F463229

General Info

Members Datasets Scaffolds Average Seq Length
556 293 524 124

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10039518|Ga0316575_100395182
Length 149
Sequence LSGSSARISDTNRGKDKKGGLALARIAGVDLPRRKRIEVGLTYIYGIGPCISKRILQQLSINPDTKTDDLSEVEINSIRKLIDKDYKVEGELRTEVSMNIKRLMDLGSYRGLRHRKSLPVRGQRTSTNARTRKGPRRSAIKKKGGVKKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
6 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
7 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
8 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
17 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
18 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
19 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
20 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
21 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
22 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
23 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
24 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
25 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
26 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
27 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
28 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
29 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
30 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
36 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
117 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
118 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
166 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
167 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
168 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
169 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
170 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
171 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
172 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
173 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
174 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
175 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
176 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
247 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
254 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
255 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
256 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
290 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
291 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
292 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
293 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.45
Metatranscriptomes 26.8
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 1.08
Rhizoplane 2.16
Rhizosphere 79.5
Stem 0
Stem Tuber 0
Unclassified 14.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2194807 2162886007 Bacteria 1205
2 2214800779 2209111006 Bacteria 2080
3 Ga0006759J45824_1055651 3300003163 Bacteria 528
4 Ga0006770J48903_1032151 3300003305 Bacteria 1125
5 rootH2_10088212 3300003320 Bacteria 1950
6 Ga0006562J51391_1003423 3300003578 Bacteria 13910
7 Ga0058860_10114316 3300004801 Bacteria 13584
8 Ga0065717_1001968 3300005276 Bacteria 4650
9 Ga0065716_1002480 3300005277 Bacteria 1749
10 Ga0065714_10025944 3300005288 Bacteria 1249
11 Ga0065714_10042876 3300005288 Bacteria 515
12 Ga0065704_10082398 3300005289 Bacteria 3606
13 Ga0065704_10102101 3300005289 Bacteria 2215
14 Ga0065715_10036832 3300005293 Bacteria 2618
15 Ga0065715_10041344 3300005293 Bacteria 823
16 Ga0065715_10068655 3300005293 Bacteria 502
17 Ga0065715_10163470 3300005293 Bacteria 1593
18 Ga0065715_11166518 3300005293 Bacteria 505
19 Ga0070670_100135400 3300005331 Bacteria 2129
20 Ga0070682_100014403 3300005337 Bacteria 4569
21 Ga0070682_100313456 3300005337 Bacteria 1156
22 Ga0070682_101077147 3300005337 Bacteria 671
23 Ga0070682_101512104 3300005337 Bacteria 578
24 Ga0070692_10963833 3300005345 Bacteria 594
25 Ga0070659_101008212 3300005366 Bacteria 731
26 Ga0070667_100269037 3300005367 Bacteria 1528
27 Ga0070700_101201795 3300005441 Bacteria 633
28 Ga0070694_100043859 3300005444 Bacteria 2992
29 Ga0070685_10260034 3300005466 Bacteria 1154
30 Ga0070684_100076178 3300005535 Bacteria 2961
31 Ga0070693_100169224 3300005547 Bacteria 1398
32 Ga0070693_101062405 3300005547 Bacteria 616
33 Ga0070665_100178604 3300005548 Bacteria 2124
34 Ga0070665_101405649 3300005548 Bacteria 707
35 Ga0068855_100000266 3300005563 Bacteria 65127
36 Ga0068855_100585338 3300005563 Bacteria 1205
37 Ga0068856_100184992 3300005614 Bacteria 2097
38 Ga0068866_11328912 3300005718 Bacteria 523
39 Ga0068861_100150704 3300005719 Bacteria 1908
40 Ga0068870_10096798 3300005840 Bacteria 1660
41 Ga0068863_100605478 3300005841 Bacteria 1085
42 Ga0070716_100062251 3300006173 Bacteria 2163
43 Ga0075362_10012264 3300006177 Bacteria 3401
44 Ga0075366_10454452 3300006195 Bacteria 790
45 Ga0075366_10705138 3300006195 Bacteria 627
46 Ga0097621_100207019 3300006237 Bacteria 1705
47 Ga0097621_101038106 3300006237 Bacteria 768
48 Ga0075370_10246110 3300006353 Bacteria 1059
49 Ga0075428_101191413 3300006844 Bacteria 803
50 Ga0075429_100581559 3300006880 Bacteria 981
51 Ga0075436_100044416 3300006914 Bacteria 3064
52 Ga0099824_1003374 3300006942 Bacteria 23361
53 Ga0079104_1000280 3300006946 Bacteria 65859
54 Ga0099826_10000125 3300006948 Bacteria 34471
55 Ga0105251_10038077 3300009011 Bacteria 2357
56 Ga0105244_10000027 3300009036 Bacteria 207569
57 Ga0105250_10391215 3300009092 Bacteria 615
58 Ga0105240_10294524 3300009093 Bacteria 1859
59 Ga0111539_10052091 3300009094 Bacteria 4873
60 Ga0111539_10414510 3300009094 Bacteria 1569
61 Ga0111539_10610521 3300009094 Bacteria 1270
62 Ga0111539_11817012 3300009094 Bacteria 707
63 Ga0105238_10472531 3300009551 Bacteria 1252
64 Ga0157373_10001369 3300013100 Bacteria 18710
65 Ga0157371_10001678 3300013102 Bacteria 22612
66 Ga0157371_10492659 3300013102 Bacteria 904
67 Ga0157370_10073063 3300013104 Bacteria 3236
68 Ga0157370_10106885 3300013104 Bacteria 2618
69 Ga0157370_10218418 3300013104 Bacteria 1766
70 Ga0157370_10316188 3300013104 Bacteria 1441
71 Ga0157370_11190464 3300013104 Bacteria 688
72 Ga0157370_12059252 3300013104 Bacteria 512
73 Ga0157369_10000613 3300013105 Bacteria 46357
74 Ga0157378_11618085 3300013297 Bacteria 694
75 Ga0163162_10022452 3300013306 Bacteria 6216
76 Ga0157375_11032639 3300013308 Bacteria 960
77 Ga0163163_10624074 3300014325 Bacteria 1141
78 Ga0157380_11594516 3300014326 Bacteria 708
79 Ga0182008_10300387 3300014497 Bacteria 840
80 Ga0157376_10261956 3300014969 Bacteria 1620
81 Ga0182006_1009290 3300015261 Bacteria 4412
82 Ga0182006_1062134 3300015261 Bacteria 1406
83 Ga0182006_1242266 3300015261 Bacteria 592
84 Ga0163161_10000039 3300017792 Bacteria 148130
85 Ga0163161_10009312 3300017792 Bacteria 6794
86 Ga0163161_10317631 3300017792 Bacteria 1230
87 Ga0206356_11535795 3300020070 Bacteria 1012
88 Ga0206351_10991482 3300020077 Bacteria 3143
89 Ga0206352_10855877 3300020078 Bacteria 794
90 Ga0207655_1000038 3300025728 Bacteria 348340
91 Ga0207705_11074582 3300025909 Bacteria 620
92 Ga0207695_10512058 3300025913 Bacteria 1082
93 Ga0207690_10762923 3300025932 Bacteria 798
94 Ga0207704_10563187 3300025938 Bacteria 928
95 Ga0207665_10034201 3300025939 Bacteria 3373
96 Ga0207667_10002028 3300025949 Bacteria 25387
97 Ga0207667_11480608 3300025949 Bacteria 650
98 Ga0207640_10268750 3300025981 Bacteria 1333
99 Ga0207658_10283042 3300025986 Bacteria 1422
100 Ga0207658_10494531 3300025986 Bacteria 1089
101 Ga0207678_10265484 3300026067 Bacteria 1471
