2352
400 Ga0466959_0009180 3300045049 Bacteria 7023
401 Ga0451576_0005405 3300045051 Bacteria 16037
402 Ga0466958_0008426 3300045836 Bacteria 5717
403 Ga0495627_015346 3300046453 Bacteria 2646
404 Ga0495592_0297626 3300046454 Bacteria 1050
405 Ga0495629_0084603 3300046459 Bacteria 2213
406 Ga0495638_0027538 3300046460 Bacteria 3678
407 Ga0495651_0149998 3300046462 Bacteria 1682
408 Ga0495650_0063482 3300046471 Bacteria 1472
409 Ga0495580_0082501 3300046472 Bacteria 2241
410 Ga0495639_0010835 3300046475 Bacteria 3927
411 Ga0495585_0069617 3300046492 Bacteria 1920
412 Ga0495606_0008149 3300046507 Bacteria 9177
413 Ga0495608_0099213 3300046511 Bacteria 1879
414 Ga0495616_0003991 3300046513 Bacteria 9382
415 Ga0495620_0003885 3300046515 Bacteria 8525
416 Ga0495628_0235432 3300046516 Bacteria 1371
417 Ga0495628_0356895 3300046516 Bacteria 1074
418 Ga0495631_0003913 3300046518 Bacteria 8043
419 Ga0495632_0039077 3300046519 Bacteria 2398
420 Ga0495637_0011511 3300046520 Bacteria 4247
421 Ga0495642_0047257 3300046528 Bacteria 1762
422 Ga0495652_0258746 3300046529 Bacteria 1286
423 Ga0495654_0029206 3300046530 Bacteria 2812
424 Ga0495586_0119700 3300046535 Bacteria 1470
425 Ga0495621_0013009 3300046539 Bacteria 2608
426 Ga0495656_0000114 3300046615 Bacteria 31389
427 Ga0495668_0033715 3300046616 Bacteria 2875
428 Ga0495625_0000294 3300046660 Bacteria 77321
429 Ga0495625_0008695 3300046660 Bacteria 8621
430 Ga0495588_0024588 3300046674 Bacteria 2993
431 Ga0495588_0077703 3300046674 Bacteria 1731
432 Ga0495647_0005004 3300046681 Bacteria 4339
433 Ga0495649_0000270 3300046694 Bacteria 46170
434 Ga0495589_0026302 3300046794 Bacteria 2949
435 Ga0495660_0037101 3300046810 Bacteria 2716
436 Ga0495676_0020316 3300047321 Bacteria 5830
437 Ga0495681_0040685 3300047470 Bacteria 2262
438 Ga0495593_0009903 3300047673 Bacteria 5527
439 Ga0496100_0029685 3300048903 Bacteria 3384
440 Ga0496101_0003936 3300048904 Bacteria 9282
441 Ga0496101_0257882 3300048904 Bacteria 1359
442 Ga0496102_0007549 3300048905 Bacteria 9296
443 Ga0496102_0021838 3300048905 Bacteria 5665
444 Ga0496104_0001619 3300048907 Bacteria 19424
445 Ga0496105_0003397 3300048908 Bacteria 11774
446 Ga0496107_0035127 3300048910 Bacteria 3594
447 Ga0496108_0065778 3300048911 Bacteria 3056
448 Ga0496109_0136456 3300048912 Bacteria 2292
449 Ga0496111_0071375 3300048914 Bacteria 2527
450 Ga0496112_0376116 3300048915 Bacteria 1362
451 Ga0496114_0094860 3300048917 Bacteria 2538
452 Ga0496116_0023802 3300048919 Bacteria 4551
453 Ga0496116_0144007 3300048919 Bacteria 1335
454 Ga0496117_0010951 3300048920 Bacteria 8173
455 Ga0496118_0017904 3300048921 Bacteria 6426
456 Ga0496118_0058254 3300048921 Bacteria 2888
457 Ga0496119_0012317 3300048922 Bacteria 6962
458 Ga0496122_0083672 3300048925 Bacteria 2211
459 Ga0496123_0014852 3300048926 Bacteria 6427
460 Ga0496124_0093603 3300048927 Bacteria 2445
461 Ga0496125_0052493 3300048928 Bacteria 3352
462 Ga0496125_0079343 3300048928 Bacteria 2519
463 Ga0496125_0108402 3300048928 Bacteria 2020
464 Ga0496126_0060332 3300048929 Bacteria 3412
465 Ga0501262_000138 3300049759 Bacteria 9065
466 Ga0501265_004384 3300049762 Bacteria 1606
467 nmdc:mga03n38_80013_c1 3300050490 Bacteria 1534
468 nmdc:mga00v17_64072_c1 3300050491 Bacteria 2265
469 nmdc:mga0yw44_245496_c1 3300050492 Bacteria 1191
470 nmdc:mga0k408_12512_c1 3300050493 Bacteria 4639
471 nmdc:mga0k408_19510_c1 3300050493 Bacteria 3790
472 nmdc:mga0k408_250046_c1 3300050493 Bacteria 1059
473 nmdc:mga0k408_32098_c1 3300050493 Bacteria 3000
474 nmdc:mga0k408_66920_c1 3300050493 Bacteria 2093
475 nmdc:mga06z11_83836_c1 3300050494 Bacteria 1716
476 nmdc:mga06z11_8825_c1 3300050494 Bacteria 4222
477 nmdc:mga07m45_125706_c1 3300050496 Bacteria 1483
478 nmdc:mga07m45_141133_c1 3300050496 Bacteria 1395
479 nmdc:mga07m45_210645_c1 3300050496 Bacteria 1131
480 nmdc:mga07m45_37567_c1 3300050496 Bacteria 2701
481 nmdc:mga07m45_47327_c1 3300050496 Bacteria 2418
482 nmdc:mga07m45_5751_c1 3300050496 Bacteria 6205
483 nmdc:mga07m45_966_c2 3300050496 Bacteria 8224
484 nmdc:mga05p37_42453_c1 3300050507 Bacteria 5587
485 nmdc:mga0sz30_112190_c1 3300050516 Bacteria 1195
486 Ga0495601_0111487 3300053077 Bacteria 1772
487 Ga0500610_0072486 3300053079 Bacteria 1796
488 Ga0500635_0000243 3300053080 Bacteria 23803
489 Ga0500643_017857 3300053087 Bacteria 2365
490 Ga0500644_0003211 3300053088 Bacteria 4045
491 Ga0500651_0000057 3300053093 Bacteria 72615
492 Ga0500566_0099850 3300053094 Bacteria 1593
493 Ga0500650_0019041 3300053098 Bacteria 2989
494 Ga0500555_038217 3300053103 Bacteria 1343
495 Ga0500562_028761 3300053108 Bacteria 1461
496 Ga0500571_000038 3300053110 Bacteria 41284
497 Ga0500593_000984 3300053117 Bacteria 10398
498 Ga0500593_006723 3300053117 Bacteria 4618
499 Ga0500594_0000390 3300053118 Bacteria 9816
500 Ga0500607_005933 3300053121 Bacteria 7854
501 Ga0500607_039435 3300053121 Bacteria 2564
502 Ga0500608_016963 3300053122 Bacteria 3300
503 Ga0500628_001932 3300053129 Bacteria 3485
504 Ga0500655_001260 3300053133 Bacteria 4809
505 Ga0500658_0000408 3300053134 Bacteria 18668
