F462907

General Info

Members Datasets Scaffolds Average Seq Length
553 268 530 163

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0270713|Ga0495588_0270713_191_769
Length 192
Sequence MLSITLQKEILCKALSEKVKLMHASVSNHTSAQPSTHGHLADITAGNEYLAFKLGDEEYGIDILKVQEIRGYENVTRIANAPEFIKGVINLRGIIVPIVDMRIKFNLGEPSYDQFTVVIILSIAGRVMGMVVDSVSDVTTLQPDQIRPAPQMGTALNTDYLVGLGTLEERMLILLDIERLMSSAEMGLLQQV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2738541280 Massilia sp. GV090 Isolate Unclassified
9 2738541297 Duganella sp. GV083 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738541357 Duganella sp. GV053 Isolate Unclassified
12 2738543003 Duganella sp. GV066 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2821131069 Duganella sp. 1224 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 2919476304 Duganella sp. 3397 Isolate Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
144 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
239 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
240 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
241 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
242 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
245 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
254 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 4.7
Isolates 3.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.24
Nodule 1.08
Rhizoplane 3.07
Rhizosphere 65.64
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1461477 2162886007 Bacteria 3135
2 JGI25154J39366_1001906 3300002738 Bacteria 6308
3 JGI25154J39366_1002842 3300002738 Bacteria 4093
4 JGI25158J39367_1014369 3300002739 Bacteria 1024
5 JGI25152J39213_1000005 3300002773 Bacteria 160019
6 JGI25152J39213_1000395 3300002773 Bacteria 26530
7 JGI25152J39213_1001135 3300002773 Bacteria 12394
8 JGI25150J39212_1000257 3300002774 Bacteria 28157
9 JGI25150J39212_1003081 3300002774 Bacteria 3987
10 JGI25159J45721_1001262 3300002987 Bacteria 10675
11 JGI25159J45721_1002087 3300002987 Bacteria 7852
12 JGI25159J45721_1006008 3300002987 Bacteria 3710
13 JGI25159J45721_1009997 3300002987 Bacteria 2456
14 JGI25159J45721_1011209 3300002987 Bacteria 2219
15 JGI25159J45721_1013151 3300002987 Bacteria 1932
16 Ga0006759J45824_1040057 3300003163 Bacteria 741
17 JGI25153J46596_10005220 3300003215 Bacteria 6836
18 JGI25153J46596_10012789 3300003215 Bacteria 3595
19 JGI25153J46596_10021873 3300003215 Bacteria 2374
20 rootL2_10025949 3300003322 Bacteria 1768
21 rootL2_10163565 3300003322 Bacteria 1140
22 rootL2_10172118 3300003322 Bacteria 4219
23 JGI25160J50197_1006456 3300003354 Bacteria 4745
24 JGI25160J50197_1015450 3300003354 Bacteria 2503
25 JGI25161J50226_1002529 3300003374 Bacteria 4636
26 JGI25161J50226_1008082 3300003374 Bacteria 1664
27 Ga0007417J51691_1033061 3300003544 Bacteria 792
28 Ga0007417J51691_1092036 3300003544 Bacteria 655
29 Ga0007410J51695_1032984 3300003574 Bacteria 800
30 Ga0007410J51695_1075106 3300003574 Bacteria 539
31 Ga0007409J51694_1018473 3300003575 Bacteria 820
32 Ga0007416J51690_1023281 3300003577 Bacteria 799
33 Ga0007415J51800_128042 3300003613 Bacteria 660
34 Ga0032354_1035241 3300003693 Bacteria 805
35 Ga0055526_1000030 3300003771 Bacteria 143833
