F463895

General Info

Members Datasets Scaffolds Average Seq Length
562 219 1124 81

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10008199|JGI25406J46586_100081995
Length 89
Sequence MQMRARLEALIDEMLDGQIMLDEALSEFEKLYIQKALTRHKEHLSRTAATLGIHRNTLSKRVADYRSQERPAPAAKKRAQGKPAKRKTR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
169 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.85
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008199 3300003203 Bacteria 4743
2 JGI24751J29686_10000094 3300002459 Bacteria 49568
3 JGI24751J29686_10000191 3300002459 Bacteria 27160
4 JGI25406J46586_10009747 3300003203 Bacteria 4292
5 Ga0065704_10166314 3300005289 Bacteria 1320
6 Ga0065704_10318390 3300005289 Bacteria 855
7 Ga0065704_10344944 3300005289 Unclassified 818
8 Ga0065712_10001594 3300005290 Bacteria 6011
9 Ga0065712_10008770 3300005290 Bacteria 3565
10 Ga0065712_10092796 3300005290 Bacteria 2310
11 Ga0065712_10117135 3300005290 Bacteria 1724
12 Ga0065715_10006372 3300005293 Bacteria 5492
13 Ga0065715_10035979 3300005293 Bacteria 1732
14 Ga0065715_10113654 3300005293 Bacteria 2480
15 Ga0065715_10370858 3300005293 Bacteria 921
16 Ga0065707_10110364 3300005295 Bacteria 2432
17 Ga0065707_10115720 3300005295 Bacteria 2245
18 Ga0065707_10161902 3300005295 Bacteria 1556
19 Ga0065707_10349622 3300005295 Bacteria 918
20 Ga0065707_10982957 3300005295 Unclassified 544
21 Ga0070676_10173107 3300005328 Bacteria 1398
22 Ga0070690_100031910 3300005330 Bacteria 3285
23 Ga0070690_100251795 3300005330 Bacteria 1249
24 Ga0070670_100000114 3300005331 Bacteria 75910
25 Ga0070670_100202830 3300005331 Bacteria 1723
26 Ga0070670_102124130 3300005331 Bacteria 518
27 Ga0070677_10123601 3300005333 Bacteria 1172
28 Ga0070677_10152345 3300005333 Bacteria 1077
29 Ga0068869_100082711 3300005334 Bacteria 2400
30 Ga0068869_100092655 3300005334 Bacteria 2275
31 Ga0068869_100232030 3300005334 Bacteria 1467
32 Ga0068869_100400619 3300005334 Bacteria 1129
33 Ga0068869_100441205 3300005334 Bacteria 1077
34 Ga0068869_100712543 3300005334 Bacteria 857
35 Ga0068869_101432929 3300005334 Bacteria 612
36 Ga0068869_101933482 3300005334 Bacteria 529
37 Ga0070666_10889211 3300005335 Bacteria 658
38 Ga0070680_100002508 3300005336 Bacteria 13596
39 Ga0070680_100026929 3300005336 Bacteria 4601
40 Ga0070682_100245325 3300005337 Bacteria 1288
41 Ga0070682_100375511 3300005337 Bacteria 1067
42 Ga0070682_101035313 3300005337 Bacteria 683
43 Ga0070682_101745188 3300005337 Bacteria 542
44 Ga0068868_100057087 3300005338 Bacteria 3084
45 Ga0070689_100118039 3300005340 Bacteria 2116
46 Ga0070689_100291797 3300005340 Bacteria 1355
47 Ga0070689_100542544 3300005340 Unclassified 1001
48 Ga0070691_10831239 3300005341 Bacteria 565
49 Ga0070687_100004445 3300005343 Bacteria 5592
50 Ga0070692_10003489 3300005345 Bacteria 6384
51 Ga0070692_10299986 3300005345 Bacteria 981
52 Ga0070692_10521935 3300005345 Bacteria 773
53 Ga0070692_11328743 3300005345 Bacteria 517
54 Ga0070669_100082872 3300005353 Bacteria 2391
55 Ga0070669_100592515 3300005353 Bacteria 928
56 Ga0070669_100974702 3300005353 Bacteria 726
57 Ga0070671_100047086 3300005355 Bacteria 3587
58 Ga0070671_100062474 3300005355 Bacteria 3101
59 Ga0070671_101731503 3300005355 Bacteria 555
60 Ga0070674_100123350 3300005356 Bacteria 1921
61 Ga0070674_101906980 3300005356 Unclassified 540
62 Ga0070673_100013883 3300005364 Bacteria 5591
63 Ga0070673_100022513 3300005364 Bacteria 4587
64 Ga0070673_100098072 3300005364 Bacteria 2408
65 Ga0070673_100208783 3300005364 Bacteria 1685
66 Ga0070673_100716726 3300005364 Bacteria 919
67 Ga0070673_101975493 3300005364 Bacteria 553
68 Ga0070688_100007548 3300005365 Bacteria 5868
69 Ga0070688_101196060 3300005365 Bacteria 611
70 Ga0070688_101198862 3300005365 Bacteria 610
71 Ga0070667_100019627 3300005367 Bacteria 5607
72 Ga0070667_100822965 3300005367 Bacteria 863
73 Ga0070705_100063982 3300005440 Bacteria 2195
74 Ga0070705_100275934 3300005440 Bacteria 1193
75 Ga0070705_100298243 3300005440 Bacteria 1154
76 Ga0070705_100760602 3300005440 Bacteria 767
77 Ga0070700_100057090 3300005441 Bacteria 2449
78 Ga0070700_100084636 3300005441 Bacteria 2056
79 Ga0070700_100635904 3300005441 Bacteria 841
80 Ga0070694_100008814 3300005444 Bacteria 6181
81 Ga0070694_100018231 3300005444 Bacteria 4453
82 Ga0070694_100045829 3300005444 Bacteria 2932
83 Ga0070694_100214237 3300005444 Bacteria 1442
84 Ga0070694_100897133 3300005444 Bacteria 732
85 Ga0070694_100930945 3300005444 Bacteria 719
86 Ga0070708_100059397 3300005445 Bacteria 3409
87 Ga0070663_100639843 3300005455 Bacteria 898
88 Ga0070678_100370671 3300005456 Bacteria 1236
89 Ga0070662_101088713 3300005457 Bacteria 685
90 Ga0070681_10000346 3300005458 Bacteria 37410
91 Ga0068867_100024313 3300005459 Bacteria 4340
92 Ga0068867_100143435 3300005459 Bacteria 1869
93 Ga0068867_100725168 3300005459 Bacteria 879
94 Ga0070685_11272566 3300005466 Unclassified 561
95 Ga0070706_100125170 3300005467 Bacteria 2396
96 Ga0070706_102135232 3300005467 Unclassified 506
97 Ga0070707_100087597 3300005468 Bacteria 3011
98 Ga0070707_100233032 3300005468 Bacteria 1792
99 Ga0070698_100094420 3300005471 Bacteria 2970
100 Ga0070698_100110266 3300005471 Bacteria 2717
101 Ga0070699_100073853 3300005518 Bacteria 2967
102 Ga0070699_100450327 3300005518 Bacteria 1167