506 Ga0500658_0001506 3300053134 Bacteria 9333
507 Ga0500658_0015246 3300053134 Bacteria 2851
508 Ga0500559_0006861 3300053136 Bacteria 5103
509 Ga0500568_0007904 3300053139 Bacteria 5176
510 Ga0500574_038913 3300053141 Bacteria 1318
511 Ga0500586_044798 3300053145 Bacteria 1512
512 Ga0500616_0011515 3300053153 Bacteria 5216
513 Ga0500616_0032745 3300053153 Bacteria 2840
514 Ga0500627_0002652 3300053158 Bacteria 5358
515 Ga0500634_0027640 3300053161 Bacteria 3091
516 Ga0500638_003779 3300053162 Bacteria 5694
517 Ga0500625_038758 3300053729 Bacteria 2249
518 Ga0500661_002140 3300055283 Bacteria 3727
519 Ga0466962_0031832 3300061719 Bacteria 2525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0032745 Ga0500616_0032745_2022_2828 264
2 3300036401 Ga0373937_0044882 Ga0373937_0044882_144_1082 288
3 3300046459 Ga0495629_0084603 Ga0495629_0084603_568_1506 288
4 3300046681 Ga0495647_0005004 Ga0495647_0005004_2132_3070 288
5 3300053077 Ga0495601_0111487 Ga0495601_0111487_124_1062 288
6 3300025711 Ga0207696_1016135 Ga0207696_10161352 289
7 3300046454 Ga0495592_0297626 Ga0495592_0297626_92_1030 290
8 3300009148 Ga0105243_10005637 Ga0105243_100056379 297
9 3300025292 Ga0209676_1000367 Ga0209676_100036773 297
10 3300025303 Ga0209051_1001096 Ga0209051_100109621 297
11 3300025304 Ga0209257_1011962 Ga0209257_10119622 297
12 3300025935 Ga0207709_10000587 Ga0207709_100005873 297
13 3300031731 Ga0307405_10009141 Ga0307405_100091413 297
14 3300031731 Ga0307405_10112474 Ga0307405_101124742 297
15 3300014497 Ga0182008_10001323 Ga0182008_100013234 298
16 3300041997 Ga0439431_0043738 Ga0439431_0043738_82_1020 299
17 3300031911 Ga0307412_10383535 Ga0307412_103835351 301
18 3300009553 Ga0105249_10337813 Ga0105249_103378131 302
19 3300013306 Ga0163162_10721334 Ga0163162_107213341 302
20 3300042435 Ga0439434_0005516 Ga0439434_0005516_1856_2764 302
21 3300041997 Ga0439431_0016587 Ga0439431_0016587_60_1004 303
22 3300026067 Ga0207678_10225758 Ga0207678_102257581 304
23 3300031507 Ga0307509_10169074 Ga0307509_101690741 304
24 3300035691 Ga0373931_0008810 Ga0373931_0008810_3018_3944 304
25 3300042015 Ga0439462_0022952 Ga0439462_0022952_215_1204 304
26 3300046492 Ga0495585_0069617 Ga0495585_0069617_220_1146 304
27 iso_pu_bacteria 2831864461 2831869180 304
28 3300002738 JGI25154J39366_1001254 JGI25154J39366_10012545 305
29 3300002741 JGI25157J39369_1000199 JGI25157J39369_10001997 305
30 3300005329 Ga0070683_100311895 Ga0070683_1003118952 305
31 3300005330 Ga0070690_100024000 Ga0070690_1000240003 305
32 3300005339 Ga0070660_100025146 Ga0070660_1000251467 305
33 3300005364 Ga0070673_100093450 Ga0070673_1000934502 305
34 3300005563 Ga0068855_100019384 Ga0068855_1000193843 305
35 3300005563 Ga0068855_100391845 Ga0068855_1003918452 305
36 3300005578 Ga0068854_100018408 Ga0068854_1000184084 305
37 3300005614 Ga0068856_100011642 Ga0068856_1000116427 305
38 3300005719 Ga0068861_100020935 Ga0068861_1000209353 305
39 3300005843 Ga0068860_100201055 Ga0068860_1002010552 305
40 3300006195 Ga0075366_10025007 Ga0075366_100250072 305
41 3300006353 Ga0075370_10000635 Ga0075370_100006356 305
42 3300009176 Ga0105242_10047066 Ga0105242_100470663 305
43 3300009545 Ga0105237_10048563 Ga0105237_100485633 305
44 3300009545 Ga0105237_10313130 Ga0105237_103131302 305
45 3300009551 Ga0105238_10120658 Ga0105238_101206581 305
46 3300013105 Ga0157369_10080034 Ga0157369_100800343 305
47 3300013307 Ga0157372_10172260 Ga0157372_101722602 305
48 3300013308 Ga0157375_10524596 Ga0157375_105245962 305
49 3300021361 Ga0213872_10085291 Ga0213872_100852912 305
50 3300025226 Ga0209674_100064 Ga0209674_1000647 305
51 3300025230 Ga0209563_100099 Ga0209563_1000997 305
52 3300025231 Ga0207427_100844 Ga0207427_1008447 305
53 3300025242 Ga0209258_100453 Ga0209258_10045334 305
54 3300025242 Ga0209258_100808 Ga0209258_10080812 305
55 3300025246 Ga0209646_1000060 Ga0209646_1000060237 305
56 3300025250 Ga0209026_1000049 Ga0209026_1000049235 305
57 3300025253 Ga0209677_100954 Ga0209677_1009549 305
58 3300025253 Ga0209677_102445 Ga0209677_1024455 305
59 3300025253 Ga0209677_104629 Ga0209677_1046292 305
60 3300025254 Ga0209148_1007934 Ga0209148_10079342 305
61 3300025256 Ga0209759_1000272 Ga0209759_100027266 305
62 3300025272 Ga0209455_1000157 Ga0209455_10001577 305
63 3300025907 Ga0207645_10238765 Ga0207645_102387652 305
64 3300025909 Ga0207705_10144464 Ga0207705_101444642 305
65 3300025911 Ga0207654_10100393 Ga0207654_101003932 305
66 3300025913 Ga0207695_10073418 Ga0207695_100734182 305
67 3300025914 Ga0207671_10102589 Ga0207671_101025892 305
68 3300025932 Ga0207690_10016847 Ga0207690_100168472 305
69 3300025934 Ga0207686_10047616 Ga0207686_100476163 305
70 3300025942 Ga0207689_10094734 Ga0207689_100947342 305
71 3300025944 Ga0207661_10175879 Ga0207661_101758792 305
72 3300025949 Ga0207667_10104617 Ga0207667_101046174 305
73 3300025949 Ga0207667_10527990 Ga0207667_105279901 305
74 3300025960 Ga0207651_10095847 Ga0207651_100958472 305
75 3300026023 Ga0207677_10203707 Ga0207677_102037071 305
76 3300026078 Ga0207702_10003218 Ga0207702_100032187 305