36 Ga0055526_1000299 3300003771 Bacteria 41248
37 Ga0055526_1004222 3300003771 Bacteria 8724
38 Ga0055526_1021791 3300003771 Bacteria 2212
39 Ga0055526_1054898 3300003771 Bacteria 882
40 Ga0055537_1000154 3300003773 Bacteria 51753
41 Ga0055537_1000352 3300003773 Bacteria 31239
42 Ga0055537_1009364 3300003773 Bacteria 2170
43 Ga0055537_1011579 3300003773 Bacteria 1777
44 Ga0055537_1021026 3300003773 Bacteria 978
45 Ga0055524_1000021 3300003775 Bacteria 227578
46 Ga0055524_1000099 3300003775 Bacteria 107171
47 Ga0055524_1000187 3300003775 Bacteria 68927
48 Ga0055524_1004400 3300003775 Bacteria 6499
49 Ga0055524_1004548 3300003775 Bacteria 6384
50 Ga0055524_1005250 3300003775 Bacteria 5817
51 Ga0055524_1006690 3300003775 Bacteria 4979
52 Ga0055524_1010226 3300003775 Bacteria 3750
53 Ga0055524_1054133 3300003775 Bacteria 882
54 Ga0055534_1000513 3300003784 Bacteria 20944
55 Ga0055534_1002618 3300003784 Bacteria 6131
56 Ga0055534_1002635 3300003784 Bacteria 6093
57 Ga0055528_1000059 3300003790 Bacteria 87695
58 Ga0055528_1000134 3300003790 Bacteria 60071
59 Ga0055528_1004752 3300003790 Bacteria 6473
60 Ga0055530_10012808 3300003791 Bacteria 2902
61 Ga0055530_10024424 3300003791 Bacteria 1713
62 Ga0055530_10037340 3300003791 Bacteria 1216
63 Ga0055531_10013680 3300003794 Bacteria 3721
64 Ga0055543_1002545 3300004625 Bacteria 5950
65 Ga0055543_1002848 3300004625 Bacteria 5454
66 Ga0055543_1003435 3300004625 Bacteria 4682
67 Ga0065165_1000005 3300005262 Bacteria 370361
68 Ga0065165_1000055 3300005262 Bacteria 187003
69 Ga0065165_1000161 3300005262 Bacteria 116828
70 Ga0065165_1008738 3300005262 Bacteria 4674
71 Ga0065165_1023935 3300005262 Bacteria 2061
72 Ga0065165_1076394 3300005262 Bacteria 878
73 Ga0065704_10080069 3300005289 Bacteria 4017
74 Ga0065704_10294778 3300005289 Bacteria 842
75 Ga0070687_100006487 3300005343 Bacteria 4798
76 Ga0070661_100352170 3300005344 Bacteria 1155
77 Ga0070701_10817497 3300005438 Bacteria 637
78 Ga0070663_101003553 3300005455 Bacteria 726
79 Ga0070662_100243355 3300005457 Bacteria 1443
80 Ga0070698_100236037 3300005471 Bacteria 1762
81 Ga0070698_100264333 3300005471 Bacteria 1652
82 Ga0070704_100138856 3300005549 Bacteria 1895
83 Ga0070664_100056867 3300005564 Bacteria 3324
84 Ga0068854_101790607 3300005578 Bacteria 563
85 Ga0075363_100057244 3300006048 Bacteria 2091
86 Ga0075432_10015104 3300006058 Bacteria 2632
87 Ga0070712_100031691 3300006175 Bacteria 3564
88 Ga0075362_10005190 3300006177 Bacteria 4746
89 Ga0075430_100007348 3300006846 Bacteria 9310
90 Ga0075430_100010695 3300006846 Bacteria 7776
91 Ga0075431_100000307 3300006847 Bacteria 38506
92 Ga0075431_100003813 3300006847 Bacteria 14657
93 Ga0075433_10058639 3300006852 Bacteria 3367
94 Ga0075429_100075130 3300006880 Bacteria 2944
95 Ga0079104_1009630 3300006946 Bacteria 3258
96 Ga0079104_1010273 3300006946 Bacteria 3096
97 Ga0099826_10000002 3300006948 Bacteria 1125830
98 Ga0075435_101364271 3300007076 Bacteria 621
99 Ga0105244_10000853 3300009036 Bacteria 25698
100 Ga0105244_10001358 3300009036 Bacteria 19911
101 Ga0105242_11322444 3300009176 Bacteria 745
102 Ga0105237_11578017 3300009545 Bacteria 663