102 Ga0207708_10079820 3300026075 Bacteria 2514
103 Ga0207702_10965924 3300026078 Bacteria 845
104 Ga0207641_10489061 3300026088 Bacteria 1194
105 Ga0207641_10549673 3300026088 Bacteria 1126
106 Ga0207675_100142829 3300026118 Bacteria 2275
107 Ga0207675_101412797 3300026118 Bacteria 717
108 Ga0209281_1000337 3300027111 Bacteria 79938
109 Ga0209969_1034203 3300027360 Bacteria 781
110 Ga0209489_111364 3300027361 Bacteria 9138
111 Ga0209968_1030260 3300027526 Bacteria 904
112 Ga0209999_1008578 3300027543 Bacteria 1845
113 Ga0210002_1004025 3300027617 Bacteria 2181
114 Ga0209282_1014100 3300027666 Bacteria 5087
115 Ga0209974_10095230 3300027876 Bacteria 1036
116 Ga0207428_10295979 3300027907 Bacteria 1198
117 Ga0265337_1001901 3300028556 Bacteria 9942
118 Ga0265334_10026835 3300028573 Bacteria 2322
119 Ga0307515_10372371 3300028794 Bacteria 1064
120 Ga0316177_1046974 3300030731 Bacteria 993
121 Ga0316179_1001570 3300030734 Bacteria 581
122 Ga0316183_1071033 3300030742 Bacteria 879
123 Ga0316181_1007760 3300030744 Bacteria 1229
124 Ga0265332_10007637 3300031238 Bacteria 4886
125 Ga0265320_10001512 3300031240 Bacteria 16930
126 Ga0265339_10005033 3300031249 Bacteria 8891
127 Ga0265331_10111421 3300031250 Bacteria 1255
128 Ga0265316_10008237 3300031344 Bacteria 9701
129 Ga0307513_10502075 3300031456 Bacteria 930
130 Ga0307408_100015317 3300031548 Bacteria 5105
131 Ga0307508_10036327 3300031616 Bacteria 4436
132 Ga0316575_10000149 3300031665 Bacteria 17798
133 Ga0316575_10001226 3300031665 Bacteria 8137
134 Ga0316575_10004586 3300031665 Bacteria 4865
135 Ga0316575_10039518 3300031665 Bacteria 1862
136 Ga0316575_10153189 3300031665 Bacteria 952
137 Ga0316575_10163129 3300031665 Bacteria 922
138 Ga0316575_10208125 3300031665 Bacteria 815
139 Ga0316575_10237569 3300031665 Bacteria 763
140 Ga0316579_10002340 3300031691 Bacteria 7159
141 Ga0316579_10024561 3300031691 Bacteria 2715
142 Ga0316579_10052226 3300031691 Bacteria 1914
143 Ga0316579_10073335 3300031691 Bacteria 1624
144 Ga0316579_10183841 3300031691 Bacteria 1011
145 Ga0265314_10000003 3300031711 Bacteria 1653386
146 Ga0265314_10008394 3300031711 Bacteria 8853
147 Ga0265314_10564153 3300031711 Bacteria 591
148 Ga0316576_10004459 3300031727 Bacteria 8400
149 Ga0316576_10102441 3300031727 Bacteria 2141
150 Ga0316576_10181947 3300031727 Bacteria 1585
151 Ga0316576_10217851 3300031727 Bacteria 1436
152 Ga0316576_10483275 3300031727 Bacteria 912
153 Ga0316576_10555152 3300031727 Bacteria 841
154 Ga0316576_10934201 3300031727 Bacteria 620
155 Ga0316578_10000551 3300031728 Bacteria 12895
156 Ga0316578_10018044 3300031728 Bacteria 3856
157 Ga0316578_10023200 3300031728 Bacteria 3471
158 Ga0316578_10031535 3300031728 Bacteria 3020
159 Ga0316578_10036494 3300031728 Bacteria 2828
160 Ga0316578_10045538 3300031728 Bacteria 2554
161 Ga0316578_10083874 3300031728 Bacteria 1898
162 Ga0316578_10276204 3300031728 Bacteria 1006
163 Ga0316578_10324371 3300031728 Bacteria 919
164 Ga0307516_10009446 3300031730 Bacteria 10868
165 Ga0307405_10000005 3300031731 Bacteria 376536
166 Ga0307405_10458504 3300031731 Bacteria 1012
167 Ga0316577_10012414 3300031733 Bacteria 4641
168 Ga0316577_10038851 3300031733 Bacteria 2663
169 Ga0316577_10039079 3300031733 Bacteria 2655
170 Ga0316577_10067164 3300031733 Bacteria 2001
171 Ga0316577_10087820 3300031733 Bacteria 1740
172 Ga0316577_10180186 3300031733 Bacteria 1193
173 Ga0316577_10407017 3300031733 Bacteria 773
174 Ga0307413_10001014 3300031824 Bacteria 10155
175 Ga0307413_10001307 3300031824 Bacteria 9311
176 Ga0307413_11018250 3300031824 Bacteria 711
177 Ga0307410_10000034 3300031852 Bacteria 48449
178 Ga0307406_10000004 3300031901 Bacteria 179772
179 Ga0307407_10000196 3300031903 Bacteria 18233
180 Ga0307412_10007950 3300031911 Bacteria 6045
181 Ga0307412_10014189 3300031911 Bacteria 4692
182 Ga0307416_100010892 3300032002 Bacteria 6031
183 Ga0307414_10000011 3300032004 Bacteria 338253
184 Ga0307414_10000673 3300032004 Bacteria 17502
185 Ga0307414_10019816 3300032004 Bacteria 4178
186 Ga0307414_10043096 3300032004 Bacteria 3071
187 Ga0307414_10125747 3300032004 Bacteria 1980
188 Ga0307414_10315779 3300032004 Bacteria 1328
189 Ga0307414_10402286 3300032004 Bacteria 1189
190 Ga0307411_10000004 3300032005 Bacteria 460327
191 Ga0307411_10189460 3300032005 Bacteria 1569
192 Ga0307411_10855941 3300032005 Bacteria 805
193 Ga0307415_100359982 3300032126 Bacteria 1228
194 Ga0316583_10004307 3300032133 Bacteria 5075
195 Ga0316583_10022138 3300032133 Bacteria 2277
196 Ga0316583_10087149 3300032133 Bacteria 1090
197 Ga0316583_10126206 3300032133 Unclassified 892
198 Ga0316585_10000257 3300032137 Bacteria 11433
199 Ga0316585_10078970 3300032137 Bacteria 1071
200 Ga0316580_10001569 3300032139 Bacteria 6027
201 Ga0316580_10164116 3300032139 Bacteria 682
202 Ga0316580_10219907 3300032139 Unclassified 586
203 Ga0316593_10000043 3300032168 Bacteria 13880
204 Ga0316593_10000056 3300032168 Bacteria 12817
205 Ga0316593_10000122 3300032168 Bacteria 10489
206 Ga0316593_10002146 3300032168 Bacteria 4599
207 Ga0316593_10002854 3300032168 Bacteria 4188
208 Ga0316593_10004277 3300032168 Bacteria 3652
209 Ga0316593_10005053 3300032168 Bacteria 3445
210 Ga0316593_10006583 3300032168 Bacteria 3144
211 Ga0316593_10006629 3300032168 Bacteria 3137
212 Ga0316593_10007530 3300032168 Bacteria 2994
213 Ga0316593_10007701 3300032168 Bacteria 2966
214 Ga0316593_10016226 3300032168 Bacteria 2254
215 Ga0316593_10023631 3300032168 Bacteria 1942
216 Ga0316593_10035501 3300032168 Bacteria 1640
217 Ga0316593_10035731 3300032168 Bacteria 1636
218 Ga0316593_10041560 3300032168 Bacteria 1530
219 Ga0316593_10043846 3300032168 Bacteria 1495
220 Ga0316593_10064721 3300032168 Bacteria 1256
221 Ga0316593_10122060 3300032168 Bacteria 936
222 Ga0316593_10206720 3300032168 Bacteria 727
223 Ga0316593_10253337 3300032168 Bacteria 659
224 Ga0316593_10271923 3300032168 Bacteria 637
225 Ga0316593_10277543 3300032168 Bacteria 631
226 Ga0316593_10285207 3300032168 Bacteria 623
227 Ga0316593_10394852 3300032168 Bacteria 534
228 Ga0316593_10421790 3300032168 Bacteria 518
229 Ga0307510_10030428 3300033180 Bacteria 6119
230 Ga0316592_1007152 3300033524 Bacteria 2172
231 Ga0316592_1007747 3300033524 Bacteria 2103
232 Ga0316592_1013208 3300033524 Bacteria 1700
233 Ga0316592_1052294 3300033524 Bacteria 913
234 Ga0316592_1064707 3300033524 Bacteria 823
235 Ga0316592_1072240 3300033524 Unclassified 781
236 Ga0316592_1082406 3300033524 Bacteria 732
237 Ga0316592_1093090 3300033524 Bacteria 690
238 Ga0316592_1113639 3300033524 Bacteria 627
239 Ga0316592_1149544 3300033524 Unclassified 550
240 Ga0316592_1174028 3300033524 Bacteria 513
241 Ga0316586_1009254 3300033527 Bacteria 1474
242 Ga0316586_1068067 3300033527 Bacteria 653
243 Ga0316588_1000859 3300033528 Bacteria 4615
244 Ga0316588_1001747 3300033528 Bacteria 3653
245 Ga0316588_1003151 3300033528 Bacteria 2970
246 Ga0316588_1006369 3300033528 Unclassified 2357
247 Ga0316588_1020308 3300033528 Bacteria 1503
248 Ga0316588_1020631 3300033528 Bacteria 1493
249 Ga0316588_1021213 3300033528 Bacteria 1477
250 Ga0316588_1026533 3300033528 Bacteria 1342
251 Ga0316588_1049262 3300033528 Bacteria 1020
252 Ga0316588_1056196 3300033528 Bacteria 958
253 Ga0316588_1060942 3300033528 Bacteria 921
254 Ga0316588_1092385 3300033528 Bacteria 754
255 Ga0316588_1130515 3300033528 Bacteria 639
256 Ga0316588_1135850 3300033528 Bacteria 627
257 Ga0316588_1135863 3300033528 Bacteria 627
258 Ga0316588_1146595 3300033528 Unclassified 605
259 Ga0316587_1001245 3300033529 Bacteria 3069