77 3300028381 Ga0268264_10388760 Ga0268264_103887601 305
78 3300028666 Ga0265336_10000040 Ga0265336_10000040127 305
79 3300029957 Ga0265324_10001932 Ga0265324_100019325 305
80 3300031616 Ga0307508_10238600 Ga0307508_102386002 305
81 3300031730 Ga0307516_10001176 Ga0307516_1000117633 305
82 3300037466 Ga0395898_0140581 Ga0395898_0140581_510_1439 305
83 3300038443 Ga0395901_0010895 Ga0395901_0010895_5706_6635 305
84 3300039447 Ga0436361_0064311 Ga0436361_0064311_534_1460 305
85 3300039447 Ga0436361_0276783 Ga0436361_0276783_112_1038 305
86 3300039447 Ga0436361_0691237 Ga0436361_0691237_4304_5227 305
87 3300039447 Ga0436361_1092231 Ga0436361_1092231_1576_2502 305
88 3300041512 Ga0451853_3940933 Ga0451853_3940933_43_969 305
89 3300044656 Ga0466969_0004140 Ga0466969_0004140_6253_7179 305
90 3300044658 Ga0466972_0079632 Ga0466972_0079632_225_1160 305
91 3300044683 Ga0466965_0024200 Ga0466965_0024200_590_1516 305
92 3300044684 Ga0466966_0083702 Ga0466966_0083702_368_1294 305
93 3300044693 Ga0466961_0038822 Ga0466961_0038822_1126_2052 305
94 3300044706 Ga0466964_0005324 Ga0466964_0005324_3161_4087 305
95 3300044719 Ga0466971_0038951 Ga0466971_0038951_698_1624 305
96 3300044735 Ga0466968_0048165 Ga0466968_0048165_519_1445 305
97 3300044765 Ga0466970_0022480 Ga0466970_0022480_2340_3266 305
98 3300044842 Ga0466957_0037756 Ga0466957_0037756_730_1656 305
99 3300044901 Ga0466960_0034753 Ga0466960_0034753_595_1518 305
100 3300045049 Ga0466959_0009180 Ga0466959_0009180_1799_2725 305
101 3300045836 Ga0466958_0008426 Ga0466958_0008426_4294_5220 305
102 3300046462 Ga0495651_0149998 Ga0495651_0149998_570_1496 305
103 3300046471 Ga0495650_0063482 Ga0495650_0063482_516_1445 305
104 3300046475 Ga0495639_0010835 Ga0495639_0010835_652_1581 305
105 3300046507 Ga0495606_0008149 Ga0495606_0008149_3978_4907 305
106 3300046511 Ga0495608_0099213 Ga0495608_0099213_284_1213 305
107 3300046529 Ga0495652_0258746 Ga0495652_0258746_121_1050 305
108 3300046616 Ga0495668_0033715 Ga0495668_0033715_600_1529 305
109 3300046694 Ga0495649_0000270 Ga0495649_0000270_6168_7097 305
110 3300046794 Ga0495589_0026302 Ga0495589_0026302_353_1282 305
111 3300050496 nmdc:mga07m45_5751_c1 nmdc:mga07m45_5751_c1_1371_2297 305
112 3300053080 Ga0500635_0000243 Ga0500635_0000243_6980_7906 305
113 3300055283 Ga0500661_002140 Ga0500661_002140_1020_1949 305
114 3300061719 Ga0466962_0031832 Ga0466962_0031832_1501_2427 305
115 iso_pu_bacteria 2585428062 2587754344 305
116 iso_pu_bacteria 2721755523 2722881879 305
117 iso_pu_bacteria 2839138175 2839144825 305
118 iso_pu_bacteria 2842747753 2842751914 305
119 iso_pu_bacteria 2919704043 2919705269 305
120 3300025294 Ga0209025_1001452 Ga0209025_100145223 306
121 3300025933 Ga0207706_10006170 Ga0207706_1000617010 306
122 3300044658 Ga0466972_0001854 Ga0466972_0001854_5919_6869 306
123 iso_pu_bacteria 2885192300 2885192398 306
124 iso_pu_bacteria 2932422444 2932423907 306
125 3300009147 Ga0114129_10025979 Ga0114129_100259796 307
126 3300028794 Ga0307515_10108747 Ga0307515_101087472 307
127 3300031730 Ga0307516_10000155 Ga0307516_1000015552 307
128 3300031730 Ga0307516_10000155 Ga0307516_1000015556 307
129 3300031911 Ga0307412_10155167 Ga0307412_101551672 307
130 3300044712 Ga0453684_0384314 Ga0453684_0384314_277_1266 307
131 3300050507 nmdc:mga05p37_42453_c1 nmdc:mga05p37_42453_c1_3970_4902 307
132 3300003771 Ga0055526_1006456 Ga0055526_10064563 308
133 3300004625 Ga0055543_1001804 Ga0055543_10018045 308
134 3300005262 Ga0065165_1001023 Ga0065165_100102317 308
135 3300005338 Ga0068868_100322084 Ga0068868_1003220842 308
136 3300005354 Ga0070675_100133034 Ga0070675_1001330342 308
137 3300005367 Ga0070667_100141980 Ga0070667_1001419802 308
138 3300005457 Ga0070662_100112514 Ga0070662_1001125142 308
139 3300005466 Ga0070685_10115033 Ga0070685_101150332 308
140 3300005467 Ga0070706_100000388 Ga0070706_10000038817 308
141 3300005468 Ga0070707_100071369 Ga0070707_1000713696 308
142 3300005471 Ga0070698_100421808 Ga0070698_1004218081 308
143 3300005577 Ga0068857_100000643 Ga0068857_1000006435 308
144 3300005616 Ga0068852_100026629 Ga0068852_1000266295 308
145 3300005617 Ga0068859_100039119 Ga0068859_1000391192 308
146 3300005617 Ga0068859_100796317 Ga0068859_1007963171 308
147 3300005840 Ga0068870_10208328 Ga0068870_102083281 308
148 3300005841 Ga0068863_100329760 Ga0068863_1003297601 308
149 3300005843 Ga0068860_100625975 Ga0068860_1006259751 308
150 3300006042 Ga0075368_10074386 Ga0075368_100743862 308
151 3300006177 Ga0075362_10035780 Ga0075362_100357802 308
152 3300006178 Ga0075367_10018219 Ga0075367_100182194 308
153 3300006195 Ga0075366_10013970 Ga0075366_100139704 308
154 3300006353 Ga0075370_10004190 Ga0075370_100041904 308
155 3300006353 Ga0075370_10023580 Ga0075370_100235803 308
156 3300006931 Ga0097620_100039122 Ga0097620_1000391222 308
157 3300006931 Ga0097620_100796298 Ga0097620_1007962981 308
158 3300006946 Ga0079104_1000016 Ga0079104_100001667 308
159 3300009092 Ga0105250_10001094 Ga0105250_1000109410 308
160 3300009093 Ga0105240_10076158 Ga0105240_100761584 308