103 Ga0070699_100641724 3300005518 Bacteria 969
104 Ga0070699_101346496 3300005518 Bacteria 655
105 Ga0070679_100000167 3300005530 Bacteria 53124
106 Ga0070684_100382658 3300005535 Bacteria 1296
107 Ga0070697_100082363 3300005536 Bacteria 2652
108 Ga0070697_100477605 3300005536 Bacteria 1088
109 Ga0070697_101003395 3300005536 Unclassified 742
110 Ga0070697_101125616 3300005536 Bacteria 699
111 Ga0068853_100836185 3300005539 Bacteria 882
112 Ga0068853_102071609 3300005539 Bacteria 552
113 Ga0070672_101572669 3300005543 Bacteria 590
114 Ga0070672_101646845 3300005543 Unclassified 576
115 Ga0070686_100007097 3300005544 Bacteria 6246
116 Ga0070686_100030023 3300005544 Bacteria 3312
117 Ga0070695_100099744 3300005545 Bacteria 1954
118 Ga0070695_100261927 3300005545 Bacteria 1263
119 Ga0070695_100436320 3300005545 Bacteria 1000
120 Ga0070695_100603847 3300005545 Bacteria 862
121 Ga0070695_101299971 3300005545 Bacteria 601
122 Ga0070696_100040651 3300005546 Bacteria 3211
123 Ga0070696_100462463 3300005546 Bacteria 1003
124 Ga0070696_100802713 3300005546 Bacteria 775
125 Ga0070693_100014447 3300005547 Bacteria 4046
126 Ga0070693_100053043 3300005547 Unclassified 2327
127 Ga0070693_100835127 3300005547 Bacteria 685
128 Ga0070665_101619932 3300005548 Bacteria 655
129 Ga0070665_102229584 3300005548 Bacteria 551
130 Ga0070704_100141554 3300005549 Bacteria 1879
131 Ga0070704_100466776 3300005549 Bacteria 1090
132 Ga0070704_100489050 3300005549 Bacteria 1066
133 Ga0070704_101367714 3300005549 Bacteria 649
134 Ga0070704_101615598 3300005549 Bacteria 598
135 Ga0070664_100188309 3300005564 Bacteria 1838
136 Ga0070664_101229272 3300005564 Bacteria 707
137 Ga0068857_100711339 3300005577 Bacteria 955
138 Ga0068857_102426174 3300005577 Bacteria 515
139 Ga0068854_100039640 3300005578 Bacteria 3320
140 Ga0068854_100091612 3300005578 Bacteria 2263
141 Ga0068854_100293181 3300005578 Bacteria 1313
142 Ga0068854_100388898 3300005578 Bacteria 1151
143 Ga0068854_100458041 3300005578 Bacteria 1067
144 Ga0068856_100002768 3300005614 Bacteria 17951
145 Ga0070702_100001012 3300005615 Bacteria 11131
146 Ga0070702_100027311 3300005615 Bacteria 3078
147 Ga0068852_100086572 3300005616 Bacteria 2794
148 Ga0068852_100099748 3300005616 Bacteria 2618
149 Ga0068852_100690134 3300005616 Bacteria 1030
150 Ga0068852_101190245 3300005616 Bacteria 783
151 Ga0068852_102003857 3300005616 Bacteria 601
152 Ga0068852_102636758 3300005616 Bacteria 522
153 Ga0068859_100018948 3300005617 Bacteria 6913
154 Ga0068859_100047567 3300005617 Bacteria 4310
155 Ga0068859_100075160 3300005617 Bacteria 3419
156 Ga0068859_100171835 3300005617 Bacteria 2248
157 Ga0068859_100228440 3300005617 Bacteria 1949
158 Ga0068859_100253471 3300005617 Bacteria 1850
159 Ga0068859_100309465 3300005617 Bacteria 1673
160 Ga0068859_100392449 3300005617 Bacteria 1484
161 Ga0068859_100452962 3300005617 Bacteria 1379
162 Ga0068859_100861888 3300005617 Bacteria 991
163 Ga0068859_100976930 3300005617 Bacteria 929
164 Ga0068859_101277599 3300005617 Bacteria 809
165 Ga0068859_101328588 3300005617 Bacteria 792
166 Ga0068859_101678531 3300005617 Bacteria 702
167 Ga0068859_101834971 3300005617 Bacteria 670
168 Ga0068859_102876146 3300005617 Bacteria 528
169 Ga0068864_100028159 3300005618 Bacteria 4748
170 Ga0068864_100181690 3300005618 Bacteria 1923
171 Ga0068864_100231112 3300005618 Bacteria 1710
172 Ga0068864_100468868 3300005618 Bacteria 1207
173 Ga0068864_100925489 3300005618 Bacteria 862
174 Ga0068866_10012150 3300005718 Bacteria 3748
175 Ga0068866_10016776 3300005718 Bacteria 3281
176 Ga0068866_11449659 3300005718 Unclassified 503
177 Ga0068861_100135781 3300005719 Bacteria 2001
178 Ga0068861_100240181 3300005719 Bacteria 1540
179 Ga0068861_101384485 3300005719 Bacteria 687
180 Ga0068851_10050015 3300005834 Bacteria 2122
181 Ga0068870_10371885 3300005840 Bacteria 923
182 Ga0068863_100249452 3300005841 Bacteria 1714
183 Ga0068863_100478207 3300005841 Bacteria 1225
184 Ga0068858_100085310 3300005842 Bacteria 2938
185 Ga0068858_100145576 3300005842 Bacteria 2225
186 Ga0068858_100519328 3300005842 Bacteria 1151
187 Ga0068858_102440513 3300005842 Bacteria 517
188 Ga0068860_100013884 3300005843 Bacteria 7898
189 Ga0068860_100124479 3300005843 Bacteria 2471
190 Ga0068860_100609209 3300005843 Bacteria 1098
191 Ga0068860_100697240 3300005843 Bacteria 1025
192 Ga0068860_102410676 3300005843 Bacteria 546
193 Ga0068862_100013449 3300005844 Bacteria 6774
194 Ga0068862_100194314 3300005844 Bacteria 1827
195 Ga0068862_100312111 3300005844 Bacteria 1449
196 Ga0081539_10000156 3300005985 Bacteria 158871
197 Ga0081539_10006451 3300005985 Bacteria 11246
198 Ga0070716_100065375 3300006173 Bacteria 2118
199 Ga0070716_101026682 3300006173 Bacteria 653
200 Ga0097621_100007317 3300006237 Bacteria 7889
201 Ga0097621_100082998 3300006237 Bacteria 2669
202 Ga0068871_100003671 3300006358 Bacteria 10550
203 Ga0068871_100004971 3300006358 Bacteria 9285
204 Ga0068871_100480521 3300006358 Bacteria 1117
205 Ga0075428_100908941 3300006844 Unclassified 933
206 Ga0075428_101069017 3300006844 Bacteria 853
207 Ga0075430_100064925 3300006846 Bacteria 3067
208 Ga0075431_100082205 3300006847 Bacteria 3325
209 Ga0075433_10073858 3300006852 Bacteria 3000
210 Ga0075433_10147413 3300006852 Bacteria 2092
211 Ga0075433_10369873 3300006852 Bacteria 1266