260 Ga0316587_1015125 3300033529 Bacteria 1278
261 Ga0316587_1016011 3300033529 Bacteria 1248
262 Ga0316587_1043626 3300033529 Bacteria 813
263 Ga0316587_1053265 3300033529 Bacteria 744
264 Ga0316587_1053922 3300033529 Bacteria 739
265 Ga0316596_1000192 3300033541 Bacteria 8874
266 Ga0316596_1002183 3300033541 Bacteria 4145
267 Ga0316596_1002659 3300033541 Bacteria 3836
268 Ga0316596_1004036 3300033541 Bacteria 3258
269 Ga0316596_1004099 3300033541 Bacteria 3239
270 Ga0316596_1004371 3300033541 Bacteria 3164
271 Ga0316596_1004901 3300033541 Bacteria 3027
272 Ga0316596_1008012 3300033541 Bacteria 2506
273 Ga0316596_1014240 3300033541 Bacteria 1970
274 Ga0316596_1014588 3300033541 Bacteria 1950
275 Ga0316596_1015153 3300033541 Bacteria 1919
276 Ga0316596_1017794 3300033541 Bacteria 1791
277 Ga0316596_1020030 3300033541 Bacteria 1700
278 Ga0316596_1022113 3300033541 Unclassified 1623
279 Ga0316596_1025419 3300033541 Bacteria 1523
280 Ga0316596_1032416 3300033541 Bacteria 1359
281 Ga0316596_1039234 3300033541 Bacteria 1242
282 Ga0316596_1048342 3300033541 Bacteria 1124
283 Ga0316596_1067865 3300033541 Bacteria 954
284 Ga0316596_1074927 3300033541 Bacteria 907
285 Ga0316596_1077007 3300033541 Bacteria 895
286 Ga0316596_1091092 3300033541 Bacteria 822
287 Ga0316596_1096682 3300033541 Unclassified 797
288 Ga0316596_1120423 3300033541 Bacteria 714
289 Ga0316596_1168651 3300033541 Unclassified 604
290 Ga0316596_1206162 3300033541 Bacteria 548
291 Ga0373936_0091793 3300035113 Bacteria 1274
292 Ga0373945_0399143 3300035116 Bacteria 602
293 Ga0373955_0364387 3300035172 Bacteria 876
294 Ga0316574_0000750 3300035398 Bacteria 13959
295 Ga0316574_0000856 3300035398 Bacteria 13374
296 Ga0316574_0002922 3300035398 Bacteria 8695
297 Ga0316574_0019371 3300035398 Bacteria 4012
298 Ga0316574_0059478 3300035398 Bacteria 2397
299 Ga0316574_0161585 3300035398 Bacteria 1442
300 Ga0316574_0618378 3300035398 Bacteria 668
301 Ga0373935_0267123 3300035692 Bacteria 1201
302 Ga0373927_0262653 3300035695 Bacteria 1135
303 Ga0373937_0413547 3300036401 Bacteria 1280
304 Ga0373937_1612981 3300036401 Bacteria 596
305 Ga0316582_0006527 3300036647 Bacteria 6134
306 Ga0316582_0015300 3300036647 Bacteria 4382
307 Ga0316582_0023472 3300036647 Bacteria 3678
308 Ga0316582_0026898 3300036647 Bacteria 3468
309 Ga0316582_0067307 3300036647 Bacteria 2310
310 Ga0316582_0092797 3300036647 Bacteria 1990
311 Ga0316582_0186537 3300036647 Bacteria 1412
312 Ga0316582_0187204 3300036647 Bacteria 1409
313 Ga0316582_0351306 3300036647 Bacteria 1014
314 Ga0316582_0529583 3300036647 Bacteria 812
315 Ga0316582_0677811 3300036647 Bacteria 709
316 Ga0316582_0797892 3300036647 Bacteria 647
317 Ga0316582_0832147 3300036647 Bacteria 632
318 Ga0316584_0001013 3300036712 Bacteria 16221
319 Ga0316584_0001647 3300036712 Bacteria 13630
320 Ga0316584_0009321 3300036712 Bacteria 6809
321 Ga0316584_0034182 3300036712 Bacteria 3769
322 Ga0316584_0054560 3300036712 Bacteria 2991
323 Ga0316584_0193838 3300036712 Bacteria 1501
324 Ga0316584_0213477 3300036712 Bacteria 1420
325 Ga0316584_0297685 3300036712 Bacteria 1169
326 Ga0316584_0441487 3300036712 Bacteria 922
327 Ga0316584_0455823 3300036712 Bacteria 904
328 Ga0316584_0475142 3300036712 Bacteria 881
329 Ga0316584_0556354 3300036712 Bacteria 800
330 Ga0316584_0562901 3300036712 Unclassified 794
331 Ga0316584_0743775 3300036712 Bacteria 669
332 Ga0316584_0747639 3300036712 Bacteria 667
333 Ga0373925_0036996 3300037068 Bacteria 3602
334 Ga0373925_1064320 3300037068 Unclassified 666
335 Ga0316581_0002103 3300037588 Bacteria 4685
336 Ga0316581_0004683 3300037588 Bacteria 3509
337 Ga0400484_12384 3300038725 Bacteria 5081
338 Ga0400484_44344 3300038725 Bacteria 4672
339 Ga0400490_18978 3300038726 Bacteria 41932
340 Ga0400490_19520 3300038726 Bacteria 4897
341 Ga0400490_20958 3300038726 Bacteria 2883
342 Ga0400490_43141 3300038726 Bacteria 1353
343 Ga0400490_44309 3300038726 Bacteria 1787
344 Ga0400490_48796 3300038726 Bacteria 1056
345 Ga0400491_26970 3300038727 Bacteria 2755
346 Ga0400491_29253 3300038727 Bacteria 8022
347 Ga0400485_07355 3300038735 Bacteria 3551
348 Ga0400485_08047 3300038735 Bacteria 20055
349 Ga0400485_08672 3300038735 Bacteria 18258
350 Ga0400485_19339 3300038735 Bacteria 2888
351 Ga0400488_34896 3300038741 Bacteria 1063
352 Ga0400488_39523 3300038741 Bacteria 3954
353 Ga0400488_57582 3300038741 Bacteria 1769
354 Ga0400488_58717 3300038741 Bacteria 2359
355 Ga0400486_05152 3300038742 Bacteria 15610
356 Ga0400486_09544 3300038742 Bacteria 18982
357 Ga0400486_17114 3300038742 Bacteria 18189
358 Ga0400486_17728 3300038742 Bacteria 12468
359 Ga0400486_32047 3300038742 Bacteria 23991
360 Ga0400483_000987 3300039062 Bacteria 2757
361 Ga0400483_006020 3300039062 Bacteria 1317
362 Ga0400483_023928 3300039062 Bacteria 5426
363 Ga0400483_042851 3300039062 Bacteria 14723
364 Ga0400483_077376 3300039062 Bacteria 8060
365 Ga0400483_127715 3300039062 Bacteria 2344
366 Ga0400483_170096 3300039062 Bacteria 1400
367 Ga0400483_198250 3300039062 Bacteria 18872
368 Ga0400483_228134 3300039062 Bacteria 119181
369 Ga0400483_231578 3300039062 Bacteria 1989
370 Ga0400483_278711 3300039062 Bacteria 5840
371 Ga0400483_281776 3300039062 Bacteria 7321
372 Ga0400483_283849 3300039062 Bacteria 3132
373 Ga0400489_41472 3300039093 Bacteria 14759
374 Ga0400489_66216 3300039093 Bacteria 19270
375 Ga0400489_74615 3300039093 Bacteria 23866
376 Ga0400489_78871 3300039093 Bacteria 1773
377 Ga0400487_03008 3300039110 Bacteria 21586
378 Ga0439447_002479 3300041407 Bacteria 6716
379 Ga0451787_789122 3300041441 Bacteria 643
380 Ga0451789_0960489 3300041443 Bacteria 740
381 Ga0451789_1350685 3300041443 Bacteria 531
382 Ga0451791_0489072 3300041451 Bacteria 1708
383 Ga0451797_1408326 3300041453 Bacteria 597
384 Ga0451795_1044940 3300041456 Bacteria 2963
385 Ga0451804_1059666 3300041463 Bacteria 1135
386 Ga0451807_0815463 3300041486 Bacteria 625
387 Ga0451807_2557317 3300041486 Bacteria 513
388 Ga0451835_0820626 3300041492 Bacteria 1224
389 Ga0451837_1056715 3300041494 Bacteria 8321
390 Ga0451837_1067335 3300041494 Bacteria 913
391 Ga0451841_0293830 3300041498 Bacteria 1508
392 Ga0451849_0167691 3300041505 Bacteria 1753
393 Ga0451855_1626854 3300041511 Bacteria 818
394 Ga0451853_1266368 3300041512 Bacteria 15952
395 Ga0439445_0010667 3300042004 Bacteria 2179
396 Ga0439445_0023087 3300042004 Bacteria 1573
397 Ga0439445_0036329 3300042004 Bacteria 1296
398 Ga0439462_0072003 3300042015 Bacteria 939
399 Ga0453683_0016045 3300044673 Bacteria 4840
400 Ga0453684_0287491 3300044712 Bacteria 1873
401 Ga0466971_0061064 3300044719 Bacteria 1704
402 Ga0466960_0032952 3300044901 Bacteria 2404
403 Ga0451576_0087476 3300045051 Bacteria 3241
404 Ga0495629_0227354 3300046459 Bacteria 1286
405 Ga0495641_0369011 3300046461 Bacteria 650
406 Ga0495606_0029837 3300046507 Bacteria 3822
407 Ga0495616_0108615 3300046513 Bacteria 1291
408 Ga0495637_0302890 3300046520 Bacteria 567
409 Ga0495643_0000294 3300046522 Bacteria 70329
410 Ga0495625_0001933 3300046660 Bacteria 23424
411 Ga0495635_0477578 3300046663 Bacteria 822
412 Ga0495581_0055694 3300047315 Bacteria 2282
413 Ga0495680_0042938 3300047322 Bacteria 3584
414 Ga0496104_0957742 3300048907 Bacteria 760
415 Ga0496104_1122216 3300048907 Bacteria 690
416 Ga0496112_0553523 3300048915 Bacteria 1084
417 Ga0496116_0000024 3300048919 Bacteria 471420
418 Ga0496121_0183138 3300048924 Bacteria 1509
419 Ga0496124_0114008 3300048927 Bacteria 2171
420 Ga0496125_0000018 3300048928 Bacteria 482390
421 Ga0496126_0042425 3300048929 Bacteria 4201