161 3300009093 Ga0105240_10308219 Ga0105240_103082192 308
162 3300009098 Ga0105245_10098769 Ga0105245_100987692 308
163 3300009098 Ga0105245_10136482 Ga0105245_101364822 308
164 3300009098 Ga0105245_10227316 Ga0105245_102273162 308
165 3300009148 Ga0105243_10007314 Ga0105243_100073145 308
166 3300009176 Ga0105242_10235149 Ga0105242_102351492 308
167 3300009545 Ga0105237_10037619 Ga0105237_100376195 308
168 3300010375 Ga0105239_10013427 Ga0105239_100134275 308
169 3300013297 Ga0157378_10146509 Ga0157378_101465092 308
170 3300013308 Ga0157375_10014275 Ga0157375_100142753 308
171 3300013308 Ga0157375_10382629 Ga0157375_103826292 308
172 3300021384 Ga0213876_10178945 Ga0213876_101789452 308
173 3300025273 Ga0209673_1020420 Ga0209673_10204202 308
174 3300025295 Ga0209564_1000008 Ga0209564_1000008597 308
175 3300025908 Ga0207643_10181400 Ga0207643_101814002 308
176 3300025910 Ga0207684_10006285 Ga0207684_1000628513 308
177 3300025913 Ga0207695_10085364 Ga0207695_100853644 308
178 3300025913 Ga0207695_10238069 Ga0207695_102380692 308
179 3300025914 Ga0207671_10030763 Ga0207671_100307632 308
180 3300025922 Ga0207646_10044087 Ga0207646_100440873 308
181 3300025927 Ga0207687_10058118 Ga0207687_100581182 308
182 3300025927 Ga0207687_10144215 Ga0207687_101442152 308
183 3300025934 Ga0207686_10118135 Ga0207686_101181353 308
184 3300025935 Ga0207709_10000117 Ga0207709_1000011785 308
185 3300025941 Ga0207711_10264924 Ga0207711_102649243 308
186 3300025942 Ga0207689_10051455 Ga0207689_100514552 308
187 3300025942 Ga0207689_10183674 Ga0207689_101836742 308
188 3300025961 Ga0207712_10466021 Ga0207712_104660211 308
189 3300026023 Ga0207677_10052699 Ga0207677_100526992 308
190 3300026023 Ga0207677_10353751 Ga0207677_103537511 308
191 3300026067 Ga0207678_10020544 Ga0207678_100205443 308
192 3300026089 Ga0207648_10028772 Ga0207648_100287722 308
193 3300026116 Ga0207674_10001652 Ga0207674_100016525 308
194 3300026118 Ga0207675_100080204 Ga0207675_1000802042 308
195 3300026142 Ga0207698_10035164 Ga0207698_100351642 308
196 3300027111 Ga0209281_1000017 Ga0209281_100001777 308
197 3300028794 Ga0307515_10070037 Ga0307515_100700374 308
198 3300031548 Ga0307408_100000246 Ga0307408_10000024630 308
199 3300031730 Ga0307516_10001709 Ga0307516_100017098 308
200 3300031901 Ga0307406_10001082 Ga0307406_1000108216 308
201 3300032002 Ga0307416_100376310 Ga0307416_1003763102 308
202 3300037471 Ga0395905_0004450 Ga0395905_0004450_7026_7955 308
203 3300039437 Ga0436365_0179555 Ga0436365_0179555_174_1124 308
204 3300049762 Ga0501265_004384 Ga0501265_004384_208_1143 308
205 3300050493 nmdc:mga0k408_32098_c1 nmdc:mga0k408_32098_c1_1699_2634 308
206 3300050494 nmdc:mga06z11_83836_c1 nmdc:mga06z11_83836_c1_430_1365 308
207 3300050496 nmdc:mga07m45_141133_c1 nmdc:mga07m45_141133_c1_38_973 308
208 3300050496 nmdc:mga07m45_37567_c1 nmdc:mga07m45_37567_c1_1228_2163 308
209 3300050516 nmdc:mga0sz30_112190_c1 nmdc:mga0sz30_112190_c1_162_1097 308
210 iso_pu_bacteria 2643221628 2644161511 308
211 iso_pu_bacteria 2842677519 2842680535 308
212 iso_pu_bacteria 2904449895 2904450824 308
213 iso_pu_bacteria 2904456579 2904459673 308
214 iso_pu_bacteria 2919462493 2919462650 308
215 iso_pu_bacteria 2929520902 2929521772 308
216 iso_pu_bacteria 2945972063 2945973600 308
217 3300006042 Ga0075368_10086232 Ga0075368_100862321 309
218 3300006048 Ga0075363_100021061 Ga0075363_1000210612 309
219 3300006177 Ga0075362_10024734 Ga0075362_100247342 309
220 3300006178 Ga0075367_10059629 Ga0075367_100596292 309
221 3300006195 Ga0075366_10005751 Ga0075366_100057516 309
222 3300006353 Ga0075370_10100417 Ga0075370_101004171 309
223 3300025986 Ga0207658_10214692 Ga0207658_102146922 309
224 3300027614 Ga0209970_1000287 Ga0209970_10002875 309
225 3300028794 Ga0307515_10000221 Ga0307515_1000022167 309
226 3300028794 Ga0307515_10000777 Ga0307515_1000077716 309
227 3300031456 Ga0307513_10001667 Ga0307513_100016676 309
228 3300031456 Ga0307513_10074508 Ga0307513_100745083 309
229 3300031616 Ga0307508_10000141 Ga0307508_1000014118 309
230 3300031649 Ga0307514_10035594 Ga0307514_100355942 309
231 3300031649 Ga0307514_10200284 Ga0307514_102002842 309
232 3300031730 Ga0307516_10004703 Ga0307516_100047036 309
233 3300033179 Ga0307507_10094543 Ga0307507_100945432 309
234 3300041452 Ga0451793_1648312 Ga0451793_1648312_59_994 309
235 3300041460 Ga0451802_2098710 Ga0451802_2098710_505_1443 309
236 3300041486 Ga0451807_0108644 Ga0451807_0108644_306_1241 309
237 3300044673 Ga0453683_0001704 Ga0453683_0001704_6709_7647 309
238 3300045051 Ga0451576_0005405 Ga0451576_0005405_9700_10638 309
239 3300046519 Ga0495632_0039077 Ga0495632_0039077_1444_2379 309
240 3300046660 Ga0495625_0008695 Ga0495625_0008695_1692_2627 309
241 3300048905 Ga0496102_0021838 Ga0496102_0021838_2052_2987 309
242 3300050493 nmdc:mga0k408_19510_c1 nmdc:mga0k408_19510_c1_2766_3704 309
243 3300050493 nmdc:mga0k408_66920_c1 nmdc:mga0k408_66920_c1_777_1715 309
244 3300050494 nmdc:mga06z11_8825_c1 nmdc:mga06z11_8825_c1_814_1752 309
245 3300050496 nmdc:mga07m45_125706_c1 nmdc:mga07m45_125706_c1_531_1466 309