103 Ga0105239_10684948 3300010375 Bacteria 1172
104 Ga0157371_10484893 3300013102 Bacteria 912
105 Ga0157371_10850636 3300013102 Bacteria 690
106 Ga0157370_10265893 3300013104 Bacteria 1585
107 Ga0163162_10150722 3300013306 Bacteria 2443
108 Ga0157372_10158298 3300013307 Bacteria 2617
109 Ga0157376_10095410 3300014969 Bacteria 2586
110 Ga0182006_1000026 3300015261 Bacteria 253543
111 Ga0182005_1000007 3300015265 Bacteria 490994
112 Ga0183362_10001 3300015683 Bacteria 2046624
113 Ga0163161_10013042 3300017792 Bacteria 5776
114 Ga0206356_10656751 3300020070 Bacteria 646
115 Ga0213872_10000028 3300021361 Bacteria 148766
116 Ga0213872_10006430 3300021361 Bacteria 5898
117 Ga0213872_10022306 3300021361 Bacteria 2915
118 Ga0213872_10038434 3300021361 Bacteria 2184
119 Ga0213872_10042049 3300021361 Bacteria 2084
120 Ga0209436_100351 3300025208 Bacteria 20779
121 Ga0209436_103001 3300025208 Bacteria 4686
122 Ga0209436_104886 3300025208 Bacteria 3210
123 Ga0209436_109138 3300025208 Bacteria 1913
124 Ga0209436_113812 3300025208 Bacteria 1306
125 Ga0209437_107534 3300025233 Bacteria 1766
126 Ga0207425_1000001 3300025245 Bacteria 2525432
127 Ga0207425_1000009 3300025245 Bacteria 593135
128 Ga0207425_1000339 3300025245 Bacteria 32468
129 Ga0209646_1000010 3300025246 Bacteria 573803
130 Ga0209646_1000613 3300025246 Bacteria 13729
131 Ga0209026_1003538 3300025250 Bacteria 5064
132 Ga0209026_1004793 3300025250 Bacteria 3865
133 Ga0209026_1005027 3300025250 Bacteria 3697
134 Ga0209129_1000001 3300025258 Bacteria 1452436
135 Ga0209129_1000003 3300025258 Bacteria 903689
136 Ga0209129_1000061 3300025258 Bacteria 246061
137 Ga0209565_1000057 3300025263 Bacteria 196908
138 Ga0209565_1000184 3300025263 Bacteria 76638
139 Ga0209565_1000765 3300025263 Bacteria 18855
140 Ga0209565_1010721 3300025263 Bacteria 2263
141 Ga0209565_1033708 3300025263 Bacteria 985
142 Ga0209673_1000029 3300025273 Bacteria 351978
143 Ga0209673_1000051 3300025273 Bacteria 282161
144 Ga0209673_1013647 3300025273 Bacteria 3194
145 Ga0209130_1000084 3300025284 Bacteria 160070
146 Ga0209130_1000091 3300025284 Bacteria 149502
147 Ga0209130_1000175 3300025284 Bacteria 91205
148 Ga0209130_1002422 3300025284 Bacteria 9393
149 Ga0209130_1003652 3300025284 Bacteria 6378
150 Ga0209675_1000019 3300025291 Bacteria 351950
151 Ga0209675_1000027 3300025291 Bacteria 282175
152 Ga0209675_1001211 3300025291 Bacteria 15650
153 Ga0209675_1002713 3300025291 Bacteria 8882
154 Ga0209675_1002714 3300025291 Bacteria 8882
155 Ga0209564_1000010 3300025295 Bacteria 885399
156 Ga0209564_1000068 3300025295 Bacteria 311171
157 Ga0209564_1000094 3300025295 Bacteria 243176
158 Ga0209564_1000889 3300025295 Bacteria 39484
159 Ga0209564_1005384 3300025295 Bacteria 7334
160 Ga0209564_1033786 3300025295 Bacteria 1514
161 Ga0209758_1000041 3300025297 Bacteria 410328
162 Ga0209758_1000073 3300025297 Bacteria 276262
163 Ga0209758_1000101 3300025297 Bacteria 225913
164 Ga0209050_1000046 3300025298 Bacteria 386466
165 Ga0209050_1000442 3300025298 Bacteria 75310
166 Ga0209050_1013122 3300025298 Bacteria 3717
167 Ga0209256_1000018 3300025299 Bacteria 568467
168 Ga0209256_1000044 3300025299 Bacteria 337264
169 Ga0209256_1000068 3300025299 Bacteria 246064