212 Ga0075433_11196624 3300006852 Bacteria 660
213 Ga0075434_100265582 3300006871 Bacteria 1735
214 Ga0075434_100827680 3300006871 Bacteria 941
215 Ga0075434_101632481 3300006871 Bacteria 653
216 Ga0075434_102116580 3300006871 Unclassified 567
217 Ga0075429_100013969 3300006880 Bacteria 6960
218 Ga0075429_100130410 3300006880 Bacteria 2199
219 Ga0075429_101699964 3300006880 Bacteria 548
220 Ga0068865_100026316 3300006881 Bacteria 3834
221 Ga0068865_100990594 3300006881 Bacteria 735
222 Ga0075436_101455849 3300006914 Unclassified 520
223 Ga0097620_100018948 3300006931 Bacteria 6913
224 Ga0097620_100047563 3300006931 Bacteria 4310
225 Ga0097620_100075163 3300006931 Bacteria 3419
226 Ga0097620_100171834 3300006931 Bacteria 2248
227 Ga0097620_100228433 3300006931 Bacteria 1949
228 Ga0097620_100253466 3300006931 Bacteria 1850
229 Ga0097620_100309432 3300006931 Bacteria 1673
230 Ga0097620_100392461 3300006931 Bacteria 1484
231 Ga0097620_100422345 3300006931 Bacteria 1429
232 Ga0097620_100452934 3300006931 Bacteria 1379
233 Ga0097620_100721883 3300006931 Bacteria 1086
234 Ga0097620_100861837 3300006931 Bacteria 991
235 Ga0097620_100976934 3300006931 Bacteria 929
236 Ga0097620_101277706 3300006931 Bacteria 809
237 Ga0097620_101328522 3300006931 Bacteria 792
238 Ga0097620_101678650 3300006931 Bacteria 702
239 Ga0097620_101835108 3300006931 Bacteria 670
240 Ga0097620_102876086 3300006931 Bacteria 528
241 Ga0075435_100087628 3300007076 Bacteria 2565
242 Ga0105250_10418703 3300009092 Bacteria 597
243 Ga0105240_10843118 3300009093 Bacteria 990
244 Ga0105240_11083715 3300009093 Bacteria 853
245 Ga0105240_11274181 3300009093 Bacteria 776
246 Ga0111539_10074896 3300009094 Bacteria 3989
247 Ga0111539_11301083 3300009094 Bacteria 844
248 Ga0111539_11441220 3300009094 Bacteria 799
249 Ga0105245_10011473 3300009098 Bacteria 7718
250 Ga0105245_11520527 3300009098 Bacteria 720
251 Ga0105245_12157775 3300009098 Bacteria 611
252 Ga0105247_10294934 3300009101 Bacteria 1123
253 Ga0105247_10888158 3300009101 Unclassified 687
254 Ga0105247_11106579 3300009101 Bacteria 625
255 Ga0114129_10110624 3300009147 Bacteria 3792
256 Ga0114129_10119549 3300009147 Bacteria 3629
257 Ga0114129_10230598 3300009147 Bacteria 2494
258 Ga0114129_10337510 3300009147 Bacteria 2000
259 Ga0114129_13217513 3300009147 Bacteria 531
260 Ga0105243_10003336 3300009148 Bacteria 13028
261 Ga0105243_10474270 3300009148 Bacteria 1179
262 Ga0105243_10763633 3300009148 Bacteria 949
263 Ga0105243_10951691 3300009148 Bacteria 858
264 Ga0105243_11313234 3300009148 Bacteria 741
265 Ga0105243_11974532 3300009148 Unclassified 617
266 Ga0105241_10033574 3300009174 Bacteria 3852
267 Ga0105241_10067871 3300009174 Bacteria 2761
268 Ga0105241_10073986 3300009174 Bacteria 2652
269 Ga0105241_10127553 3300009174 Bacteria 2056
270 Ga0105241_10758275 3300009174 Bacteria 890
271 Ga0105241_11057497 3300009174 Unclassified 762
272 Ga0105241_11279781 3300009174 Unclassified 698
273 Ga0105242_10066917 3300009176 Bacteria 2968
274 Ga0105242_10109530 3300009176 Bacteria 2352
275 Ga0105242_10677977 3300009176 Bacteria 1006
276 Ga0105248_10016927 3300009177 Bacteria 8026
277 Ga0105248_10028955 3300009177 Bacteria 6175
278 Ga0105248_10483503 3300009177 Bacteria 1396
279 Ga0105248_10579562 3300009177 Bacteria 1266
280 Ga0105248_11147345 3300009177 Unclassified 878
281 Ga0105237_10882970 3300009545 Bacteria 901
282 Ga0105237_10988243 3300009545 Bacteria 848
283 Ga0105237_12645985 3300009545 Unclassified 512
284 Ga0105238_10079152 3300009551 Bacteria 3276
285 Ga0105249_10015727 3300009553 Bacteria 6700
286 Ga0105249_10756136 3300009553 Bacteria 1034
287 Ga0105239_10175943 3300010375 Bacteria 2393
288 Ga0105239_10231285 3300010375 Bacteria 2074
289 Ga0105239_10346170 3300010375 Unclassified 1678
290 Ga0105239_10432288 3300010375 Bacteria 1492
291 Ga0105239_10461061 3300010375 Bacteria 1442
292 Ga0105246_10079373 3300011119 Bacteria 2334
293 Ga0105246_10157235 3300011119 Bacteria 1728
294 Ga0105246_11447552 3300011119 Bacteria 643
295 Ga0105246_11473210 3300011119 Bacteria 638
296 Ga0157373_10009101 3300013100 Bacteria 7346
297 Ga0157373_10035950 3300013100 Bacteria 3556
298 Ga0157371_10586673 3300013102 Bacteria 828
299 Ga0157374_10014257 3300013296 Bacteria 6951
300 Ga0157374_10671413 3300013296 Bacteria 1048
301 Ga0157374_11491914 3300013296 Bacteria 699
302 Ga0157378_10005752 3300013297 Bacteria 10859
303 Ga0157378_10059933 3300013297 Bacteria 3396
304 Ga0157378_10123829 3300013297 Bacteria 2386
305 Ga0157378_10131377 3300013297 Bacteria 2318
306 Ga0157378_11542433 3300013297 Bacteria 709
307 Ga0163162_10002137 3300013306 Bacteria 18541
308 Ga0163162_10196265 3300013306 Bacteria 2147
309 Ga0163162_10379754 3300013306 Bacteria 1546
310 Ga0163162_10719202 3300013306 Bacteria 1119
311 Ga0163162_11475222 3300013306 Unclassified 774
312 Ga0163162_12087872 3300013306 Unclassified 650
313 Ga0157372_10078787 3300013307 Bacteria 3724
314 Ga0157372_10532086 3300013307 Unclassified 1370
315 Ga0157372_10940020 3300013307 Unclassified 1002
316 Ga0157372_11020404 3300013307 Bacteria 958
317 Ga0157372_11752379 3300013307 Bacteria 714
318 Ga0157372_12548346 3300013307 Bacteria 587
319 Ga0157375_10019072 3300013308 Bacteria 6229
320 Ga0157375_10215245 3300013308 Bacteria 2079
321 Ga0157375_10290503 3300013308 Bacteria 1798