246 3300053134 Ga0500658_0015246 Ga0500658_0015246_585_1520 309
247 iso_pu_bacteria 2513020051 2513230030 309
248 iso_pu_bacteria 2643221658 2644324235 309
249 iso_pu_bacteria 2643221672 2644399467 309
250 iso_pu_bacteria 2643221683 2644465037 309
251 iso_pu_bacteria 2954767861 2954770785 309
252 3300002987 JGI25159J45721_1011127 JGI25159J45721_10111272 310
253 3300003322 rootL2_10062417 rootL2_100624172 310
254 3300003784 Ga0055534_1008457 Ga0055534_10084572 310
255 3300005328 Ga0070676_10296232 Ga0070676_102962321 310
256 3300005329 Ga0070683_100202003 Ga0070683_1002020032 310
257 3300005334 Ga0068869_100297623 Ga0068869_1002976232 310
258 3300005344 Ga0070661_100129704 Ga0070661_1001297042 310
259 3300005356 Ga0070674_100122233 Ga0070674_1001222332 310
260 3300005356 Ga0070674_100264122 Ga0070674_1002641222 310
261 3300005367 Ga0070667_100036966 Ga0070667_1000369663 310
262 3300005456 Ga0070678_100025246 Ga0070678_1000252464 310
263 3300005459 Ga0068867_100004283 Ga0068867_1000042839 310
264 3300005535 Ga0070684_100404125 Ga0070684_1004041251 310
265 3300005548 Ga0070665_100016667 Ga0070665_1000166674 310
266 3300005548 Ga0070665_100155233 Ga0070665_1001552333 310
267 3300005564 Ga0070664_100003941 Ga0070664_1000039418 310
268 3300005564 Ga0070664_100443559 Ga0070664_1004435592 310
269 3300005617 Ga0068859_100264579 Ga0068859_1002645792 310
270 3300005718 Ga0068866_10039101 Ga0068866_100391012 310
271 3300005719 Ga0068861_100003803 Ga0068861_1000038038 310
272 3300005841 Ga0068863_100368200 Ga0068863_1003682002 310
273 3300005843 Ga0068860_100019424 Ga0068860_1000194242 310
274 3300005844 Ga0068862_100027196 Ga0068862_1000271965 310
275 3300005844 Ga0068862_100050422 Ga0068862_1000504223 310
276 3300005844 Ga0068862_100061092 Ga0068862_1000610923 310
277 3300006195 Ga0075366_10002902 Ga0075366_100029026 310
278 3300006195 Ga0075366_10026682 Ga0075366_100266823 310
279 3300006353 Ga0075370_10049246 Ga0075370_100492461 310
280 3300006881 Ga0068865_100012454 Ga0068865_1000124545 310
281 3300006881 Ga0068865_100134829 Ga0068865_1001348292 310
282 3300006931 Ga0097620_100264589 Ga0097620_1002645892 310
283 3300009148 Ga0105243_10128360 Ga0105243_101283602 310
284 3300013297 Ga0157378_10015862 Ga0157378_100158623 310
285 3300013308 Ga0157375_10126005 Ga0157375_101260052 310
286 3300014497 Ga0182008_10001893 Ga0182008_100018933 310
287 3300014968 Ga0157379_10199818 Ga0157379_101998182 310
288 3300017792 Ga0163161_10046136 Ga0163161_100461363 310
289 3300025284 Ga0209130_1002913 Ga0209130_10029133 310
290 3300025291 Ga0209675_1008940 Ga0209675_10089403 310
291 3300025292 Ga0209676_1020966 Ga0209676_10209663 310
292 3300025920 Ga0207649_10199262 Ga0207649_101992622 310
293 3300025931 Ga0207644_10137219 Ga0207644_101372192 310
294 3300025937 Ga0207669_10101506 Ga0207669_101015062 310
295 3300025937 Ga0207669_10296435 Ga0207669_102964351 310
296 3300025938 Ga0207704_10032479 Ga0207704_100324793 310
297 3300025940 Ga0207691_10051737 Ga0207691_100517372 310
298 3300025942 Ga0207689_10325431 Ga0207689_103254312 310
299 3300025945 Ga0207679_10154489 Ga0207679_101544892 310
300 3300025986 Ga0207658_10049045 Ga0207658_100490453 310
301 3300026035 Ga0207703_10450961 Ga0207703_104509612 310
302 3300026089 Ga0207648_10008269 Ga0207648_100082693 310
303 3300026089 Ga0207648_10119908 Ga0207648_101199082 310
304 3300026118 Ga0207675_100009803 Ga0207675_1000098034 310
305 3300026121 Ga0207683_10050234 Ga0207683_100502343 310
306 3300026121 Ga0207683_10088143 Ga0207683_100881432 310
307 3300028379 Ga0268266_10062898 Ga0268266_100628982 310
308 3300028380 Ga0268265_10026776 Ga0268265_100267763 310
309 3300028381 Ga0268264_10372947 Ga0268264_103729472 310
310 3300028794 Ga0307515_10000137 Ga0307515_10000137169 310
311 3300031251 Ga0265327_10000640 Ga0265327_1000064016 310
312 3300031251 Ga0265327_10008506 Ga0265327_100085067 310
313 3300031731 Ga0307405_10128723 Ga0307405_101287232 310
314 3300032002 Ga0307416_100088462 Ga0307416_1000884622 310
315 3300035089 Ga0373944_0045699 Ga0373944_0045699_169_1107 310
316 3300041406 Ga0439439_0001487 Ga0439439_0001487_124_1062 310
317 3300041406 Ga0439439_0017146 Ga0439439_0017146_35_973 310
318 3300041999 Ga0439433_0004117 Ga0439433_0004117_762_1700 310
319 3300042002 Ga0439442_001303 Ga0439442_001303_3572_4510 310
320 3300042004 Ga0439445_0003027 Ga0439445_0003027_698_1636 310
321 3300042006 Ga0439432_028680 Ga0439432_028680_818_1756 310
322 3300042007 Ga0439449_0000254 Ga0439449_0000254_2103_3041 310
323 3300042007 Ga0439449_0006594 Ga0439449_0006594_466_1404 310
324 3300042145 Ga0450906_001491 Ga0450906_001491_797_1735 310
325 3300042435 Ga0439434_0009062 Ga0439434_0009062_1647_2585 310
326 3300042532 Ga0450893_0002594 Ga0450893_0002594_187_1125 310
327 3300046472 Ga0495580_0082501 Ga0495580_0082501_986_1930 310
328 3300046516 Ga0495628_0235432 Ga0495628_0235432_265_1206 310
329 3300046528 Ga0495642_0047257 Ga0495642_0047257_302_1243 310
330 3300046535 Ga0495586_0119700 Ga0495586_0119700_414_1352 310
331 3300046539 Ga0495621_0013009 Ga0495621_0013009_308_1249 310