170 Ga0209256_1000116 3300025299 Bacteria 169876
171 Ga0209256_1000145 3300025299 Bacteria 150609
172 Ga0209256_1000944 3300025299 Bacteria 35230
173 Ga0209256_1000988 3300025299 Bacteria 34026
174 Ga0209256_1001504 3300025299 Bacteria 23632
175 Ga0209256_1005880 3300025299 Bacteria 6797
176 Ga0207426_1002522 3300025302 Bacteria 11488
177 Ga0207426_1049750 3300025302 Bacteria 1253
178 Ga0209051_1084955 3300025303 Bacteria 899
179 Ga0209257_1000068 3300025304 Bacteria 341291
180 Ga0207655_1003094 3300025728 Bacteria 12643
181 Ga0207662_10049387 3300025918 Bacteria 2496
182 Ga0207657_10565395 3300025919 Bacteria 889
183 Ga0207650_10752491 3300025925 Bacteria 825
184 Ga0207687_10328281 3300025927 Bacteria 1240
185 Ga0207700_10883835 3300025928 Bacteria 800
186 Ga0207706_10189257 3300025933 Bacteria 1807
187 Ga0207679_10285849 3300025945 Bacteria 1416
188 Ga0207678_10221123 3300026067 Bacteria 1621
189 Ga0207678_10988778 3300026067 Bacteria 745
190 Ga0207641_10450365 3300026088 Bacteria 1244
191 Ga0209281_1007000 3300027111 Bacteria 2862
192 Ga0209282_1000001 3300027666 Bacteria 2450367
193 Ga0207428_10778334 3300027907 Bacteria 681
194 Ga0316181_1044356 3300030744 Bacteria 781
195 Ga0316182_1264385 3300030745 Bacteria 1996
196 Ga0265331_10014718 3300031250 Bacteria 4155
197 Ga0265327_10036265 3300031251 Bacteria 2713
198 Ga0307408_100000981 3300031548 Bacteria 22068
199 Ga0307408_100002767 3300031548 Bacteria 12179
200 Ga0265314_10026912 3300031711 Bacteria 4315
201 Ga0265314_10066364 3300031711 Bacteria 2434
202 Ga0307405_10537483 3300031731 Bacteria 943
203 Ga0307413_10579002 3300031824 Bacteria 915
204 Ga0307518_10220327 3300031838 Bacteria 1239
205 Ga0307412_10816818 3300031911 Bacteria 811
206 Ga0307412_10937376 3300031911 Bacteria 761
207 Ga0307409_100954037 3300031995 Bacteria 874
208 Ga0307416_100077240 3300032002 Bacteria 2796
209 Ga0307416_100153247 3300032002 Bacteria 2117
210 Ga0307411_10488768 3300032005 Bacteria 1038
211 Ga0307415_100163703 3300032126 Bacteria 1727
212 Ga0373925_0456418 3300037068 Bacteria 1047
213 Ga0395899_0000956 3300037312 Bacteria 27045
214 Ga0395899_0001859 3300037312 Bacteria 17459
215 Ga0395899_0005685 3300037312 Bacteria 9681
216 Ga0395899_0010146 3300037312 Bacteria 7222
217 Ga0395899_0013974 3300037312 Bacteria 6131
218 Ga0395899_0016969 3300037312 Bacteria 5549
219 Ga0395899_0169586 3300037312 Bacteria 1537
220 Ga0395899_0446244 3300037312 Bacteria 848
221 Ga0395899_0677771 3300037312 Bacteria 649
222 Ga0395900_0002911 3300037418 Bacteria 18649
223 Ga0395900_0012846 3300037418 Bacteria 8556
224 Ga0395900_0055358 3300037418 Bacteria 4085
225 Ga0395900_0256585 3300037418 Bacteria 1747
226 Ga0395898_0014005 3300037466 Bacteria 8241
227 Ga0395898_0294748 3300037466 Bacteria 1547
228 Ga0395898_0350813 3300037466 Bacteria 1407
229 Ga0395905_0003076 3300037471 Bacteria 18042
230 Ga0395905_0008279 3300037471 Bacteria 10265
231 Ga0395905_0011242 3300037471 Bacteria 8654
232 Ga0395905_0014393 3300037471 Bacteria 7555
233 Ga0395905_0254933 3300037471 Bacteria 1639
234 Ga0395905_0307657 3300037471 Bacteria 1473
235 Ga0395905_0548908 3300037471 Bacteria 1057
236 Ga0395905_0726369 3300037471 Bacteria 895