322 Ga0157375_13339784 3300013308 Bacteria 535
323 Ga0157375_13382193 3300013308 Bacteria 531
324 Ga0163163_10000207 3300014325 Bacteria 60848
325 Ga0163163_10022361 3300014325 Bacteria 5985
326 Ga0163163_10250635 3300014325 Bacteria 1821
327 Ga0163163_10591752 3300014325 Bacteria 1173
328 Ga0157380_10008346 3300014326 Bacteria 7385
329 Ga0157380_10087360 3300014326 Bacteria 2563
330 Ga0157380_10646115 3300014326 Unclassified 1054
331 Ga0157377_10010162 3300014745 Bacteria 4645
332 Ga0157377_10658018 3300014745 Unclassified 755
333 Ga0157379_10396337 3300014968 Bacteria 1268
334 Ga0157379_11152030 3300014968 Bacteria 744
335 Ga0157376_10005546 3300014969 Bacteria 8822
336 Ga0157376_10227162 3300014969 Bacteria 1732
337 Ga0163161_10016716 3300017792 Bacteria 5126
338 Ga0163161_10210736 3300017792 Bacteria 1501
339 Ga0163161_10958153 3300017792 Bacteria 728
340 Ga0213876_10000219 3300021384 Bacteria 57264
341 Ga0207656_10664544 3300025321 Unclassified 533
342 Ga0207682_10108973 3300025893 Bacteria 1217
343 Ga0207642_10077140 3300025899 Bacteria 1606
344 Ga0207642_10099969 3300025899 Bacteria 1454
345 Ga0207642_10301175 3300025899 Bacteria 929
346 Ga0207688_10030150 3300025901 Bacteria 2990
347 Ga0207688_10213824 3300025901 Bacteria 1159
348 Ga0207688_10626503 3300025901 Bacteria 679
349 Ga0207680_11199079 3300025903 Bacteria 541
350 Ga0207647_10513952 3300025904 Bacteria 667
351 Ga0207645_10388183 3300025907 Bacteria 938
352 Ga0207643_10025181 3300025908 Bacteria 3287
353 Ga0207684_10106345 3300025910 Bacteria 2400
354 Ga0207654_10036715 3300025911 Bacteria 2740
355 Ga0207654_10124572 3300025911 Bacteria 1623
356 Ga0207654_10190070 3300025911 Bacteria 1345
357 Ga0207654_10319531 3300025911 Bacteria 1061
358 Ga0207654_11031757 3300025911 Bacteria 598
359 Ga0207707_10000022 3300025912 Bacteria 198808
360 Ga0207707_10123409 3300025912 Bacteria 2265
361 Ga0207695_10403110 3300025913 Bacteria 1252
362 Ga0207671_10005880 3300025914 Bacteria 11137
363 Ga0207660_10000065 3300025917 Bacteria 55387
364 Ga0207660_10006783 3300025917 Bacteria 7416
365 Ga0207662_10007330 3300025918 Bacteria 6000
366 Ga0207662_10094078 3300025918 Bacteria 1848
367 Ga0207662_10181534 3300025918 Bacteria 1354
368 Ga0207662_10474737 3300025918 Bacteria 858
369 Ga0207649_10897953 3300025920 Bacteria 695
370 Ga0207649_11248627 3300025920 Bacteria 587
371 Ga0207652_10000535 3300025921 Bacteria 38543
372 Ga0207652_11871859 3300025921 Bacteria 505
373 Ga0207646_10177524 3300025922 Bacteria 1924
374 Ga0207646_10877974 3300025922 Unclassified 796
375 Ga0207681_10252150 3300025923 Bacteria 1378
376 Ga0207681_11049846 3300025923 Bacteria 684
377 Ga0207681_11509486 3300025923 Unclassified 563
378 Ga0207694_10051102 3300025924 Bacteria 3203
379 Ga0207650_10000022 3300025925 Bacteria 318878
380 Ga0207650_10077523 3300025925 Bacteria 2513
381 Ga0207659_10405080 3300025926 Bacteria 1142
382 Ga0207659_11728932 3300025926 Unclassified 532
383 Ga0207687_10054725 3300025927 Bacteria 2793
384 Ga0207687_11597051 3300025927 Bacteria 560
385 Ga0207644_10247368 3300025931 Bacteria 1421
386 Ga0207690_10702495 3300025932 Bacteria 831
387 Ga0207706_10080446 3300025933 Bacteria 2865
388 Ga0207686_10245950 3300025934 Bacteria 1304
389 Ga0207709_10785982 3300025935 Unclassified 767
390 Ga0207670_10034301 3300025936 Bacteria 3278
391 Ga0207670_10449361 3300025936 Unclassified 1039
392 Ga0207670_10925701 3300025936 Bacteria 731
393 Ga0207670_11090451 3300025936 Bacteria 674
394 Ga0207669_10227355 3300025937 Bacteria 1374
395 Ga0207669_11769660 3300025937 Unclassified 528
396 Ga0207704_10169971 3300025938 Bacteria 1562
397 Ga0207665_10161218 3300025939 Bacteria 1613
398 Ga0207665_10840614 3300025939 Bacteria 726
399 Ga0207691_10002346 3300025940 Bacteria 18532
400 Ga0207691_11320946 3300025940 Bacteria 595
401 Ga0207711_10012742 3300025941 Bacteria 6984
402 Ga0207711_10298656 3300025941 Bacteria 1485
403 Ga0207711_11674446 3300025941 Unclassified 579
404 Ga0207689_10002651 3300025942 Bacteria 16551
405 Ga0207689_10033037 3300025942 Bacteria 4300
406 Ga0207689_10093627 3300025942 Bacteria 2468
407 Ga0207689_10158066 3300025942 Bacteria 1868
408 Ga0207689_10275383 3300025942 Bacteria 1393
409 Ga0207689_10368172 3300025942 Bacteria 1196
410 Ga0207689_10672261 3300025942 Bacteria 873
411 Ga0207689_10866295 3300025942 Bacteria 762
412 Ga0207679_10048298 3300025945 Bacteria 3097
413 Ga0207679_11002815 3300025945 Bacteria 765
414 Ga0207679_11315102 3300025945 Bacteria 663
415 Ga0207679_11413886 3300025945 Bacteria 638
416 Ga0207679_11463162 3300025945 Unclassified 627
417 Ga0207667_10888141 3300025949 Bacteria 884
418 Ga0207651_10037434 3300025960 Bacteria 3178
419 Ga0207651_10427837 3300025960 Bacteria 1131
420 Ga0207651_10987191 3300025960 Bacteria 752
421 Ga0207712_10054053 3300025961 Bacteria 2820
422 Ga0207640_10070041 3300025981 Bacteria 2357
423 Ga0207640_10088814 3300025981 Bacteria 2135
424 Ga0207640_10185440 3300025981 Bacteria 1564
425 Ga0207640_10195516 3300025981 Bacteria 1528
426 Ga0207640_10858498 3300025981 Bacteria 790
427 Ga0207640_11035789 3300025981 Bacteria 723
428 Ga0207640_11682907 3300025981 Bacteria 572
429 Ga0207658_10203866 3300025986 Bacteria 1653
430 Ga0207658_10220065 3300025986 Bacteria 1597
431 Ga0207677_10040785 3300026023 Bacteria 3063
432 Ga0207677_11059485 3300026023 Bacteria 737