332 3300046615 Ga0495656_0000114 Ga0495656_0000114_2450_3388 310
333 3300048903 Ga0496100_0029685 Ga0496100_0029685_1590_2531 310
334 3300048904 Ga0496101_0003936 Ga0496101_0003936_5474_6415 310
335 3300048905 Ga0496102_0007549 Ga0496102_0007549_4667_5608 310
336 3300048907 Ga0496104_0001619 Ga0496104_0001619_13186_14127 310
337 3300048908 Ga0496105_0003397 Ga0496105_0003397_5694_6635 310
338 3300048910 Ga0496107_0035127 Ga0496107_0035127_653_1594 310
339 3300048911 Ga0496108_0065778 Ga0496108_0065778_581_1522 310
340 3300048912 Ga0496109_0136456 Ga0496109_0136456_504_1445 310
341 3300048914 Ga0496111_0071375 Ga0496111_0071375_1081_2022 310
342 3300048915 Ga0496112_0376116 Ga0496112_0376116_173_1114 310
343 3300048917 Ga0496114_0094860 Ga0496114_0094860_331_1269 310
344 3300053088 Ga0500644_0003211 Ga0500644_0003211_2026_2964 310
345 3300053145 Ga0500586_044798 Ga0500586_044798_533_1471 310
346 3300053153 Ga0500616_0011515 Ga0500616_0011515_1112_2050 310
347 iso_pu_bacteria 2599185214 2599620677 310
348 iso_pu_bacteria 2599185226 2599673976 310
349 iso_pu_bacteria 2599185227 2599678707 310
350 iso_pu_bacteria 2599185229 2599690188 310
351 iso_pu_bacteria 2738541277 2738720525 310
352 iso_pu_bacteria 2738541307 2738884099 310
353 iso_pu_bacteria 2738543013 2739250197 310
354 iso_pu_bacteria 2738543019 2739279724 310
355 iso_pu_bacteria 2818991446 2819601204 310
356 iso_pu_bacteria 2831265667 2831271475 310
357 iso_pu_bacteria 2838054893 2838055379 310
358 iso_pu_bacteria 2885198086 2885201546 310
359 iso_pu_bacteria 2885211737 2885215743 310
360 iso_pu_bacteria 2899924645 2899927449 310
361 iso_pu_bacteria 2904541872 2904548071 310
362 iso_pu_bacteria 2928037797 2928042639 310
363 iso_pu_bacteria 2928044640 2928048934 310
364 iso_pu_bacteria 2928051484 2928055268 310
365 iso_pu_bacteria 2928064002 2928068696 310
366 iso_pu_bacteria 2928070936 2928073393 310
367 iso_pu_bacteria 2928084124 2928090051 310
368 iso_pu_bacteria 2929160207 2929161534 310
369 iso_pu_bacteria 2945909444 2945913998 310
370 iso_pu_bacteria 2945984333 2945990607 310
371 3300005295 Ga0065707_10087081 Ga0065707_100870815 311
372 3300015683 Ga0183362_10001 Ga0183362_10001701 311
373 3300031456 Ga0307513_10071296 Ga0307513_100712963 311
374 3300037068 Ga0373925_0012106 Ga0373925_0012106_949_1890 311
375 3300046516 Ga0495628_0356895 Ga0495628_0356895_99_1040 311
376 3300001989 JGI24739J22299_10043806 JGI24739J22299_100438062 312
377 3300003187 JGI25151J46595_10002493 JGI25151J46595_100024933 312
378 3300003773 Ga0055537_1001147 Ga0055537_10011479 312
379 3300003784 Ga0055534_1001199 Ga0055534_10011999 312
380 3300006038 Ga0075365_10014301 Ga0075365_100143013 312
381 3300006048 Ga0075363_100015241 Ga0075363_1000152412 312
382 3300006177 Ga0075362_10029390 Ga0075362_100293902 312
383 3300006178 Ga0075367_10045095 Ga0075367_100450952 312
384 3300006195 Ga0075366_10004500 Ga0075366_100045006 312
385 3300006195 Ga0075366_10020940 Ga0075366_100209402 312
386 3300006353 Ga0075370_10003110 Ga0075370_100031102 312
387 3300006353 Ga0075370_10030426 Ga0075370_100304262 312
388 3300006353 Ga0075370_10036768 Ga0075370_100367682 312
389 3300006946 Ga0079104_1013872 Ga0079104_10138722 312
390 3300006948 Ga0099826_10000498 Ga0099826_100004983 312
391 3300017792 Ga0163161_10045327 Ga0163161_100453273 312
392 3300025258 Ga0209129_1005353 Ga0209129_10053535 312
393 3300025263 Ga0209565_1000098 Ga0209565_100009826 312
394 3300025273 Ga0209673_1000058 Ga0209673_1000058225 312
395 3300025291 Ga0209675_1000010 Ga0209675_100001041 312
396 3300025294 Ga0209025_1000194 Ga0209025_100019435 312
397 3300025294 Ga0209025_1015699 Ga0209025_10156995 312
398 3300025303 Ga0209051_1000894 Ga0209051_100089426 312
399 3300027666 Ga0209282_1020331 Ga0209282_10203312 312
400 3300030732 Ga0316176_1070259 Ga0316176_10702592 312
401 3300030733 Ga0314311_1074579 Ga0314311_10745793 312
402 3300031548 Ga0307408_100009802 Ga0307408_1000098022 312
403 3300031901 Ga0307406_10006015 Ga0307406_100060155 312
404 3300031911 Ga0307412_10131167 Ga0307412_101311672 312
405 3300042122 Ga0450920_026994 Ga0450920_026994_64_1002 312
406 3300042145 Ga0450906_005561 Ga0450906_005561_564_1502 312
407 3300042531 Ga0450918_010010 Ga0450918_010010_371_1309 312
408 3300046660 Ga0495625_0000294 Ga0495625_0000294_73519_74457 312
409 3300049759 Ga0501262_000138 Ga0501262_000138_6198_7175 312
410 3300050490 nmdc:mga03n38_80013_c1 nmdc:mga03n38_80013_c1_84_1022 312
411 3300050491 nmdc:mga00v17_64072_c1 nmdc:mga00v17_64072_c1_125_1063 312
412 3300050492 nmdc:mga0yw44_245496_c1 nmdc:mga0yw44_245496_c1_211_1149 312
413 3300050493 nmdc:mga0k408_12512_c1 nmdc:mga0k408_12512_c1_359_1327 312
414 3300050493 nmdc:mga0k408_250046_c1 nmdc:mga0k408_250046_c1_48_986 312
415 3300050496 nmdc:mga07m45_47327_c1 nmdc:mga07m45_47327_c1_295_1233 312
416 3300050496 nmdc:mga07m45_966_c2 nmdc:mga07m45_966_c2_2468_3436 312
417 3300053079 Ga0500610_0072486 Ga0500610_0072486_667_1605 312
418 3300003781 Ga0055536_1007310 Ga0055536_10073104 313
419 3300003792 Ga0055540_1003315 Ga0055540_10033152 313