237 Ga0395901_0000054 3300038443 Bacteria 160505
238 Ga0395901_0136176 3300038443 Bacteria 2581
239 Ga0395901_0173048 3300038443 Bacteria 2265
240 Ga0395901_0186978 3300038443 Bacteria 2172
241 Ga0395901_0391537 3300038443 Bacteria 1429
242 Ga0436361_0094167 3300039447 Bacteria 4739
243 Ga0436361_0239828 3300039447 Bacteria 7791
244 Ga0436361_0415428 3300039447 Bacteria 27224
245 Ga0436361_0454653 3300039447 Bacteria 5158
246 Ga0436361_0616428 3300039447 Bacteria 15855
247 Ga0436361_0751503 3300039447 Bacteria 33769
248 Ga0451789_1340800 3300041443 Bacteria 621
249 Ga0451853_0633733 3300041512 Bacteria 711
250 Ga0439441_177702 3300042001 Bacteria 511
251 Ga0439448_0003458 3300042005 Bacteria 4372
252 Ga0450906_048048 3300042145 Bacteria 753
253 Ga0439446_0109307 3300042156 Bacteria 881
254 Ga0451577_0004580 3300042876 Bacteria 14527
255 Ga0451577_0011575 3300042876 Bacteria 8338
256 Ga0451577_0011766 3300042876 Bacteria 8259
257 Ga0451577_0171947 3300042876 Bacteria 1952
258 Ga0451577_0303962 3300042876 Bacteria 1445
259 Ga0466969_0549737 3300044656 Bacteria 528
260 Ga0466972_0000029 3300044658 Bacteria 165236
261 Ga0466972_0000041 3300044658 Bacteria 132242
262 Ga0466972_0077596 3300044658 Bacteria 1582
263 Ga0466972_0105427 3300044658 Bacteria 1333
264 Ga0466981_0367065 3300044669 Bacteria 870
265 Ga0466982_0067121 3300044672 Bacteria 2213
266 Ga0453683_0000063 3300044673 Bacteria 175298
267 Ga0466965_0005670 3300044683 Bacteria 5634
268 Ga0466965_0029673 3300044683 Bacteria 2662
269 Ga0466965_0062996 3300044683 Bacteria 1855
270 Ga0466965_0260223 3300044683 Bacteria 932
271 Ga0466965_0632568 3300044683 Bacteria 610
272 Ga0466966_0019240 3300044684 Bacteria 4494
273 Ga0466964_0004963 3300044706 Bacteria 4917
274 Ga0466964_0320689 3300044706 Bacteria 787
275 Ga0453684_0000140 3300044712 Bacteria 319864
276 Ga0453684_0001176 3300044712 Bacteria 81199
277 Ga0453684_0175448 3300044712 Bacteria 2521
278 Ga0453684_0333104 3300044712 Bacteria 1716
279 Ga0453684_0491789 3300044712 Bacteria 1360
280 Ga0453684_0524448 3300044712 Bacteria 1308
281 Ga0466968_0037791 3300044735 Bacteria 2027
282 Ga0466968_0094557 3300044735 Bacteria 1328
283 Ga0466970_0027859 3300044765 Bacteria 2966
284 Ga0466970_0028613 3300044765 Bacteria 2930
285 Ga0466957_0066326 3300044842 Bacteria 2225
286 Ga0466959_0010294 3300045049 Bacteria 6679
287 Ga0466959_0064752 3300045049 Bacteria 2654
288 Ga0451576_0012875 3300045051 Bacteria 9377
289 Ga0451576_0341803 3300045051 Bacteria 1567
290 Ga0451576_0458082 3300045051 Bacteria 1339
291 Ga0495617_000041 3300046452 Bacteria 124027
292 Ga0495617_031756 3300046452 Bacteria 1772
293 Ga0495627_000007 3300046453 Bacteria 575915
294 Ga0495627_013592 3300046453 Bacteria 2861
295 Ga0495603_0038000 3300046455 Bacteria 2888
296 Ga0495603_0074979 3300046455 Bacteria 1986
297 Ga0495590_0053476 3300046457 Bacteria 1410
298 Ga0495629_0150432 3300046459 Bacteria 1618
299 Ga0495638_0001950 3300046460 Bacteria 17693
300 Ga0495653_0000002 3300046463 Bacteria 507262
301 Ga0495650_0000118 3300046471 Bacteria 187358
302 Ga0495650_0000156 3300046471 Bacteria 155338
303 Ga0495650_0000283 3300046471 Bacteria 96503