422 Ga0501306_023205 3300049127 Bacteria 880
423 Ga0501308_017823 3300049128 Bacteria 863
424 Ga0501308_030746 3300049128 Bacteria 719
425 Ga0501308_048743 3300049128 Bacteria 615
426 Ga0501308_049029 3300049128 Bacteria 614
427 Ga0501309_003714 3300049129 Bacteria 1744
428 Ga0501309_062175 3300049129 Bacteria 602
429 Ga0501309_079744 3300049129 Bacteria 548
430 Ga0501310_000149 3300049130 Bacteria 6887
431 Ga0501310_004978 3300049130 Bacteria 1353
432 Ga0501304_030933 3300049160 Bacteria 569
433 Ga0501305_013720 3300049161 Bacteria 1124
434 Ga0501305_114416 3300049161 Bacteria 513
435 Ga0501307_073219 3300049162 Bacteria 549
436 Ga0501311_036860 3300049527 Bacteria 728
437 Ga0501312_026996 3300049528 Bacteria 883
438 Ga0501313_016480 3300049529 Bacteria 888
439 Ga0501314_000001 3300049530 Bacteria 13837
440 Ga0501315_012969 3300049531 Bacteria 1038
441 Ga0501317_021128 3300049533 Bacteria 882
442 Ga0501317_043954 3300049533 Bacteria 691
443 Ga0501318_070968 3300049534 Bacteria 550
444 Ga0501319_000002 3300049535 Bacteria 13675
445 Ga0501319_002658 3300049535 Bacteria 1147
446 Ga0501320_000034 3300049536 Bacteria 6599
447 Ga0501320_011798 3300049536 Bacteria 910
448 Ga0501320_062180 3300049536 Bacteria 527
449 Ga0501321_003707 3300049537 Bacteria 1418
450 Ga0501321_008244 3300049537 Bacteria 1101
451 Ga0501322_000883 3300049538 Bacteria 1552
452 Ga0501323_000002 3300049539 Bacteria 14311
453 Ga0501323_000262 3300049539 Bacteria 3548
454 Ga0501324_000002 3300049540 Bacteria 14212
455 Ga0501324_003406 3300049540 Bacteria 1219
456 Ga0501325_000056 3300049541 Bacteria 3420
457 Ga0501326_00020 3300049542 Bacteria 5374
458 Ga0501326_08365 3300049542 Bacteria 601
459 Ga0501334_09915 3300049550 Bacteria 682
460 Ga0501337_000031 3300049553 Bacteria 5086
461 Ga0501338_00373 3300049554 Bacteria 1952
462 Ga0501034_0608328 3300049571 Bacteria 998
463 Ga0501034_0623976 3300049571 Bacteria 982
464 Ga0501047_0084224 3300049581 Bacteria 3056
465 Ga0501068_0429905 3300049584 Bacteria 853
466 Ga0501068_0696199 3300049584 Bacteria 664
467 Ga0501071_0056652 3300049587 Bacteria 2832
468 Ga0501071_0103016 3300049587 Bacteria 2105
469 Ga0501073_0014090 3300049589 Bacteria 5809
470 Ga0501198_084902 3300049649 Bacteria 619
471 Ga0501206_009610 3300049653 Bacteria 1288
472 Ga0501224_004359 3300049664 Bacteria 2011
473 Ga0501238_000015 3300049671 Bacteria 31964
474 Ga0501238_039361 3300049671 Bacteria 694
475 Ga0501243_049477 3300049675 Bacteria 755
476 Ga0501249_049003 3300049679 Bacteria 967
477 Ga0501257_101886 3300049686 Bacteria 755
478 Ga0501225_0055346 3300049705 Bacteria 1110
479 Ga0501080_0465292 3300049742 Bacteria 1132
480 Ga0501080_0465697 3300049742 Bacteria 1132
481 Ga0501083_0140231 3300049744 Bacteria 1583
482 Ga0501241_003188 3300049758 Bacteria 3112
483 Ga0501264_003780 3300049761 Bacteria 1375
484 Ga0501266_000002 3300049763 Bacteria 459947
485 Ga0501280_000239 3300049776 Bacteria 13899
486 Ga0501035_0018430 3300049822 Bacteria 6432
487 Ga0501044_0271959 3300049823 Bacteria 1630
488 nmdc:mga03683_92426_c1 3300050489 Bacteria 1321
489 nmdc:mga0k408_3991_c1 3300050493 Bacteria 7823
490 nmdc:mga06z11_535695_c1 3300050494 Bacteria 710
491 nmdc:mga07m45_279368_c1 3300050496 Bacteria 971
492 nmdc:mga09592_513237_c1 3300050508 Bacteria 1031
493 nmdc:mga08y16_1326928_c1 3300050511 Bacteria 685
494 nmdc:mga08y16_410335_c1 3300050511 Bacteria 1385
495 nmdc:mga08y16_74608_c1 3300050511 Bacteria 3535
496 Ga0500646_0004786 3300053090 Bacteria 3426
497 Ga0500646_0014057 3300053090 Bacteria 2076
498 Ga0500641_0000168 3300053096 Bacteria 24462
499 Ga0500641_0005947 3300053096 Bacteria 4321
500 Ga0500555_036277 3300053103 Bacteria 1383
501 Ga0500594_0276513 3300053118 Bacteria 561
502 Ga0500658_0000002 3300053134 Bacteria 548440
503 Ga0500589_068495 3300053147 Bacteria 1611
504 Ga0500622_0185057 3300053156 Bacteria 959
505 Ga0500627_0268068 3300053158 Bacteria 752
506 Ga0501084_0044143 3300054114 Bacteria 3731
507 Ga0501084_1115176 3300054114 Bacteria 662
508 Ga0590071_123555 3300059421 Bacteria 662
509 Ga0590077_007344 3300059426 Bacteria 2254
510 Ga0587084_017085 3300059477 Bacteria 1044
511 Ga0587070_001039 3300059491 Bacteria 2697
512 Ga0587092_136762 3300059512 Bacteria 536
513 Ga0587098_014745 3300059604 Bacteria 925
514 Ga0587125_001517 3300059607 Bacteria 1697
515 Ga0587101_081945 3300059623 Bacteria 613
516 Ga0587109_001894 3300059624 Bacteria 2557
517 Ga0587062_000268 3300059639 Bacteria 3294
518 Ga0587068_006892 3300059641 Bacteria 1606
519 Ga0587068_022134 3300059641 Bacteria 1051
520 Ga0587072_000911 3300059643 Bacteria 3390
521 Ga0587108_001667 3300059653 Bacteria 1398
522 Ga0587108_027930 3300059653 Bacteria 566
523 Ga0587124_000839 3300059660 Bacteria 1842
524 Ga0587111_0000650 3300060346 Bacteria 3551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10492659 Ga0157371_104926592 106
2 3300036647 Ga0316582_0187204 Ga0316582_0187204_212_694 109
3 3300005444 Ga0070694_100043859 Ga0070694_1000438592 119
4 3300009094 Ga0111539_11817012 Ga0111539_118170121 119
5 3300032168 Ga0316593_10002854 Ga0316593_100028546 119
6 3300032168 Ga0316593_10006583 Ga0316593_100065835 119
7 3300032168 Ga0316593_10006629 Ga0316593_100066295 119
8 3300032168 Ga0316593_10007530 Ga0316593_100075305 119
9 3300032168 Ga0316593_10206720 Ga0316593_102067202 119
10 3300032168 Ga0316593_10421790 Ga0316593_104217902 119
11 3300033528 Ga0316588_1020631 Ga0316588_10206313 119
12 3300033528 Ga0316588_1056196 Ga0316588_10561961 119
13 3300033529 Ga0316587_1001245 Ga0316587_10012456 119
14 3300033529 Ga0316587_1043626 Ga0316587_10436262 119
15 3300033529 Ga0316587_1053265 Ga0316587_10532652 119
16 3300033529 Ga0316587_1053922 Ga0316587_10539222 119
17 3300033541 Ga0316596_1004901 Ga0316596_10049015 119
18 3300035398 Ga0316574_0618378 Ga0316574_0618378_225_587 119
19 3300042015 Ga0439462_0072003 Ga0439462_0072003_328_690 119
20 3300053103 Ga0500555_036277 Ga0500555_036277_267_629 119
21 3300003163 Ga0006759J45824_1055651 Ga0006759J45824_10556511 120
22 3300003305 Ga0006770J48903_1032151 Ga0006770J48903_10321512 120
23 3300003320 rootH2_10088212 rootH2_100882121 120
24 3300005337 Ga0070682_101077147 Ga0070682_1010771471 120
25 3300005367 Ga0070667_100269037 Ga0070667_1002690372 120
26 3300005563 Ga0068855_100000266 Ga0068855_10000026625 120
27 3300005719 Ga0068861_100150704 Ga0068861_1001507041 120
28 3300005841 Ga0068863_100605478 Ga0068863_1006054782 120
29 3300009094 Ga0111539_10610521 Ga0111539_106105213 120
30 3300014326 Ga0157380_11594516 Ga0157380_115945162 120
31 3300025909 Ga0207705_11074582 Ga0207705_110745822 120
32 3300025949 Ga0207667_10002028 Ga0207667_1000202824 120
33 3300025981 Ga0207640_10268750 Ga0207640_102687503 120
34 3300025986 Ga0207658_10283042 Ga0207658_102830422 120
35 3300026088 Ga0207641_10489061 Ga0207641_104890613 120
36 3300026118 Ga0207675_100142829 Ga0207675_1001428294 120
37 3300031456 Ga0307513_10502075 Ga0307513_105020751 120
38 3300031616 Ga0307508_10036327 Ga0307508_100363277 120
39 3300031730 Ga0307516_10009446 Ga0307516_1000944611 120
40 3300032005 Ga0307411_10855941 Ga0307411_108559412 120
41 3300032168 Ga0316593_10043846 Ga0316593_100438462 120
42 3300033528 Ga0316588_1001747 Ga0316588_10017473 120
43 3300033528 Ga0316588_1006369 Ga0316588_10063692 120
44 3300033541 Ga0316596_1022113 Ga0316596_10221133 120
45 3300033541 Ga0316596_1048342 Ga0316596_10483423 120
46 3300033541 Ga0316596_1074927 Ga0316596_10749271 120
47 3300035695 Ga0373927_0262653 Ga0373927_0262653_99_464 120
48 3300036401 Ga0373937_1612981 Ga0373937_1612981_212_577 120