433 Ga0207703_10069126 3300026035 Bacteria 2911
434 Ga0207703_10225224 3300026035 Bacteria 1678
435 Ga0207703_10258098 3300026035 Bacteria 1574
436 Ga0207703_10347981 3300026035 Bacteria 1364
437 Ga0207703_10366208 3300026035 Bacteria 1330
438 Ga0207639_10451992 3300026041 Bacteria 1166
439 Ga0207639_10894343 3300026041 Bacteria 830
440 Ga0207639_12224094 3300026041 Bacteria 510
441 Ga0207678_11009743 3300026067 Bacteria 736
442 Ga0207708_10010398 3300026075 Bacteria 6908
443 Ga0207708_10044707 3300026075 Bacteria 3374
444 Ga0207708_10063046 3300026075 Bacteria 2832
445 Ga0207708_10691149 3300026075 Bacteria 871
446 Ga0207708_11664620 3300026075 Unclassified 560
447 Ga0207702_10014545 3300026078 Bacteria 6530
448 Ga0207641_10028688 3300026088 Bacteria 4600
449 Ga0207641_10283015 3300026088 Bacteria 1560
450 Ga0207648_10018811 3300026089 Bacteria 6244
451 Ga0207648_10050399 3300026089 Bacteria 3640
452 Ga0207648_10193181 3300026089 Bacteria 1805
453 Ga0207676_10108174 3300026095 Bacteria 2320
454 Ga0207676_10228203 3300026095 Bacteria 1663
455 Ga0207676_10324740 3300026095 Bacteria 1414
456 Ga0207676_10413683 3300026095 Bacteria 1263
457 Ga0207676_10497392 3300026095 Bacteria 1157
458 Ga0207676_12244443 3300026095 Bacteria 544
459 Ga0207674_10144459 3300026116 Bacteria 2338
460 Ga0207674_10603266 3300026116 Bacteria 1060
461 Ga0207674_10722211 3300026116 Bacteria 962
462 Ga0207674_12164087 3300026116 Bacteria 519
463 Ga0207675_100003179 3300026118 Bacteria 16107
464 Ga0207675_101263421 3300026118 Bacteria 759
465 Ga0207683_10081255 3300026121 Bacteria 2877
466 Ga0207683_10290621 3300026121 Bacteria 1495
467 Ga0207698_10065710 3300026142 Bacteria 2851
468 Ga0207698_10204732 3300026142 Bacteria 1770
469 Ga0207698_10415535 3300026142 Bacteria 1289
470 Ga0268266_10210701 3300028379 Bacteria 1782
471 Ga0268266_11140636 3300028379 Bacteria 754
472 Ga0268265_10064616 3300028380 Bacteria 2820
473 Ga0268265_12224888 3300028380 Bacteria 555
474 Ga0268265_12623269 3300028380 Unclassified 509
475 Ga0268264_10091851 3300028381 Bacteria 2619
476 Ga0268264_10971134 3300028381 Bacteria 855
477 Ga0268264_11366445 3300028381 Bacteria 719
478 Ga0268264_11449013 3300028381 Bacteria 697
479 Ga0268264_11841035 3300028381 Bacteria 615
480 Ga0307515_10626439 3300028794 Unclassified 687
481 Ga0314311_1125260 3300030733 Bacteria 502
482 Ga0316182_1426223 3300030745 Bacteria 531
483 Ga0307513_10031679 3300031456 Bacteria 5983
484 Ga0307408_100535069 3300031548 Bacteria 1031
485 Ga0307408_101200154 3300031548 Bacteria 708
486 Ga0307413_11626841 3300031824 Bacteria 574
487 Ga0307410_10186351 3300031852 Bacteria 1575
488 Ga0307410_10311853 3300031852 Bacteria 1245
489 Ga0307406_10302289 3300031901 Bacteria 1230
490 Ga0307412_11781228 3300031911 Bacteria 566
491 Ga0307409_100866496 3300031995 Bacteria 915
492 Ga0307416_100060322 3300032002 Bacteria 3089
493 Ga0307416_101521518 3300032002 Bacteria 775
494 Ga0307416_102126466 3300032002 Bacteria 663
495 Ga0307414_10159056 3300032004 Bacteria 1792
496 Ga0307414_10252105 3300032004 Bacteria 1468
497 Ga0307415_100539124 3300032126 Bacteria 1028
498 Ga0307415_101777570 3300032126 Bacteria 596
499 Ga0373959_0171230 3300034820 Bacteria 560
500 Ga0373951_0003358 3300035091 Bacteria 3907
501 Ga0373951_0250757 3300035091 Bacteria 532
502 Ga0373952_0119858 3300035092 Bacteria 713
503 Ga0373962_0399089 3300035242 Unclassified 506
504 Ga0373931_0036089 3300035691 Bacteria 2575
505 Ga0395900_0570983 3300037418 Bacteria 1074
506 Ga0395900_0735399 3300037418 Unclassified 918
507 Ga0395898_0309465 3300037466 Bacteria 1507
508 Ga0395898_0556913 3300037466 Bacteria 1089
509 Ga0395905_0001364 3300037471 Bacteria 29717
510 Ga0395905_0048010 3300037471 Bacteria 4001
511 Ga0436364_1053753 3300037853 Bacteria 1268
512 Ga0395901_1231760 3300038443 Bacteria 713
513 Ga0395901_1610336 3300038443 Bacteria 603
514 Ga0242420_002779 3300038996 Bacteria 2532
515 Ga0436365_0227208 3300039437 Bacteria 70252
516 Ga0436365_1477709 3300039437 Bacteria 713
517 Ga0439462_0207631 3300042015 Bacteria 559
518 Ga0466957_0853919 3300044842 Unclassified 649
519 Ga0496102_0567772 3300048905 Bacteria 1057
520 Ga0496103_0139861 3300048906 Bacteria 1548
521 Ga0496104_0161178 3300048907 Bacteria 2152
522 Ga0496104_0471715 3300048907 Bacteria 1166
523 Ga0496105_0738620 3300048908 Bacteria 753
524 Ga0496106_0108227 3300048909 Bacteria 2162
525 Ga0496106_0397117 3300048909 Bacteria 1108
526 Ga0496107_0105184 3300048910 Bacteria 2072
527 Ga0496108_0550061 3300048911 Bacteria 1007
528 Ga0496109_0511268 3300048912 Bacteria 1134
529 Ga0496109_2026704 3300048912 Bacteria 507
530 Ga0496112_0398208 3300048915 Bacteria 1317
531 Ga0496112_0503022 3300048915 Bacteria 1147
532 Ga0496112_0512932 3300048915 Bacteria 1134
533 Ga0496113_0510643 3300048916 Bacteria 965
534 Ga0496113_0531336 3300048916 Bacteria 944
535 Ga0501292_031800 3300049515 Bacteria 889
536 Ga0501072_0369945 3300049588 Bacteria 1138
537 Ga0501207_032378 3300049654 Bacteria 883
538 Ga0501223_014066 3300049663 Bacteria 1589
539 Ga0501227_100550 3300049665 Unclassified 769
540 Ga0501235_061476 3300049669 Bacteria 880
541 Ga0501234_015784 3300049707 Bacteria 1189
542 Ga0501245_011633 3300049708 Bacteria 1282
543 Ga0501245_151427 3300049708 Bacteria 513
544 Ga0501212_007495 3300049851 Bacteria 1497