304 Ga0495650_0012570 3300046471 Bacteria 4545
305 Ga0495582_0134313 3300046473 Bacteria 1399
306 Ga0495605_0000598 3300046474 Bacteria 28458
307 Ga0495605_0033838 3300046474 Bacteria 2592
308 Ga0495584_0004974 3300046491 Bacteria 7082
309 Ga0495584_0010756 3300046491 Bacteria 4699
310 Ga0495584_0027987 3300046491 Bacteria 2855
311 Ga0495584_0073511 3300046491 Bacteria 1718
312 Ga0495585_0007815 3300046492 Bacteria 6509
313 Ga0495585_0085860 3300046492 Bacteria 1700
314 Ga0495594_0008008 3300046499 Bacteria 5434
315 Ga0495594_0029645 3300046499 Bacteria 2958
316 Ga0495607_0002847 3300046501 Bacteria 13713
317 Ga0495607_0006823 3300046501 Bacteria 7967
318 Ga0495607_0029696 3300046501 Bacteria 3363
319 Ga0495607_0091753 3300046501 Bacteria 1644
320 Ga0495607_0105146 3300046501 Bacteria 1505
321 Ga0495607_0134272 3300046501 Bacteria 1283
322 Ga0495583_0000035 3300046506 Bacteria 246849
323 Ga0495583_0001445 3300046506 Bacteria 24126
324 Ga0495583_0010646 3300046506 Bacteria 5346
325 Ga0495606_0000703 3300046507 Bacteria 51821
326 Ga0495606_0001147 3300046507 Bacteria 37572
327 Ga0495606_0009682 3300046507 Bacteria 8110
328 Ga0495606_0010643 3300046507 Bacteria 7606
329 Ga0495606_0040641 3300046507 Bacteria 3125
330 Ga0495610_0000003 3300046512 Bacteria 1203910
331 Ga0495610_0040601 3300046512 Bacteria 2343
332 Ga0495610_0076921 3300046512 Bacteria 1542
333 Ga0495616_0000343 3300046513 Bacteria 36983
334 Ga0495616_0001789 3300046513 Bacteria 14612
335 Ga0495616_0004098 3300046513 Bacteria 9244
336 Ga0495616_0057001 3300046513 Bacteria 1927
337 Ga0495628_0588307 3300046516 Bacteria 796
338 Ga0495631_0009707 3300046518 Bacteria 4798
339 Ga0495637_0000482 3300046520 Bacteria 29077
340 Ga0495637_0043530 3300046520 Bacteria 1915
341 Ga0495637_0058860 3300046520 Bacteria 1582
342 Ga0495643_0001637 3300046522 Bacteria 19768
343 Ga0495643_0038484 3300046522 Bacteria 2619
344 Ga0495648_0013512 3300046524 Bacteria 6028
345 Ga0495648_0031766 3300046524 Bacteria 3473
346 Ga0495648_0084481 3300046524 Bacteria 1796
347 Ga0495648_0106432 3300046524 Bacteria 1535
348 Ga0495648_0312925 3300046524 Bacteria 731
349 Ga0495663_0217746 3300046525 Bacteria 670
350 Ga0495666_0112598 3300046526 Bacteria 1277
351 Ga0495642_0009421 3300046528 Bacteria 3739
352 Ga0495654_0000038 3300046530 Bacteria 185693
353 Ga0495654_0017997 3300046530 Bacteria 3707
354 Ga0495654_0082792 3300046530 Bacteria 1501
355 Ga0495598_0015814 3300046537 Bacteria 1913
356 Ga0495609_0000636 3300046538 Bacteria 27314
357 Ga0495609_0000908 3300046538 Bacteria 21503
358 Ga0495609_0003925 3300046538 Bacteria 8335
359 Ga0495609_0006138 3300046538 Bacteria 6178
360 Ga0495621_0029559 3300046539 Bacteria 1869
361 Ga0495597_0010396 3300046542 Bacteria 4550
362 Ga0495597_0114218 3300046542 Bacteria 1130
363 Ga0495622_0000013 3300046557 Bacteria 186778
364 Ga0495622_0052526 3300046557 Bacteria 1891
365 Ga0495633_0016870 3300046558 Bacteria 3749
366 Ga0495633_0135812 3300046558 Bacteria 1137
367 Ga0495633_0138257 3300046558 Bacteria 1126
368 Ga0495633_0155768 3300046558 Bacteria 1054
369 Ga0495633_0257139 3300046558 Bacteria 796
370 Ga0495656_0165108 3300046615 Bacteria 1078
371 Ga0495668_0000006 3300046616 Bacteria 553404