49 3300036647 Ga0316582_0677811 Ga0316582_0677811_259_624 120
50 3300039062 Ga0400483_170096 Ga0400483_170096_430_795 120
51 3300041443 Ga0451789_0960489 Ga0451789_0960489_39_404 120
52 3300041453 Ga0451797_1408326 Ga0451797_1408326_126_491 120
53 3300041486 Ga0451807_0815463 Ga0451807_0815463_123_488 120
54 3300041486 Ga0451807_2557317 Ga0451807_2557317_12_377 120
55 3300041492 Ga0451835_0820626 Ga0451835_0820626_116_481 120
56 3300041498 Ga0451841_0293830 Ga0451841_0293830_292_657 120
57 3300041505 Ga0451849_0167691 Ga0451849_0167691_973_1338 120
58 3300041512 Ga0451853_1266368 Ga0451853_1266368_5022_5387 120
59 3300042004 Ga0439445_0010667 Ga0439445_0010667_882_1247 120
60 3300042004 Ga0439445_0023087 Ga0439445_0023087_525_890 120
61 3300044719 Ga0466971_0061064 Ga0466971_0061064_236_601 120
62 3300044901 Ga0466960_0032952 Ga0466960_0032952_1637_2002 120
63 3300048907 Ga0496104_0957742 Ga0496104_0957742_17_382 120
64 3300049127 Ga0501306_023205 Ga0501306_023205_392_757 120
65 3300049128 Ga0501308_017823 Ga0501308_017823_116_481 120
66 3300049128 Ga0501308_030746 Ga0501308_030746_187_552 120
67 3300049128 Ga0501308_048743 Ga0501308_048743_190_555 120
68 3300049128 Ga0501308_049029 Ga0501308_049029_126_491 120
69 3300049129 Ga0501309_003714 Ga0501309_003714_1212_1577 120
70 3300049129 Ga0501309_062175 Ga0501309_062175_103_468 120
71 3300049129 Ga0501309_079744 Ga0501309_079744_108_473 120
72 3300049130 Ga0501310_004978 Ga0501310_004978_544_909 120
73 3300049160 Ga0501304_030933 Ga0501304_030933_39_404 120
74 3300049161 Ga0501305_013720 Ga0501305_013720_315_680 120
75 3300049161 Ga0501305_114416 Ga0501305_114416_39_404 120
76 3300049162 Ga0501307_073219 Ga0501307_073219_115_480 120
77 3300049527 Ga0501311_036860 Ga0501311_036860_91_456 120
78 3300049528 Ga0501312_026996 Ga0501312_026996_190_555 120
79 3300049529 Ga0501313_016480 Ga0501313_016480_126_491 120
80 3300049531 Ga0501315_012969 Ga0501315_012969_164_529 120
81 3300049533 Ga0501317_043954 Ga0501317_043954_112_477 120
82 3300049534 Ga0501318_070968 Ga0501318_070968_83_448 120
83 3300049537 Ga0501321_008244 Ga0501321_008244_342_707 120
84 3300049542 Ga0501326_08365 Ga0501326_08365_35_400 120
85 3300049571 Ga0501034_0608328 Ga0501034_0608328_98_463 120
86 3300049584 Ga0501068_0696199 Ga0501068_0696199_266_631 120
87 3300049653 Ga0501206_009610 Ga0501206_009610_585_950 120
88 3300049686 Ga0501257_101886 Ga0501257_101886_127_492 120
89 3300049705 Ga0501225_0055346 Ga0501225_0055346_93_458 120
90 3300049742 Ga0501080_0465292 Ga0501080_0465292_166_531 120
91 3300049761 Ga0501264_003780 Ga0501264_003780_854_1219 120
92 3300050511 nmdc:mga08y16_410335_c1 nmdc:mga08y16_410335_c1_716_1081 120
93 3300054114 Ga0501084_0044143 Ga0501084_0044143_1345_1710 120
94 3300054114 Ga0501084_1115176 Ga0501084_1115176_241_606 120
95 3300059421 Ga0590071_123555 Ga0590071_123555_92_457 120
96 3300059426 Ga0590077_007344 Ga0590077_007344_352_717 120
97 3300059653 Ga0587108_027930 Ga0587108_027930_39_404 120
98 iso_pu_bacteria 2513020052 2513232386 120
99 iso_pu_bacteria 2519899754 2520879551 120
100 iso_pu_bacteria 2643221600 2644009212 120
101 iso_pu_bacteria 2643221667 2644373949 120
102 iso_pu_bacteria 2643221716 2644643919 120
103 iso_pu_bacteria 2643221725 2644681814 120
104 iso_pu_bacteria 2738541279 2738733049 120
105 iso_pu_bacteria 2738541285 2738765587 120
106 iso_pu_bacteria 2738543007 2739214630 120
107 iso_pu_bacteria 2739367857 2740002855 120
108 iso_pu_bacteria 2739367858 2740007672 120
109 iso_pu_bacteria 2802428842 2802655277 120
110 iso_pu_bacteria 2816332280 2817413530 120
111 iso_pu_bacteria 2857613821 2857617067 120
112 iso_pu_bacteria 2857618242 2857619736 120
113 iso_pu_bacteria 2881359912 2881364120 120
114 iso_pu_bacteria 2903895155 2903898679 120
115 iso_pu_bacteria 2904419702 2904422381 120
116 iso_pu_bacteria 2904555929 2904558513 120
117 iso_pu_bacteria 2919191525 2919194239 120
118 iso_pu_bacteria 2919509842 2919511844 120
119 iso_pu_bacteria 2919683626 2919684597 120
120 iso_pu_bacteria 2929150217 2929150586 120
121 iso_pu_bacteria 2958458903 2958461983 120
122 iso_pu_bacteria 2958512119 2958514516 120
123 iso_pu_bacteria 2965320100 2965321940 120
124 iso_pu_bacteria 2977268062 2977272058 120
125 iso_pu_bacteria 8036736890 8036739247 120
126 iso_pu_bacteria 8054307821 8054311447 120
127 iso_pu_bacteria 8055419101 8055423565 120
128 iso_pu_bacteria 8055592153 8055595081 120
129 iso_pu_bacteria 8056440228 8056443500 120
130 3300005337 Ga0070682_101512104 Ga0070682_1015121041 121
131 3300006237 Ga0097621_101038106 Ga0097621_1010381061 121
132 3300006880 Ga0075429_100581559 Ga0075429_1005815592 121
133 3300014325 Ga0163163_10624074 Ga0163163_106240743 121
134 3300014969 Ga0157376_10261956 Ga0157376_102619561 121
135 3300028556 Ga0265337_1001901 Ga0265337_100190119 121
136 3300028573 Ga0265334_10026835 Ga0265334_100268354 121
137 3300031240 Ga0265320_10001512 Ga0265320_100015129 121
138 3300031250 Ga0265331_10111421 Ga0265331_101114213 121
139 3300031665 Ga0316575_10153189 Ga0316575_101531892 121
140 3300031665 Ga0316575_10237569 Ga0316575_102375691 121
141 3300031691 Ga0316579_10052226 Ga0316579_100522262 121
142 3300031711 Ga0265314_10008394 Ga0265314_100083948 121
143 3300031711 Ga0265314_10564153 Ga0265314_105641531 121
144 3300031727 Ga0316576_10217851 Ga0316576_102178513 121
145 3300031727 Ga0316576_10555152 Ga0316576_105551522 121
146 3300031727 Ga0316576_10934201 Ga0316576_109342012 121
147 3300031728 Ga0316578_10031535 Ga0316578_100315353 121
148 3300031728 Ga0316578_10276204 Ga0316578_102762041 121
149 3300031728 Ga0316578_10324371 Ga0316578_103243712 121
150 3300031733 Ga0316577_10407017 Ga0316577_104070172 121
151 3300032168 Ga0316593_10007701 Ga0316593_100077014 121
152 3300032168 Ga0316593_10271923 Ga0316593_102719231 121
153 3300032168 Ga0316593_10285207 Ga0316593_102852071 121
154 3300033524 Ga0316592_1082406 Ga0316592_10824061 121
155 3300033527 Ga0316586_1009254 Ga0316586_10092542 121
156 3300033528 Ga0316588_1026533 Ga0316588_10265333 121
157 3300033528 Ga0316588_1130515 Ga0316588_11305151 121
158 3300033529 Ga0316587_1015125 Ga0316587_10151254 121
159 3300036647 Ga0316582_0797892 Ga0316582_0797892_172_540 121
160 3300036712 Ga0316584_0034182 Ga0316584_0034182_1339_1707 121
161 3300036712 Ga0316584_0213477 Ga0316584_0213477_177_545 121
162 3300039062 Ga0400483_127715 Ga0400483_127715_16_384 121
163 3300039062 Ga0400483_283849 Ga0400483_283849_2003_2371 121
164 3300041456 Ga0451795_1044940 Ga0451795_1044940_2193_2561 121
165 3300041494 Ga0451837_1067335 Ga0451837_1067335_280_648 121
166 3300041511 Ga0451855_1626854 Ga0451855_1626854_419_787 121
167 3300045051 Ga0451576_0087476 Ga0451576_0087476_1029_1400 121
168 3300046459 Ga0495629_0227354 Ga0495629_0227354_112_480 121
169 3300046461 Ga0495641_0369011 Ga0495641_0369011_188_556 121
170 3300046663 Ga0495635_0477578 Ga0495635_0477578_17_385 121
171 3300047315 Ga0495581_0055694 Ga0495581_0055694_1350_1718 121
172 3300047322 Ga0495680_0042938 Ga0495680_0042938_517_885 121
173 3300049742 Ga0501080_0465697 Ga0501080_0465697_621_989 121
174 3300050508 nmdc:mga09592_513237_c1 nmdc:mga09592_513237_c1_303_671 121
175 3300005441 Ga0070700_101201795 Ga0070700_1012017951 122
176 3300005466 Ga0070685_10260034 Ga0070685_102600342 122
177 3300005547 Ga0070693_100169224 Ga0070693_1001692242 122
178 3300005718 Ga0068866_11328912 Ga0068866_113289122 122
179 3300005840 Ga0068870_10096798 Ga0068870_100967985 122
180 3300006237 Ga0097621_100207019 Ga0097621_1002070195 122
181 3300009094 Ga0111539_10052091 Ga0111539_100520914 122