420 3300003794 Ga0055531_10004533 Ga0055531_100045337 313
421 3300005366 Ga0070659_100076497 Ga0070659_1000764972 313
422 3300005457 Ga0070662_100010608 Ga0070662_1000106084 313
423 3300005564 Ga0070664_100047752 Ga0070664_1000477522 313
424 3300005577 Ga0068857_100159759 Ga0068857_1001597592 313
425 3300005616 Ga0068852_100031429 Ga0068852_1000314294 313
426 3300006051 Ga0075364_10034294 Ga0075364_100342942 313
427 3300006353 Ga0075370_10190108 Ga0075370_101901082 313
428 3300009036 Ga0105244_10013907 Ga0105244_100139073 313
429 3300009098 Ga0105245_10592584 Ga0105245_105925841 313
430 3300009148 Ga0105243_10097271 Ga0105243_100972712 313
431 3300010375 Ga0105239_10176307 Ga0105239_101763072 313
432 3300014497 Ga0182008_10039147 Ga0182008_100391472 313
433 3300015261 Ga0182006_1012165 Ga0182006_10121652 313
434 3300015262 Ga0182007_10008063 Ga0182007_100080633 313
435 3300025292 Ga0209676_1003347 Ga0209676_10033473 313
436 3300025298 Ga0209050_1000786 Ga0209050_10007868 313
437 3300025303 Ga0209051_1001079 Ga0209051_10010793 313
438 3300025304 Ga0209257_1004591 Ga0209257_10045918 313
439 3300025728 Ga0207655_1003837 Ga0207655_10038372 313
440 3300025927 Ga0207687_10386795 Ga0207687_103867952 313
441 3300025935 Ga0207709_10019655 Ga0207709_100196552 313
442 3300025945 Ga0207679_10267782 Ga0207679_102677822 313
443 3300026041 Ga0207639_10073052 Ga0207639_100730523 313
444 3300026116 Ga0207674_10113483 Ga0207674_101134832 313
445 3300026142 Ga0207698_10565782 Ga0207698_105657822 313
446 3300031456 Ga0307513_10000029 Ga0307513_1000002978 313
447 3300048919 Ga0496116_0023802 Ga0496116_0023802_933_1886 313
448 3300048920 Ga0496117_0010951 Ga0496117_0010951_2411_3364 313
449 3300048921 Ga0496118_0017904 Ga0496118_0017904_1840_2793 313
450 3300048928 Ga0496125_0079343 Ga0496125_0079343_241_1194 313
451 3300048928 Ga0496125_0108402 Ga0496125_0108402_346_1299 313
452 3300050496 nmdc:mga07m45_210645_c1 nmdc:mga07m45_210645_c1_153_1106 313
453 3300053098 Ga0500650_0019041 Ga0500650_0019041_1762_2709 313
454 3300053117 Ga0500593_000984 Ga0500593_000984_1911_2858 313
455 3300053122 Ga0500608_016963 Ga0500608_016963_2019_2972 313
456 3300053129 Ga0500628_001932 Ga0500628_001932_1178_2125 313
457 3300001979 JGI24740J21852_10014995 JGI24740J21852_100149953 314
458 3300001989 JGI24739J22299_10013835 JGI24739J22299_100138352 314
459 3300002774 JGI25150J39212_1001865 JGI25150J39212_10018652 314
460 3300002987 JGI25159J45721_1006802 JGI25159J45721_10068022 314
461 3300002987 JGI25159J45721_1010765 JGI25159J45721_10107651 314
462 3300003761 Ga0055535_1000286 Ga0055535_100028631 314
463 3300003762 Ga0055542_1000080 Ga0055542_100008031 314
464 3300003771 Ga0055526_1018554 Ga0055526_10185542 314
465 3300003771 Ga0055526_1020918 Ga0055526_10209182 314
466 3300003773 Ga0055537_1017345 Ga0055537_10173451 314
467 3300003784 Ga0055534_1004097 Ga0055534_10040972 314
468 3300003790 Ga0055528_1036084 Ga0055528_10360841 314
469 3300003791 Ga0055530_10003765 Ga0055530_100037652 314
470 3300003792 Ga0055540_1032905 Ga0055540_10329052 314
471 3300004625 Ga0055543_1003991 Ga0055543_10039913 314
472 3300005262 Ga0065165_1013931 Ga0065165_10139311 314
473 3300005262 Ga0065165_1023367 Ga0065165_10233672 314
474 3300005834 Ga0068851_10008974 Ga0068851_100089744 314
475 3300010375 Ga0105239_10171788 Ga0105239_101717882 314
476 3300013100 Ga0157373_10099715 Ga0157373_100997152 314
477 3300013102 Ga0157371_10029559 Ga0157371_100295592 314
478 3300013104 Ga0157370_10029709 Ga0157370_100297093 314
479 3300013104 Ga0157370_10304179 Ga0157370_103041792 314
480 3300013105 Ga0157369_10102395 Ga0157369_101023952 314
481 3300013307 Ga0157372_10230769 Ga0157372_102307692 314
482 3300014497 Ga0182008_10083166 Ga0182008_100831661 314
483 3300017792 Ga0163161_10005510 Ga0163161_100055103 314
484 3300025208 Ga0209436_114702 Ga0209436_1147022 314
485 3300025228 Ga0209672_101674 Ga0209672_1016745 314
486 3300025229 Ga0209147_100450 Ga0209147_1004502 314
487 3300025242 Ga0209258_100093 Ga0209258_10009380 314
488 3300025245 Ga0207425_1000715 Ga0207425_10007153 314
489 3300025254 Ga0209148_1000007 Ga0209148_10000071047 314
490 3300025258 Ga0209129_1000024 Ga0209129_100002423 314
491 3300025263 Ga0209565_1000583 Ga0209565_100058316 314
492 3300025263 Ga0209565_1001746 Ga0209565_10017463 314
493 3300025273 Ga0209673_1002614 Ga0209673_10026149 314
494 3300025273 Ga0209673_1002934 Ga0209673_10029349 314
495 3300025284 Ga0209130_1000757 Ga0209130_10007572 314
496 3300025284 Ga0209130_1007852 Ga0209130_10078523 314
497 3300025291 Ga0209675_1006671 Ga0209675_10066713 314
498 3300025291 Ga0209675_1008554 Ga0209675_10085542 314
499 3300025292 Ga0209676_1000028 Ga0209676_1000028329 314
500 3300025292 Ga0209676_1000317 Ga0209676_100031743 314
501 3300025294 Ga0209025_1001526 Ga0209025_10015263 314
502 3300025294 Ga0209025_1010030 Ga0209025_10100303 314
503 3300025294 Ga0209025_1019317 Ga0209025_10193172 314
504 3300025295 Ga0209564_1000344 Ga0209564_100034477 314
505 3300025295 Ga0209564_1001028 Ga0209564_100102829 314