372 Ga0495668_0000029 3300046616 Bacteria 279128
373 Ga0495668_0000048 3300046616 Bacteria 217867
374 Ga0495668_0002401 3300046616 Bacteria 15518
375 Ga0495668_0011995 3300046616 Bacteria 5159
376 Ga0495668_0020180 3300046616 Bacteria 3833
377 Ga0495611_0007976 3300046648 Bacteria 4497
378 Ga0495611_0039554 3300046648 Bacteria 2099
379 Ga0495625_0009364 3300046660 Bacteria 8201
380 Ga0495625_0023387 3300046660 Bacteria 4720
381 Ga0495625_0048447 3300046660 Bacteria 3059
382 Ga0495625_0048663 3300046660 Bacteria 3051
383 Ga0495625_0057969 3300046660 Bacteria 2753
384 Ga0495625_0127931 3300046660 Bacteria 1723
385 Ga0495625_0432950 3300046660 Bacteria 816
386 Ga0495659_0000131 3300046664 Bacteria 32964
387 Ga0495659_0010583 3300046664 Bacteria 2964
388 Ga0495659_0010749 3300046664 Bacteria 2944
389 Ga0495659_0018249 3300046664 Bacteria 2335
390 Ga0495661_0024496 3300046665 Bacteria 3906
391 Ga0495661_0044005 3300046665 Bacteria 2740
392 Ga0495661_0048407 3300046665 Bacteria 2583
393 Ga0495661_0053181 3300046665 Bacteria 2436
394 Ga0495661_0412569 3300046665 Bacteria 655
395 Ga0495588_0125310 3300046674 Bacteria 1354
396 Ga0495588_0270713 3300046674 Bacteria 895
397 Ga0495669_0000252 3300046684 Bacteria 31128
398 Ga0495669_0000898 3300046684 Bacteria 12510
399 Ga0495670_0049128 3300046691 Bacteria 2110
400 Ga0495671_0000001 3300046692 Bacteria 1169494
401 Ga0495671_0000424 3300046692 Bacteria 33646
402 Ga0495671_0015429 3300046692 Bacteria 4091
403 Ga0495671_0016794 3300046692 Bacteria 3903
404 Ga0495649_0001756 3300046694 Bacteria 15980
405 Ga0495649_0016067 3300046694 Bacteria 4249
406 Ga0495649_0114952 3300046694 Bacteria 1425
407 Ga0495649_0220491 3300046694 Bacteria 981
408 Ga0495589_0176648 3300046794 Bacteria 1014
409 Ga0495660_0008242 3300046810 Bacteria 6104
410 Ga0495660_0009445 3300046810 Bacteria 5686
411 Ga0495660_0013668 3300046810 Bacteria 4706
412 Ga0495660_0038874 3300046810 Bacteria 2644
413 Ga0495660_0106628 3300046810 Bacteria 1435
414 Ga0495636_0000811 3300047318 Bacteria 11512
415 Ga0495636_0002048 3300047318 Bacteria 7737
416 Ga0495636_0005914 3300047318 Bacteria 4800
417 Ga0495636_0100429 3300047318 Bacteria 1264
418 Ga0495674_0080093 3300047319 Bacteria 2803
419 Ga0495672_0000973 3300047320 Bacteria 29705
420 Ga0495672_0006177 3300047320 Bacteria 9342
421 Ga0495672_0011872 3300047320 Bacteria 6114
422 Ga0495676_0017575 3300047321 Bacteria 6319
423 Ga0495683_0000952 3300047323 Bacteria 20358
424 Ga0495687_000148 3300047443 Bacteria 106947
425 Ga0495687_002762 3300047443 Bacteria 13602
426 Ga0495687_016671 3300047443 Bacteria 3689
427 Ga0495687_042465 3300047443 Bacteria 1986
428 Ga0495687_153366 3300047443 Bacteria 784
429 Ga0495677_0004720 3300047445 Bacteria 5196
430 Ga0495677_0006369 3300047445 Bacteria 4458
431 Ga0495677_0010235 3300047445 Bacteria 3448
432 Ga0495679_006853 3300047446 Bacteria 4839
433 Ga0495679_019788 3300047446 Bacteria 2357
434 Ga0495679_037484 3300047446 Bacteria 1524
435 Ga0495685_000077 3300047447 Bacteria 37238
436 Ga0495685_009695 3300047447 Bacteria 3222
437 Ga0495685_019032 3300047447 Bacteria 2357
438 Ga0495685_051116 3300047447 Bacteria 1402