182 3300009094 Ga0111539_10414510 Ga0111539_104145103 122
183 3300025938 Ga0207704_10563187 Ga0207704_105631871 122
184 3300026075 Ga0207708_10079820 Ga0207708_100798205 122
185 3300026088 Ga0207641_10549673 Ga0207641_105496732 122
186 3300027907 Ga0207428_10295979 Ga0207428_102959794 122
187 3300031733 Ga0316577_10087820 Ga0316577_100878203 122
188 3300033528 Ga0316588_1000859 Ga0316588_10008596 122
189 3300033528 Ga0316588_1049262 Ga0316588_10492621 122
190 3300033528 Ga0316588_1092385 Ga0316588_10923852 122
191 3300033528 Ga0316588_1135863 Ga0316588_11358632 122
192 3300033528 Ga0316588_1146595 Ga0316588_11465952 122
193 3300033541 Ga0316596_1025419 Ga0316596_10254192 122
194 3300049589 Ga0501073_0014090 Ga0501073_0014090_87_458 122
195 3300050511 nmdc:mga08y16_1326928_c1 nmdc:mga08y16_1326928_c1_46_444 122
196 3300050511 nmdc:mga08y16_74608_c1 nmdc:mga08y16_74608_c1_1604_2002 122
197 3300005337 Ga0070682_100014403 Ga0070682_1000144033 123
198 3300005345 Ga0070692_10963833 Ga0070692_109638331 123
199 3300005366 Ga0070659_101008212 Ga0070659_1010082122 123
200 3300005535 Ga0070684_100076178 Ga0070684_1000761783 123
201 3300006195 Ga0075366_10705138 Ga0075366_107051382 123
202 3300009093 Ga0105240_10294524 Ga0105240_102945243 123
203 3300009551 Ga0105238_10472531 Ga0105238_104725312 123
204 3300020078 Ga0206352_10855877 Ga0206352_108558772 123
205 3300025913 Ga0207695_10512058 Ga0207695_105120583 123
206 3300025932 Ga0207690_10762923 Ga0207690_107629231 123
207 3300026067 Ga0207678_10265484 Ga0207678_102654842 123
208 3300026118 Ga0207675_101412797 Ga0207675_1014127972 123
209 3300031238 Ga0265332_10007637 Ga0265332_100076371 123
210 3300031249 Ga0265339_10005033 Ga0265339_100050333 123
211 3300031344 Ga0265316_10008237 Ga0265316_1000823719 123
212 3300031711 Ga0265314_10000003 Ga0265314_100000031196 123
213 3300031911 Ga0307412_10007950 Ga0307412_100079504 123
214 3300032126 Ga0307415_100359982 Ga0307415_1003599822 123
215 3300035113 Ga0373936_0091793 Ga0373936_0091793_174_563 123
216 3300035172 Ga0373955_0364387 Ga0373955_0364387_137_526 123
217 3300035692 Ga0373935_0267123 Ga0373935_0267123_450_839 123
218 3300036401 Ga0373937_0413547 Ga0373937_0413547_828_1217 123
219 3300037068 Ga0373925_0036996 Ga0373925_0036996_1675_2064 123
220 3300048907 Ga0496104_1122216 Ga0496104_1122216_45_449 123
221 3300049533 Ga0501317_021128 Ga0501317_021128_461_850 123
222 3300049536 Ga0501320_062180 Ga0501320_062180_24_413 123
223 3300049539 Ga0501323_000262 Ga0501323_000262_2672_3061 123
224 3300049540 Ga0501324_003406 Ga0501324_003406_352_732 123
225 3300049571 Ga0501034_0623976 Ga0501034_0623976_82_465 123
226 3300049584 Ga0501068_0429905 Ga0501068_0429905_344_721 123
227 3300049587 Ga0501071_0056652 Ga0501071_0056652_1944_2321 123
228 3300049587 Ga0501071_0103016 Ga0501071_0103016_1085_1462 123
229 3300049744 Ga0501083_0140231 Ga0501083_0140231_177_560 123
230 3300059477 Ga0587084_017085 Ga0587084_017085_51_431 123
231 3300059491 Ga0587070_001039 Ga0587070_001039_1091_1474 123
232 3300059512 Ga0587092_136762 Ga0587092_136762_42_431 123
233 3300059604 Ga0587098_014745 Ga0587098_014745_392_775 123
234 3300059607 Ga0587125_001517 Ga0587125_001517_938_1321 123
235 3300059624 Ga0587109_001894 Ga0587109_001894_1221_1604 123
236 3300059639 Ga0587062_000268 Ga0587062_000268_2875_3258 123
237 3300059641 Ga0587068_006892 Ga0587068_006892_278_661 123
238 3300059641 Ga0587068_022134 Ga0587068_022134_224_613 123
239 3300059643 Ga0587072_000911 Ga0587072_000911_584_967 123
240 3300059653 Ga0587108_001667 Ga0587108_001667_569_952 123
241 3300059660 Ga0587124_000839 Ga0587124_000839_889_1272 123
242 3300060346 Ga0587111_0000650 Ga0587111_0000650_506_895 123
243 2162886007 SwRhRL2b_contig_2194807 SwRhRL2b_0484.00006030 124
244 2209111006 2214800779 2213830271 124
245 3300003578 Ga0006562J51391_1003423 Ga0006562J51391_100342323 124
246 3300004801 Ga0058860_10114316 Ga0058860_101143165 124
247 3300005276 Ga0065717_1001968 Ga0065717_10019686 124
248 3300005277 Ga0065716_1002480 Ga0065716_10024802 124
249 3300005288 Ga0065714_10025944 Ga0065714_100259442 124
250 3300005288 Ga0065714_10042876 Ga0065714_100428761 124
251 3300005289 Ga0065704_10082398 Ga0065704_100823982 124
252 3300005289 Ga0065704_10102101 Ga0065704_101021013 124
253 3300005293 Ga0065715_10036832 Ga0065715_100368324 124
254 3300005293 Ga0065715_10041344 Ga0065715_100413442 124
255 3300005293 Ga0065715_10068655 Ga0065715_100686551 124
256 3300005293 Ga0065715_10163470 Ga0065715_101634703 124
257 3300005293 Ga0065715_11166518 Ga0065715_111665181 124
258 3300005331 Ga0070670_100135400 Ga0070670_1001354003 124
259 3300005337 Ga0070682_100313456 Ga0070682_1003134561 124
260 3300005547 Ga0070693_101062405 Ga0070693_1010624052 124
261 3300005548 Ga0070665_100178604 Ga0070665_1001786043 124
262 3300005548 Ga0070665_101405649 Ga0070665_1014056492 124
263 3300005563 Ga0068855_100585338 Ga0068855_1005853383 124
264 3300005614 Ga0068856_100184992 Ga0068856_1001849922 124
265 3300006173 Ga0070716_100062251 Ga0070716_1000622514 124
266 3300006177 Ga0075362_10012264 Ga0075362_100122645 124
267 3300006195 Ga0075366_10454452 Ga0075366_104544522 124
268 3300006353 Ga0075370_10246110 Ga0075370_102461102 124
269 3300006844 Ga0075428_101191413 Ga0075428_1011914131 124
270 3300006914 Ga0075436_100044416 Ga0075436_1000444162 124
271 3300006942 Ga0099824_1003374 Ga0099824_100337418 124
272 3300006946 Ga0079104_1000280 Ga0079104_100028027 124
273 3300006948 Ga0099826_10000125 Ga0099826_1000012510 124
274 3300009011 Ga0105251_10038077 Ga0105251_100380774 124
275 3300009036 Ga0105244_10000027 Ga0105244_10000027185 124
276 3300009092 Ga0105250_10391215 Ga0105250_103912151 124
277 3300013100 Ga0157373_10001369 Ga0157373_100013699 124
278 3300013102 Ga0157371_10001678 Ga0157371_1000167827 124
279 3300013104 Ga0157370_10073063 Ga0157370_100730633 124
280 3300013104 Ga0157370_10106885 Ga0157370_101068854 124
281 3300013104 Ga0157370_10218418 Ga0157370_102184183 124
282 3300013104 Ga0157370_10316188 Ga0157370_103161881 124
283 3300013104 Ga0157370_11190464 Ga0157370_111904641 124
284 3300013104 Ga0157370_12059252 Ga0157370_120592521 124
285 3300013105 Ga0157369_10000613 Ga0157369_1000061317 124
286 3300013297 Ga0157378_11618085 Ga0157378_116180852 124
287 3300013306 Ga0163162_10022452 Ga0163162_100224522 124
288 3300013308 Ga0157375_11032639 Ga0157375_110326392 124
289 3300014497 Ga0182008_10300387 Ga0182008_103003872 124
290 3300015261 Ga0182006_1009290 Ga0182006_10092905 124
291 3300015261 Ga0182006_1062134 Ga0182006_10621343 124
292 3300015261 Ga0182006_1242266 Ga0182006_12422662 124
293 3300017792 Ga0163161_10000039 Ga0163161_1000003927 124
294 3300017792 Ga0163161_10009312 Ga0163161_100093127 124
295 3300017792 Ga0163161_10317631 Ga0163161_103176311 124
296 3300020070 Ga0206356_11535795 Ga0206356_115357951 124
297 3300020077 Ga0206351_10991482 Ga0206351_109914825 124
298 3300025728 Ga0207655_1000038 Ga0207655_1000038186 124
299 3300025939 Ga0207665_10034201 Ga0207665_100342015 124
300 3300025949 Ga0207667_11480608 Ga0207667_114806082 124
301 3300025986 Ga0207658_10494531 Ga0207658_104945312 124
302 3300026078 Ga0207702_10965924 Ga0207702_109659242 124
303 3300027111 Ga0209281_1000337 Ga0209281_100033738 124
304 3300027360 Ga0209969_1034203 Ga0209969_10342032 124
305 3300027361 Ga0209489_111364 Ga0209489_1113643 124
306 3300027526 Ga0209968_1030260 Ga0209968_10302604 124
307 3300027543 Ga0209999_1008578 Ga0209999_10085784 124
308 3300027617 Ga0210002_1004025 Ga0210002_10040254 124
309 3300027666 Ga0209282_1014100 Ga0209282_10141005 124