545 nmdc:mga05p37_200726_c1 3300050507 Bacteria 2416
546 nmdc:mga05p37_442321_c1 3300050507 Bacteria 1507
547 nmdc:mga05p37_813262_c1 3300050507 Bacteria 1020
548 nmdc:mga09592_606743_c1 3300050508 Unclassified 937
549 nmdc:mga08y16_1671648_c1 3300050511 Bacteria 593
550 nmdc:mga08y16_642825_c1 3300050511 Unclassified 1066
551 nmdc:mga08y16_78871_c1 3300050511 Bacteria 3432
552 nmdc:mga0n895_191433_c1 3300050512 Bacteria 2076
553 nmdc:mga0n895_25217_c1 3300050512 Bacteria 5615
554 nmdc:mga0n895_319621_c1 3300050512 Bacteria 1573
555 nmdc:mga0rr50_131385_c1 3300050513 Bacteria 2005
556 nmdc:mga0rr50_75390_c1 3300050513 Bacteria 2585
557 nmdc:mga0a205_111792_c1 3300050515 Bacteria 2631
558 nmdc:mga0a205_225252_c1 3300050515 Bacteria 1760
559 nmdc:mga0a205_238267_c1 3300050515 Bacteria 1701
560 nmdc:mga0a205_347732_c1 3300050515 Bacteria 1350
561 nmdc:mga0a205_45921_c1 3300050515 Bacteria 4213
562 Ga0500616_0038640 3300053153 Bacteria 2577
563 JGI25406J46586_10008199
564 JGI24751J29686_10000094
565 JGI24751J29686_10000191
566 JGI25406J46586_10009747
567 Ga0065704_10166314
568 Ga0065704_10318390
569 Ga0065704_10344944
570 Ga0065712_10001594
571 Ga0065712_10008770
572 Ga0065712_10092796
573 Ga0065712_10117135
574 Ga0065715_10006372
575 Ga0065715_10035979
576 Ga0065715_10113654
577 Ga0065715_10370858
578 Ga0065707_10110364
579 Ga0065707_10115720
580 Ga0065707_10161902
581 Ga0065707_10349622
582 Ga0065707_10982957
583 Ga0070676_10173107
584 Ga0070690_100031910
585 Ga0070690_100251795
586 Ga0070670_100000114
587 Ga0070670_100202830
588 Ga0070670_102124130
589 Ga0070677_10123601
590 Ga0070677_10152345
591 Ga0068869_100082711
592 Ga0068869_100092655
593 Ga0068869_100232030
594 Ga0068869_100400619
595 Ga0068869_100441205
596 Ga0068869_100712543
597 Ga0068869_101432929
598 Ga0068869_101933482
599 Ga0070666_10889211
600 Ga0070680_100002508
601 Ga0070680_100026929
602 Ga0070682_100245325
603 Ga0070682_100375511
604 Ga0070682_101035313
605 Ga0070682_101745188
606 Ga0068868_100057087
607 Ga0070689_100118039
608 Ga0070689_100291797
609 Ga0070689_100542544
610 Ga0070691_10831239
611 Ga0070687_100004445
612 Ga0070692_10003489
613 Ga0070692_10299986
614 Ga0070692_10521935
615 Ga0070692_11328743
616 Ga0070669_100082872
617 Ga0070669_100592515
618 Ga0070669_100974702
619 Ga0070671_100047086
620 Ga0070671_100062474
621 Ga0070671_101731503
622 Ga0070674_100123350
623 Ga0070674_101906980
624 Ga0070673_100013883
625 Ga0070673_100022513
626 Ga0070673_100098072
627 Ga0070673_100208783
628 Ga0070673_100716726
629 Ga0070673_101975493
630 Ga0070688_100007548
631 Ga0070688_101196060
632 Ga0070688_101198862
633 Ga0070667_100019627
634 Ga0070667_100822965
635 Ga0070705_100063982
636 Ga0070705_100275934
637 Ga0070705_100298243
638 Ga0070705_100760602
639 Ga0070700_100057090
640 Ga0070700_100084636
641 Ga0070700_100635904
642 Ga0070694_100008814
643 Ga0070694_100018231
644 Ga0070694_100045829
645 Ga0070694_100214237
646 Ga0070694_100897133
647 Ga0070694_100930945
648 Ga0070708_100059397
649 Ga0070663_100639843
650 Ga0070678_100370671
651 Ga0070662_101088713
652 Ga0070681_10000346
653 Ga0068867_100024313
654 Ga0068867_100143435
655 Ga0068867_100725168
656 Ga0070685_11272566
657 Ga0070706_100125170
658 Ga0070706_102135232
659 Ga0070707_100087597
660 Ga0070707_100233032
661 Ga0070698_100094420
662 Ga0070698_100110266
663 Ga0070699_100073853
664 Ga0070699_100450327
665 Ga0070699_100641724
666 Ga0070699_101346496
667 Ga0070679_100000167
668 Ga0070684_100382658
669 Ga0070697_100082363
670 Ga0070697_100477605
671 Ga0070697_101003395
672 Ga0070697_101125616
673 Ga0068853_100836185
674 Ga0068853_102071609
675 Ga0070672_101572669
676 Ga0070672_101646845
677 Ga0070686_100007097
678 Ga0070686_100030023
679 Ga0070695_100099744
680 Ga0070695_100261927
681 Ga0070695_100436320
682 Ga0070695_100603847
683 Ga0070695_101299971
684 Ga0070696_100040651
685 Ga0070696_100462463
686 Ga0070696_100802713
687 Ga0070693_100014447
688 Ga0070693_100053043
689 Ga0070693_100835127
690 Ga0070665_101619932
691 Ga0070665_102229584
692 Ga0070704_100141554
693 Ga0070704_100466776
694 Ga0070704_100489050
695 Ga0070704_101367714
696 Ga0070704_101615598
697 Ga0070664_100188309
698 Ga0070664_101229272
699 Ga0068857_100711339
700 Ga0068857_102426174
701 Ga0068854_100039640
702 Ga0068854_100091612
703 Ga0068854_100293181
704 Ga0068854_100388898
705 Ga0068854_100458041
706 Ga0068856_100002768
707 Ga0070702_100001012
708 Ga0070702_100027311
709 Ga0068852_100086572
710 Ga0068852_100099748
711 Ga0068852_100690134
712 Ga0068852_101190245
713 Ga0068852_102003857
714 Ga0068852_102636758
715 Ga0068859_100018948
716 Ga0068859_100047567
717 Ga0068859_100075160
718 Ga0068859_100171835
719 Ga0068859_100228440
720 Ga0068859_100253471
721 Ga0068859_100309465
722 Ga0068859_100392449
723 Ga0068859_100452962
724 Ga0068859_100861888
725 Ga0068859_100976930
726 Ga0068859_101277599
727 Ga0068859_101328588
728 Ga0068859_101678531
729 Ga0068859_101834971
730 Ga0068859_102876146
731 Ga0068864_100028159
732 Ga0068864_100181690
733 Ga0068864_100231112
734 Ga0068864_100468868
735 Ga0068864_100925489
736 Ga0068866_10012150
737 Ga0068866_10016776
738 Ga0068866_11449659
739 Ga0068861_100135781
740 Ga0068861_100240181
741 Ga0068861_101384485
742 Ga0068851_10050015
743 Ga0068870_10371885
744 Ga0068863_100249452