506 3300025297 Ga0209758_1000510 Ga0209758_100051028 314
507 3300025297 Ga0209758_1012342 Ga0209758_10123424 314
508 3300025298 Ga0209050_1000072 Ga0209050_100007285 314
509 3300025298 Ga0209050_1006264 Ga0209050_10062646 314
510 3300025299 Ga0209256_1000151 Ga0209256_1000151101 314
511 3300025299 Ga0209256_1000256 Ga0209256_100025616 314
512 3300025302 Ga0207426_1000049 Ga0207426_1000049340 314
513 3300025302 Ga0207426_1000315 Ga0207426_100031516 314
514 3300025303 Ga0209051_1000015 Ga0209051_1000015258 314
515 3300025303 Ga0209051_1000056 Ga0209051_1000056142 314
516 3300025304 Ga0209257_1000037 Ga0209257_1000037487 314
517 3300025304 Ga0209257_1004421 Ga0209257_10044213 314
518 3300025321 Ga0207656_10001300 Ga0207656_100013005 314
519 3300025949 Ga0207667_10163905 Ga0207667_101639052 314
520 3300026041 Ga0207639_10028052 Ga0207639_100280522 314
521 3300031911 Ga0307412_10107672 Ga0307412_101076722 314
522 3300032002 Ga0307416_100008180 Ga0307416_1000081805 314
523 3300046453 Ga0495627_015346 Ga0495627_015346_253_1209 314
524 3300046460 Ga0495638_0027538 Ga0495638_0027538_293_1249 314
525 3300046513 Ga0495616_0003991 Ga0495616_0003991_2098_3054 314
526 3300046515 Ga0495620_0003885 Ga0495620_0003885_7413_8369 314
527 3300046518 Ga0495631_0003913 Ga0495631_0003913_4635_5591 314
528 3300046520 Ga0495637_0011511 Ga0495637_0011511_133_1089 314
529 3300046530 Ga0495654_0029206 Ga0495654_0029206_349_1305 314
530 3300046674 Ga0495588_0024588 Ga0495588_0024588_245_1201 314
531 3300046674 Ga0495588_0077703 Ga0495588_0077703_137_1096 314
532 3300046810 Ga0495660_0037101 Ga0495660_0037101_46_1002 314
533 3300047321 Ga0495676_0020316 Ga0495676_0020316_2754_3710 314
534 3300047470 Ga0495681_0040685 Ga0495681_0040685_727_1683 314
535 3300047673 Ga0495593_0009903 Ga0495593_0009903_3971_4927 314
536 3300048904 Ga0496101_0257882 Ga0496101_0257882_300_1256 314
537 3300048919 Ga0496116_0144007 Ga0496116_0144007_258_1202 314
538 3300048921 Ga0496118_0058254 Ga0496118_0058254_1578_2522 314
539 3300048922 Ga0496119_0012317 Ga0496119_0012317_3934_4890 314
540 3300048925 Ga0496122_0083672 Ga0496122_0083672_174_1130 314
541 3300048926 Ga0496123_0014852 Ga0496123_0014852_2417_3373 314
542 3300048927 Ga0496124_0093603 Ga0496124_0093603_20_964 314
543 3300048928 Ga0496125_0052493 Ga0496125_0052493_1687_2631 314
544 3300048929 Ga0496126_0060332 Ga0496126_0060332_1694_2650 314
545 3300053087 Ga0500643_017857 Ga0500643_017857_1023_1979 314
546 3300053093 Ga0500651_0000057 Ga0500651_0000057_63132_64088 314
547 3300053094 Ga0500566_0099850 Ga0500566_0099850_203_1159 314
548 3300053103 Ga0500555_038217 Ga0500555_038217_59_1015 314
549 3300053108 Ga0500562_028761 Ga0500562_028761_290_1246 314
550 3300053110 Ga0500571_000038 Ga0500571_000038_35788_36744 314
551 3300053117 Ga0500593_006723 Ga0500593_006723_1571_2527 314
552 3300053118 Ga0500594_0000390 Ga0500594_0000390_6820_7776 314
553 3300053121 Ga0500607_005933 Ga0500607_005933_4531_5487 314
554 3300053121 Ga0500607_039435 Ga0500607_039435_1339_2295 314
555 3300053133 Ga0500655_001260 Ga0500655_001260_2087_3043 314
556 3300053134 Ga0500658_0000408 Ga0500658_0000408_11072_12028 314
557 3300053134 Ga0500658_0001506 Ga0500658_0001506_6641_7597 314
558 3300053136 Ga0500559_0006861 Ga0500559_0006861_1082_2038 314
559 3300053139 Ga0500568_0007904 Ga0500568_0007904_1926_2882 314
560 3300053141 Ga0500574_038913 Ga0500574_038913_189_1145 314
561 3300053158 Ga0500627_0002652 Ga0500627_0002652_1551_2507 314
562 3300053161 Ga0500634_0027640 Ga0500634_0027640_1915_2871 314
563 3300053162 Ga0500638_003779 Ga0500638_003779_1812_2768 314
564 3300053729 Ga0500625_038758 Ga0500625_038758_1176_2132 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

240

319

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

280

318

0.95

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

227

268

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9359 213 307
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9203 208 307
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9063 199 312
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8761 199 305
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.8753 199 312
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9742 259 312 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9708 263 305 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9683 250 308 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9667 259 306 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9396 262 305 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I3UER9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9696 213 308 GO:0003700
GO:0043565
AF-A0A069SXS9-F1-model_v4 deleted 0.968 215 311
AF-A0A1A3SUE6-F1-model_v4 Transcriptional regulator 0.9647 207 307 GO:0003700
GO:0043565
AF-A0A2V2E0K2-F1-model_v4 Stage 0 sporulation protein A homolog 0.9553 209 311 GO:0000160
GO:0003700
GO:0043565
AF-A0A807WU71-F1-model_v4 deleted 0.9546 201 309

Feature Viewer

pLDDT pTM Quality
81.28 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map