310 3300027876 Ga0209974_10095230 Ga0209974_100952303 124
311 3300028794 Ga0307515_10372371 Ga0307515_103723713 124
312 3300030731 Ga0316177_1046974 Ga0316177_10469742 124
313 3300030734 Ga0316179_1001570 Ga0316179_10015701 124
314 3300030742 Ga0316183_1071033 Ga0316183_10710332 124
315 3300030744 Ga0316181_1007760 Ga0316181_10077602 124
316 3300031548 Ga0307408_100015317 Ga0307408_1000153175 124
317 3300031665 Ga0316575_10000149 Ga0316575_1000014923 124
318 3300031665 Ga0316575_10001226 Ga0316575_100012268 124
319 3300031665 Ga0316575_10004586 Ga0316575_100045865 124
320 3300031665 Ga0316575_10039518 Ga0316575_100395182 124
321 3300031665 Ga0316575_10163129 Ga0316575_101631291 124
322 3300031665 Ga0316575_10208125 Ga0316575_102081251 124
323 3300031691 Ga0316579_10002340 Ga0316579_100023403 124
324 3300031691 Ga0316579_10024561 Ga0316579_100245611 124
325 3300031691 Ga0316579_10073335 Ga0316579_100733352 124
326 3300031691 Ga0316579_10183841 Ga0316579_101838412 124
327 3300031727 Ga0316576_10004459 Ga0316576_100044595 124
328 3300031727 Ga0316576_10102441 Ga0316576_101024413 124
329 3300031727 Ga0316576_10181947 Ga0316576_101819472 124
330 3300031727 Ga0316576_10483275 Ga0316576_104832752 124
331 3300031728 Ga0316578_10000551 Ga0316578_1000055123 124
332 3300031728 Ga0316578_10018044 Ga0316578_100180445 124
333 3300031728 Ga0316578_10023200 Ga0316578_100232004 124
334 3300031728 Ga0316578_10036494 Ga0316578_100364944 124
335 3300031728 Ga0316578_10045538 Ga0316578_100455385 124
336 3300031728 Ga0316578_10083874 Ga0316578_100838744 124
337 3300031731 Ga0307405_10000005 Ga0307405_10000005206 124
338 3300031731 Ga0307405_10458504 Ga0307405_104585042 124
339 3300031733 Ga0316577_10012414 Ga0316577_100124144 124
340 3300031733 Ga0316577_10038851 Ga0316577_100388512 124
341 3300031733 Ga0316577_10039079 Ga0316577_100390793 124
342 3300031733 Ga0316577_10067164 Ga0316577_100671643 124
343 3300031733 Ga0316577_10180186 Ga0316577_101801861 124
344 3300031824 Ga0307413_10001014 Ga0307413_1000101414 124
345 3300031824 Ga0307413_10001307 Ga0307413_100013073 124
346 3300031824 Ga0307413_11018250 Ga0307413_110182502 124
347 3300031852 Ga0307410_10000034 Ga0307410_1000003414 124
348 3300031901 Ga0307406_10000004 Ga0307406_10000004130 124
349 3300031903 Ga0307407_10000196 Ga0307407_100001966 124
350 3300031911 Ga0307412_10014189 Ga0307412_100141894 124
351 3300032002 Ga0307416_100010892 Ga0307416_1000108922 124
352 3300032004 Ga0307414_10000011 Ga0307414_10000011327 124
353 3300032004 Ga0307414_10000673 Ga0307414_1000067314 124
354 3300032004 Ga0307414_10019816 Ga0307414_100198165 124
355 3300032004 Ga0307414_10043096 Ga0307414_100430965 124
356 3300032004 Ga0307414_10125747 Ga0307414_101257473 124
357 3300032004 Ga0307414_10315779 Ga0307414_103157791 124
358 3300032004 Ga0307414_10402286 Ga0307414_104022863 124
359 3300032005 Ga0307411_10000004 Ga0307411_1000000422 124
360 3300032005 Ga0307411_10189460 Ga0307411_101894603 124
361 3300032133 Ga0316583_10004307 Ga0316583_100043075 124
362 3300032133 Ga0316583_10022138 Ga0316583_100221383 124
363 3300032133 Ga0316583_10087149 Ga0316583_100871492 124
364 3300032133 Ga0316583_10126206 Ga0316583_101262061 124
365 3300032137 Ga0316585_10000257 Ga0316585_1000025711 124
366 3300032137 Ga0316585_10078970 Ga0316585_100789701 124
367 3300032139 Ga0316580_10001569 Ga0316580_100015696 124
368 3300032139 Ga0316580_10164116 Ga0316580_101641162 124
369 3300032139 Ga0316580_10219907 Ga0316580_102199071 124
370 3300032168 Ga0316593_10000043 Ga0316593_100000436 124
371 3300032168 Ga0316593_10000056 Ga0316593_1000005624 124
372 3300032168 Ga0316593_10000122 Ga0316593_100001225 124
373 3300032168 Ga0316593_10002146 Ga0316593_100021465 124
374 3300032168 Ga0316593_10004277 Ga0316593_100042771 124
375 3300032168 Ga0316593_10005053 Ga0316593_100050531 124
376 3300032168 Ga0316593_10016226 Ga0316593_100162263 124
377 3300032168 Ga0316593_10023631 Ga0316593_100236311 124
378 3300032168 Ga0316593_10035501 Ga0316593_100355012 124
379 3300032168 Ga0316593_10035731 Ga0316593_100357311 124
380 3300032168 Ga0316593_10041560 Ga0316593_100415601 124
381 3300032168 Ga0316593_10064721 Ga0316593_100647212 124
382 3300032168 Ga0316593_10122060 Ga0316593_101220602 124
383 3300032168 Ga0316593_10253337 Ga0316593_102533371 124
384 3300032168 Ga0316593_10277543 Ga0316593_102775431 124
385 3300032168 Ga0316593_10394852 Ga0316593_103948521 124
386 3300033180 Ga0307510_10030428 Ga0307510_100304281 124
387 3300033524 Ga0316592_1007152 Ga0316592_10071523 124
388 3300033524 Ga0316592_1007747 Ga0316592_10077471 124
389 3300033524 Ga0316592_1013208 Ga0316592_10132084 124
390 3300033524 Ga0316592_1052294 Ga0316592_10522942 124
391 3300033524 Ga0316592_1064707 Ga0316592_10647072 124
392 3300033524 Ga0316592_1072240 Ga0316592_10722402 124
393 3300033524 Ga0316592_1093090 Ga0316592_10930901 124
394 3300033524 Ga0316592_1113639 Ga0316592_11136392 124
395 3300033524 Ga0316592_1149544 Ga0316592_11495442 124
396 3300033524 Ga0316592_1174028 Ga0316592_11740281 124
397 3300033527 Ga0316586_1068067 Ga0316586_10680671 124
398 3300033528 Ga0316588_1003151 Ga0316588_10031512 124
399 3300033528 Ga0316588_1020308 Ga0316588_10203081 124
400 3300033528 Ga0316588_1021213 Ga0316588_10212133 124
401 3300033528 Ga0316588_1060942 Ga0316588_10609421 124
402 3300033528 Ga0316588_1135850 Ga0316588_11358501 124
403 3300033529 Ga0316587_1016011 Ga0316587_10160112 124
404 3300033541 Ga0316596_1000192 Ga0316596_10001927 124
405 3300033541 Ga0316596_1002183 Ga0316596_10021834 124
406 3300033541 Ga0316596_1002659 Ga0316596_10026595 124
407 3300033541 Ga0316596_1004036 Ga0316596_10040364 124
408 3300033541 Ga0316596_1004099 Ga0316596_10040994 124
409 3300033541 Ga0316596_1004371 Ga0316596_10043713 124
410 3300033541 Ga0316596_1008012 Ga0316596_10080124 124
411 3300033541 Ga0316596_1014240 Ga0316596_10142402 124
412 3300033541 Ga0316596_1014588 Ga0316596_10145883 124
413 3300033541 Ga0316596_1015153 Ga0316596_10151532 124
414 3300033541 Ga0316596_1017794 Ga0316596_10177942 124
415 3300033541 Ga0316596_1020030 Ga0316596_10200303 124
416 3300033541 Ga0316596_1032416 Ga0316596_10324162 124
417 3300033541 Ga0316596_1039234 Ga0316596_10392341 124
418 3300033541 Ga0316596_1067865 Ga0316596_10678652 124
419 3300033541 Ga0316596_1077007 Ga0316596_10770072 124
420 3300033541 Ga0316596_1091092 Ga0316596_10910922 124
421 3300033541 Ga0316596_1096682 Ga0316596_10966822 124
422 3300033541 Ga0316596_1120423 Ga0316596_11204231 124
423 3300033541 Ga0316596_1168651 Ga0316596_11686511 124
424 3300033541 Ga0316596_1206162 Ga0316596_12061622 124
425 3300035116 Ga0373945_0399143 Ga0373945_0399143_97_477 124
426 3300035398 Ga0316574_0000750 Ga0316574_0000750_6636_7019 124
427 3300035398 Ga0316574_0000856 Ga0316574_0000856_5782_6174 124
428 3300035398 Ga0316574_0002922 Ga0316574_0002922_1677_2126 124
429 3300035398 Ga0316574_0019371 Ga0316574_0019371_585_968 124
430 3300035398 Ga0316574_0059478 Ga0316574_0059478_1425_1808 124
431 3300035398 Ga0316574_0161585 Ga0316574_0161585_86_469 124
432 3300036647 Ga0316582_0006527 Ga0316582_0006527_891_1340 124
433 3300036647 Ga0316582_0015300 Ga0316582_0015300_2018_2410 124
434 3300036647 Ga0316582_0023472 Ga0316582_0023472_2118_2501 124
435 3300036647 Ga0316582_0026898 Ga0316582_0026898_525_908 124
436 3300036647 Ga0316582_0067307 Ga0316582_0067307_959_1342 124
437 3300036647 Ga0316582_0092797 Ga0316582_0092797_259_642 124
438 3300036647 Ga0316582_0186537 Ga0316582_0186537_424_807 124
439 3300036647 Ga0316582_0351306 Ga0316582_0351306_560_943 124