745 Ga0068863_100478207
746 Ga0068858_100085310
747 Ga0068858_100145576
748 Ga0068858_100519328
749 Ga0068858_102440513
750 Ga0068860_100013884
751 Ga0068860_100124479
752 Ga0068860_100609209
753 Ga0068860_100697240
754 Ga0068860_102410676
755 Ga0068862_100013449
756 Ga0068862_100194314
757 Ga0068862_100312111
758 Ga0081539_10000156
759 Ga0081539_10006451
760 Ga0070716_100065375
761 Ga0070716_101026682
762 Ga0097621_100007317
763 Ga0097621_100082998
764 Ga0068871_100003671
765 Ga0068871_100004971
766 Ga0068871_100480521
767 Ga0075428_100908941
768 Ga0075428_101069017
769 Ga0075430_100064925
770 Ga0075431_100082205
771 Ga0075433_10073858
772 Ga0075433_10147413
773 Ga0075433_10369873
774 Ga0075433_11196624
775 Ga0075434_100265582
776 Ga0075434_100827680
777 Ga0075434_101632481
778 Ga0075434_102116580
779 Ga0075429_100013969
780 Ga0075429_100130410
781 Ga0075429_101699964
782 Ga0068865_100026316
783 Ga0068865_100990594
784 Ga0075436_101455849
785 Ga0097620_100018948
786 Ga0097620_100047563
787 Ga0097620_100075163
788 Ga0097620_100171834
789 Ga0097620_100228433
790 Ga0097620_100253466
791 Ga0097620_100309432
792 Ga0097620_100392461
793 Ga0097620_100422345
794 Ga0097620_100452934
795 Ga0097620_100721883
796 Ga0097620_100861837
797 Ga0097620_100976934
798 Ga0097620_101277706
799 Ga0097620_101328522
800 Ga0097620_101678650
801 Ga0097620_101835108
802 Ga0097620_102876086
803 Ga0075435_100087628
804 Ga0105250_10418703
805 Ga0105240_10843118
806 Ga0105240_11083715
807 Ga0105240_11274181
808 Ga0111539_10074896
809 Ga0111539_11301083
810 Ga0111539_11441220
811 Ga0105245_10011473
812 Ga0105245_11520527
813 Ga0105245_12157775
814 Ga0105247_10294934
815 Ga0105247_10888158
816 Ga0105247_11106579
817 Ga0114129_10110624
818 Ga0114129_10119549
819 Ga0114129_10230598
820 Ga0114129_10337510
821 Ga0114129_13217513
822 Ga0105243_10003336
823 Ga0105243_10474270
824 Ga0105243_10763633
825 Ga0105243_10951691
826 Ga0105243_11313234
827 Ga0105243_11974532
828 Ga0105241_10033574
829 Ga0105241_10067871
830 Ga0105241_10073986
831 Ga0105241_10127553
832 Ga0105241_10758275
833 Ga0105241_11057497
834 Ga0105241_11279781
835 Ga0105242_10066917
836 Ga0105242_10109530
837 Ga0105242_10677977
838 Ga0105248_10016927
839 Ga0105248_10028955
840 Ga0105248_10483503
841 Ga0105248_10579562
842 Ga0105248_11147345
843 Ga0105237_10882970
844 Ga0105237_10988243
845 Ga0105237_12645985
846 Ga0105238_10079152
847 Ga0105249_10015727
848 Ga0105249_10756136
849 Ga0105239_10175943
850 Ga0105239_10231285
851 Ga0105239_10346170
852 Ga0105239_10432288
853 Ga0105239_10461061
854 Ga0105246_10079373
855 Ga0105246_10157235
856 Ga0105246_11447552
857 Ga0105246_11473210
858 Ga0157373_10009101
859 Ga0157373_10035950
860 Ga0157371_10586673
861 Ga0157374_10014257
862 Ga0157374_10671413
863 Ga0157374_11491914
864 Ga0157378_10005752
865 Ga0157378_10059933
866 Ga0157378_10123829
867 Ga0157378_10131377
868 Ga0157378_11542433
869 Ga0163162_10002137
870 Ga0163162_10196265
871 Ga0163162_10379754
872 Ga0163162_10719202
873 Ga0163162_11475222
874 Ga0163162_12087872
875 Ga0157372_10078787
876 Ga0157372_10532086
877 Ga0157372_10940020
878 Ga0157372_11020404
879 Ga0157372_11752379
880 Ga0157372_12548346
881 Ga0157375_10019072
882 Ga0157375_10215245
883 Ga0157375_10290503
884 Ga0157375_13339784
885 Ga0157375_13382193
886 Ga0163163_10000207
887 Ga0163163_10022361
888 Ga0163163_10250635
889 Ga0163163_10591752
890 Ga0157380_10008346
891 Ga0157380_10087360
892 Ga0157380_10646115
893 Ga0157377_10010162
894 Ga0157377_10658018
895 Ga0157379_10396337
896 Ga0157379_11152030
897 Ga0157376_10005546
898 Ga0157376_10227162
899 Ga0163161_10016716
900 Ga0163161_10210736
901 Ga0163161_10958153
902 Ga0213876_10000219
903 Ga0207656_10664544
904 Ga0207682_10108973
905 Ga0207642_10077140
906 Ga0207642_10099969
907 Ga0207642_10301175
908 Ga0207688_10030150
909 Ga0207688_10213824
910 Ga0207688_10626503
911 Ga0207680_11199079
912 Ga0207647_10513952
913 Ga0207645_10388183
914 Ga0207643_10025181
915 Ga0207684_10106345
916 Ga0207654_10036715
917 Ga0207654_10124572
918 Ga0207654_10190070
919 Ga0207654_10319531
920 Ga0207654_11031757
921 Ga0207707_10000022
922 Ga0207707_10123409
923 Ga0207695_10403110
924 Ga0207671_10005880
925 Ga0207660_10000065
926 Ga0207660_10006783
927 Ga0207662_10007330
928 Ga0207662_10094078
929 Ga0207662_10181534
930 Ga0207662_10474737
931 Ga0207649_10897953
932 Ga0207649_11248627
933 Ga0207652_10000535
934 Ga0207652_11871859
935 Ga0207646_10177524
936 Ga0207646_10877974
937 Ga0207681_10252150
938 Ga0207681_11049846
939 Ga0207681_11509486
940 Ga0207694_10051102
941 Ga0207650_10000022
942 Ga0207650_10077523
943 Ga0207659_10405080
944 Ga0207659_11728932
945 Ga0207687_10054725
946 Ga0207687_11597051
947 Ga0207644_10247368
948 Ga0207690_10702495
949 Ga0207706_10080446
950 Ga0207686_10245950
951 Ga0207709_10785982
952 Ga0207670_10034301
953 Ga0207670_10449361
954 Ga0207670_10925701
955 Ga0207670_11090451
956 Ga0207669_10227355
957 Ga0207669_11769660
958 Ga0207704_10169971
959 Ga0207665_10161218
960 Ga0207665_10840614
961 Ga0207691_10002346
962 Ga0207691_11320946
963 Ga0207711_10012742
964 Ga0207711_10298656
965 Ga0207711_11674446
966 Ga0207689_10002651
967 Ga0207689_10033037
968 Ga0207689_10093627
969 Ga0207689_10158066
970 Ga0207689_10275383
971 Ga0207689_10368172
972 Ga0207689_10672261