440 3300036647 Ga0316582_0529583 Ga0316582_0529583_116_496 124
441 3300036647 Ga0316582_0832147 Ga0316582_0832147_92_478 124
442 3300036712 Ga0316584_0001013 Ga0316584_0001013_11647_12030 124
443 3300036712 Ga0316584_0001647 Ga0316584_0001647_11787_12236 124
444 3300036712 Ga0316584_0009321 Ga0316584_0009321_3925_4308 124
445 3300036712 Ga0316584_0054560 Ga0316584_0054560_2148_2528 124
446 3300036712 Ga0316584_0193838 Ga0316584_0193838_180_572 124
447 3300036712 Ga0316584_0297685 Ga0316584_0297685_12_395 124
448 3300036712 Ga0316584_0441487 Ga0316584_0441487_80_460 124
449 3300036712 Ga0316584_0455823 Ga0316584_0455823_395_775 124
450 3300036712 Ga0316584_0475142 Ga0316584_0475142_51_434 124
451 3300036712 Ga0316584_0556354 Ga0316584_0556354_291_674 124
452 3300036712 Ga0316584_0562901 Ga0316584_0562901_228_611 124
453 3300036712 Ga0316584_0743775 Ga0316584_0743775_51_437 124
454 3300036712 Ga0316584_0747639 Ga0316584_0747639_181_564 124
455 3300037068 Ga0373925_1064320 Ga0373925_1064320_115_495 124
456 3300037588 Ga0316581_0002103 Ga0316581_0002103_685_1068 124
457 3300037588 Ga0316581_0004683 Ga0316581_0004683_2928_3311 124
458 3300038725 Ga0400484_12384 Ga0400484_12384_1565_1945 124
459 3300038725 Ga0400484_44344 Ga0400484_44344_3781_4161 124
460 3300038726 Ga0400490_18978 Ga0400490_18978_26370_26750 124
461 3300038726 Ga0400490_19520 Ga0400490_19520_3964_4344 124
462 3300038726 Ga0400490_20958 Ga0400490_20958_1153_1533 124
463 3300038726 Ga0400490_43141 Ga0400490_43141_384_764 124
464 3300038726 Ga0400490_44309 Ga0400490_44309_626_1009 124
465 3300038726 Ga0400490_48796 Ga0400490_48796_156_536 124
466 3300038727 Ga0400491_26970 Ga0400491_26970_1542_1922 124
467 3300038727 Ga0400491_29253 Ga0400491_29253_6617_6997 124
468 3300038735 Ga0400485_07355 Ga0400485_07355_3055_3435 124
469 3300038735 Ga0400485_08047 Ga0400485_08047_8151_8534 124
470 3300038735 Ga0400485_08672 Ga0400485_08672_11392_11775 124
471 3300038735 Ga0400485_19339 Ga0400485_19339_1217_1597 124
472 3300038741 Ga0400488_34896 Ga0400488_34896_152_532 124
473 3300038741 Ga0400488_39523 Ga0400488_39523_784_1164 124
474 3300038741 Ga0400488_57582 Ga0400488_57582_788_1168 124
475 3300038741 Ga0400488_58717 Ga0400488_58717_815_1198 124
476 3300038742 Ga0400486_05152 Ga0400486_05152_3489_3869 124
477 3300038742 Ga0400486_09544 Ga0400486_09544_12939_13319 124
478 3300038742 Ga0400486_17114 Ga0400486_17114_11413_11796 124
479 3300038742 Ga0400486_17728 Ga0400486_17728_564_947 124
480 3300038742 Ga0400486_32047 Ga0400486_32047_6528_6908 124
481 3300039062 Ga0400483_000987 Ga0400483_000987_350_730 124
482 3300039062 Ga0400483_006020 Ga0400483_006020_208_588 124
483 3300039062 Ga0400483_023928 Ga0400483_023928_1697_2077 124
484 3300039062 Ga0400483_042851 Ga0400483_042851_12429_12809 124
485 3300039062 Ga0400483_077376 Ga0400483_077376_6659_7039 124
486 3300039062 Ga0400483_198250 Ga0400483_198250_9193_9573 124
487 3300039062 Ga0400483_228134 Ga0400483_228134_11523_11903 124
488 3300039062 Ga0400483_231578 Ga0400483_231578_718_1098 124
489 3300039062 Ga0400483_278711 Ga0400483_278711_4755_5135 124
490 3300039062 Ga0400483_281776 Ga0400483_281776_1390_1770 124
491 3300039093 Ga0400489_41472 Ga0400489_41472_6068_6451 124
492 3300039093 Ga0400489_66216 Ga0400489_66216_7493_7873 124
493 3300039093 Ga0400489_74615 Ga0400489_74615_20562_20951 124
494 3300039093 Ga0400489_78871 Ga0400489_78871_1115_1498 124
495 3300039110 Ga0400487_03008 Ga0400487_03008_4852_5235 124
496 3300041407 Ga0439447_002479 Ga0439447_002479_4048_4422 124
497 3300041441 Ga0451787_789122 Ga0451787_789122_68_442 124
498 3300041443 Ga0451789_1350685 Ga0451789_1350685_94_477 124
499 3300041451 Ga0451791_0489072 Ga0451791_0489072_514_888 124
500 3300041463 Ga0451804_1059666 Ga0451804_1059666_463_837 124
501 3300041494 Ga0451837_1056715 Ga0451837_1056715_6180_6554 124
502 3300042004 Ga0439445_0036329 Ga0439445_0036329_433_807 124
503 3300044673 Ga0453683_0016045 Ga0453683_0016045_4239_4625 124
504 3300044712 Ga0453684_0287491 Ga0453684_0287491_988_1374 124
505 3300046507 Ga0495606_0029837 Ga0495606_0029837_3150_3524 124
506 3300046513 Ga0495616_0108615 Ga0495616_0108615_864_1238 124
507 3300046520 Ga0495637_0302890 Ga0495637_0302890_25_399 124
508 3300046522 Ga0495643_0000294 Ga0495643_0000294_53142_53516 124
509 3300046660 Ga0495625_0001933 Ga0495625_0001933_15331_15705 124
510 3300048915 Ga0496112_0553523 Ga0496112_0553523_481_870 124
511 3300048919 Ga0496116_0000024 Ga0496116_0000024_103030_103404 124
512 3300048924 Ga0496121_0183138 Ga0496121_0183138_331_705 124
513 3300048927 Ga0496124_0114008 Ga0496124_0114008_176_550 124
514 3300048928 Ga0496125_0000018 Ga0496125_0000018_376790_377164 124
515 3300048929 Ga0496126_0042425 Ga0496126_0042425_104_478 124
516 3300049130 Ga0501310_000149 Ga0501310_000149_3871_4245 124
517 3300049530 Ga0501314_000001 Ga0501314_000001_10687_11061 124
518 3300049535 Ga0501319_000002 Ga0501319_000002_2651_3025 124
519 3300049535 Ga0501319_002658 Ga0501319_002658_598_972 124
520 3300049536 Ga0501320_000034 Ga0501320_000034_3326_3700 124
521 3300049536 Ga0501320_011798 Ga0501320_011798_30_404 124
522 3300049537 Ga0501321_003707 Ga0501321_003707_834_1208 124
523 3300049538 Ga0501322_000883 Ga0501322_000883_1149_1523 124
524 3300049539 Ga0501323_000002 Ga0501323_000002_3154_3528 124
525 3300049540 Ga0501324_000002 Ga0501324_000002_10828_11202 124
526 3300049541 Ga0501325_000056 Ga0501325_000056_2899_3273 124
527 3300049542 Ga0501326_00020 Ga0501326_00020_1163_1537 124
528 3300049550 Ga0501334_09915 Ga0501334_09915_182_556 124
529 3300049553 Ga0501337_000031 Ga0501337_000031_1980_2354 124
530 3300049554 Ga0501338_00373 Ga0501338_00373_1447_1821 124
531 3300049581 Ga0501047_0084224 Ga0501047_0084224_216_590 124
532 3300049649 Ga0501198_084902 Ga0501198_084902_235_609 124
533 3300049664 Ga0501224_004359 Ga0501224_004359_1583_1957 124
534 3300049671 Ga0501238_000015 Ga0501238_000015_1065_1439 124
535 3300049671 Ga0501238_039361 Ga0501238_039361_273_647 124
536 3300049675 Ga0501243_049477 Ga0501243_049477_60_434 124
537 3300049679 Ga0501249_049003 Ga0501249_049003_535_909 124
538 3300049758 Ga0501241_003188 Ga0501241_003188_1465_1839 124
539 3300049763 Ga0501266_000002 Ga0501266_000002_338626_339000 124
540 3300049776 Ga0501280_000239 Ga0501280_000239_2586_2960 124
541 3300049822 Ga0501035_0018430 Ga0501035_0018430_1071_1445 124
542 3300049823 Ga0501044_0271959 Ga0501044_0271959_189_566 124
543 3300050489 nmdc:mga03683_92426_c1 nmdc:mga03683_92426_c1_636_1010 124
544 3300050493 nmdc:mga0k408_3991_c1 nmdc:mga0k408_3991_c1_324_701 124
545 3300050494 nmdc:mga06z11_535695_c1 nmdc:mga06z11_535695_c1_27_404 124
546 3300050496 nmdc:mga07m45_279368_c1 nmdc:mga07m45_279368_c1_417_794 124
547 3300053090 Ga0500646_0004786 Ga0500646_0004786_1399_1773 124
548 3300053090 Ga0500646_0014057 Ga0500646_0014057_191_565 124
549 3300053096 Ga0500641_0000168 Ga0500641_0000168_5981_6355 124
550 3300053096 Ga0500641_0005947 Ga0500641_0005947_1481_1855 124
551 3300053118 Ga0500594_0276513 Ga0500594_0276513_62_436 124
552 3300053134 Ga0500658_0000002 Ga0500658_0000002_201694_202068 124
553 3300053147 Ga0500589_068495 Ga0500589_068495_542_916 124
554 3300053156 Ga0500622_0185057 Ga0500622_0185057_273_647 124
555 3300053158 Ga0500627_0268068 Ga0500627_0268068_291_665 124
556 3300059623 Ga0587101_081945 Ga0587101_081945_56_439 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

25

131

0.99

Feature Viewer

pLDDT pTM Quality
70.5 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map