973 Ga0207689_10866295
974 Ga0207679_10048298
975 Ga0207679_11002815
976 Ga0207679_11315102
977 Ga0207679_11413886
978 Ga0207679_11463162
979 Ga0207667_10888141
980 Ga0207651_10037434
981 Ga0207651_10427837
982 Ga0207651_10987191
983 Ga0207712_10054053
984 Ga0207640_10070041
985 Ga0207640_10088814
986 Ga0207640_10185440
987 Ga0207640_10195516
988 Ga0207640_10858498
989 Ga0207640_11035789
990 Ga0207640_11682907
991 Ga0207658_10203866
992 Ga0207658_10220065
993 Ga0207677_10040785
994 Ga0207677_11059485
995 Ga0207703_10069126
996 Ga0207703_10225224
997 Ga0207703_10258098
998 Ga0207703_10347981
999 Ga0207703_10366208
1000 Ga0207639_10451992
1001 Ga0207639_10894343
1002 Ga0207639_12224094
1003 Ga0207678_11009743
1004 Ga0207708_10010398
1005 Ga0207708_10044707
1006 Ga0207708_10063046
1007 Ga0207708_10691149
1008 Ga0207708_11664620
1009 Ga0207702_10014545
1010 Ga0207641_10028688
1011 Ga0207641_10283015
1012 Ga0207648_10018811
1013 Ga0207648_10050399
1014 Ga0207648_10193181
1015 Ga0207676_10108174
1016 Ga0207676_10228203
1017 Ga0207676_10324740
1018 Ga0207676_10413683
1019 Ga0207676_10497392
1020 Ga0207676_12244443
1021 Ga0207674_10144459
1022 Ga0207674_10603266
1023 Ga0207674_10722211
1024 Ga0207674_12164087
1025 Ga0207675_100003179
1026 Ga0207675_101263421
1027 Ga0207683_10081255
1028 Ga0207683_10290621
1029 Ga0207698_10065710
1030 Ga0207698_10204732
1031 Ga0207698_10415535
1032 Ga0268266_10210701
1033 Ga0268266_11140636
1034 Ga0268265_10064616
1035 Ga0268265_12224888
1036 Ga0268265_12623269
1037 Ga0268264_10091851
1038 Ga0268264_10971134
1039 Ga0268264_11366445
1040 Ga0268264_11449013
1041 Ga0268264_11841035
1042 Ga0307515_10626439
1043 Ga0314311_1125260
1044 Ga0316182_1426223
1045 Ga0307513_10031679
1046 Ga0307408_100535069
1047 Ga0307408_101200154
1048 Ga0307413_11626841
1049 Ga0307410_10186351
1050 Ga0307410_10311853
1051 Ga0307406_10302289
1052 Ga0307412_11781228
1053 Ga0307409_100866496
1054 Ga0307416_100060322
1055 Ga0307416_101521518
1056 Ga0307416_102126466
1057 Ga0307414_10159056
1058 Ga0307414_10252105
1059 Ga0307415_100539124
1060 Ga0307415_101777570
1061 Ga0373959_0171230
1062 Ga0373951_0003358
1063 Ga0373951_0250757
1064 Ga0373952_0119858
1065 Ga0373962_0399089
1066 Ga0373931_0036089
1067 Ga0395900_0570983
1068 Ga0395900_0735399
1069 Ga0395898_0309465
1070 Ga0395898_0556913
1071 Ga0395905_0001364
1072 Ga0395905_0048010
1073 Ga0436364_1053753
1074 Ga0395901_1231760
1075 Ga0395901_1610336
1076 Ga0242420_002779
1077 Ga0436365_0227208
1078 Ga0436365_1477709
1079 Ga0439462_0207631
1080 Ga0466957_0853919
1081 Ga0496102_0567772
1082 Ga0496103_0139861
1083 Ga0496104_0161178
1084 Ga0496104_0471715
1085 Ga0496105_0738620
1086 Ga0496106_0108227
1087 Ga0496106_0397117
1088 Ga0496107_0105184
1089 Ga0496108_0550061
1090 Ga0496109_0511268
1091 Ga0496109_2026704
1092 Ga0496112_0398208
1093 Ga0496112_0503022
1094 Ga0496112_0512932
1095 Ga0496113_0510643
1096 Ga0496113_0531336
1097 Ga0501292_031800
1098 Ga0501072_0369945
1099 Ga0501207_032378
1100 Ga0501223_014066
1101 Ga0501227_100550
1102 Ga0501235_061476
1103 Ga0501234_015784
1104 Ga0501245_011633
1105 Ga0501245_151427
1106 Ga0501212_007495
1107 nmdc:mga05p37_200726_c1
1108 nmdc:mga05p37_442321_c1
1109 nmdc:mga05p37_813262_c1
1110 nmdc:mga09592_606743_c1
1111 nmdc:mga08y16_1671648_c1
1112 nmdc:mga08y16_642825_c1
1113 nmdc:mga08y16_78871_c1
1114 nmdc:mga0n895_191433_c1
1115 nmdc:mga0n895_25217_c1
1116 nmdc:mga0n895_319621_c1
1117 nmdc:mga0rr50_131385_c1
1118 nmdc:mga0rr50_75390_c1
1119 nmdc:mga0a205_111792_c1
1120 nmdc:mga0a205_225252_c1
1121 nmdc:mga0a205_238267_c1
1122 nmdc:mga0a205_347732_c1
1123 nmdc:mga0a205_45921_c1
1124 Ga0500616_0038640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02954

HTH_8

Bacterial regulatory protein, Fis family

24

65

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l5e-assembly1.cif.gz_A-2 crystal structure of a. aeolicus ntrc1 dna binding domain 0.964 24 64
6g1d-assembly1.cif.gz_C corynebacterium glutamicum oxyr c206 mutant 0.9553 34 65
6g1d-assembly1.cif.gz_B corynebacterium glutamicum oxyr c206 mutant 0.9425 34 65
6g4r-assembly1.cif.gz_B corynebacterium glutamicum oxyr c206s mutant, h2o2-bound 0.942 34 65
7dwo-assembly1.cif.gz_A crystal structure of vibrio fischeri darr in complex with dna reveals the transcriptional activation mechanism of lttr family members 0.9381 34 66
ID Description Score Start End Superfamily
3rqiA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9882 26 58 1.10.10.60
af_Q47005_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9758 42 66 1.10.10.10
3e7lC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9661 17 64 1.10.10.60
af_P9WMH5_174_242_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9647 41 66 1.10.10.10
4l5eA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.964 24 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1W6Z6Z8-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.972 17 69 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2D7DQ24-F1-model_v4 deleted 0.9702 4 64
AF-A0A6H0KCU8-F1-model_v4 deleted 0.9595 15 64
AF-A0A7W5LQW1-F1-model_v4 Transcriptional regulator with PAS, ATPase and Fis domain 0.9496 17 64 GO:0000160
GO:0005524
GO:0006355
GO:0043565
AF-A0A524LG60-F1-model_v4 Sigma-54 factor interaction domain-containing protein 0.9479 4 64 GO:0005524
GO:0006355
GO:0043565

Map