439 Ga0495685_073847 3300047447 Bacteria 1140
440 Ga0495673_0000100 3300047469 Bacteria 173962
441 Ga0495673_0057567 3300047469 Bacteria 1678
442 Ga0495681_0002968 3300047470 Bacteria 11956
443 Ga0495681_0002980 3300047470 Bacteria 11924
444 Ga0495681_0008901 3300047470 Bacteria 6236
445 Ga0495681_0201572 3300047470 Bacteria 807
446 Ga0495686_0000874 3300047472 Bacteria 38436
447 Ga0495686_0001479 3300047472 Bacteria 25538
448 Ga0495686_0066205 3300047472 Bacteria 2233
449 Ga0495686_0097101 3300047472 Bacteria 1782
450 Ga0495626_0006135 3300048091 Bacteria 6889
451 Ga0495626_0024982 3300048091 Bacteria 2924
452 Ga0496101_0166254 3300048904 Bacteria 1694
453 Ga0496102_0020653 3300048905 Bacteria 5820
454 Ga0496102_0077882 3300048905 Bacteria 3051
455 Ga0496102_1124444 3300048905 Bacteria 705
456 Ga0496103_0003038 3300048906 Bacteria 10335
457 Ga0496103_0006660 3300048906 Bacteria 6896
458 Ga0496106_0236372 3300048909 Bacteria 1460
459 Ga0496109_0358556 3300048912 Bacteria 1378
460 Ga0496110_0441884 3300048913 Bacteria 1185
461 Ga0496110_0754295 3300048913 Bacteria 876
462 Ga0496111_0109096 3300048914 Bacteria 2038
463 Ga0496114_0127806 3300048917 Bacteria 2192
464 Ga0496114_0187535 3300048917 Bacteria 1808
465 Ga0496114_0372836 3300048917 Bacteria 1263
466 Ga0496114_0399533 3300048917 Bacteria 1217
467 Ga0496115_0361667 3300048918 Bacteria 1182
468 Ga0496118_0523900 3300048921 Bacteria 584
469 Ga0496120_0109001 3300048923 Bacteria 1450
470 Ga0496121_0248997 3300048924 Bacteria 1233
471 Ga0496122_0011024 3300048925 Bacteria 9233
472 Ga0496122_0054161 3300048925 Bacteria 3016
473 Ga0496122_0076790 3300048925 Bacteria 2349
474 Ga0496123_0006679 3300048926 Bacteria 11119
475 Ga0496124_0141048 3300048927 Bacteria 1902
476 Ga0496124_0493481 3300048927 Bacteria 823
477 Ga0496125_0000542 3300048928 Bacteria 64978
478 Ga0496125_0002429 3300048928 Bacteria 24227
479 Ga0496126_0017336 3300048929 Bacteria 7178
480 Ga0501306_057942 3300049127 Bacteria 633
481 Ga0501307_017480 3300049162 Bacteria 904
482 Ga0495678_000004 3300049459 Bacteria 532920
483 Ga0495678_001499 3300049459 Bacteria 18192
484 Ga0495678_024887 3300049459 Bacteria 2578
485 Ga0495678_052314 3300049459 Bacteria 1573
486 Ga0495682_0000869 3300049460 Bacteria 18741
487 Ga0495682_0008079 3300049460 Bacteria 4157
488 Ga0501032_0001205 3300049569 Bacteria 20672
489 Ga0501038_0632078 3300049574 Bacteria 807
490 Ga0501071_1040454 3300049587 Bacteria 633
491 Ga0501211_004952 3300049658 Bacteria 1344
492 Ga0501214_011093 3300049659 Bacteria 1003
493 Ga0501222_010742 3300049662 Bacteria 1208
494 Ga0501227_002178 3300049665 Bacteria 4331
495 Ga0501227_007019 3300049665 Bacteria 2412
496 Ga0501227_010384 3300049665 Bacteria 2018
497 Ga0501238_008241 3300049671 Bacteria 1367
498 Ga0501249_002908 3300049679 Bacteria 3444
499 Ga0501249_012616 3300049679 Bacteria 1787
500 Ga0501269_000404 3300049766 Bacteria 10033
501 Ga0501269_000424 3300049766 Bacteria 9503
502 Ga0501279_000443 3300049775 Bacteria 5502
503 Ga0501279_003130 3300049775 Bacteria 2152
504 Ga0501035_0000965 3300049822 Bacteria 30391
505 nmdc:mga03683_11945_c1 3300050489 Bacteria 3158
506 nmdc:mga03n38_12870_c1 3300050490 Bacteria 3162
507 nmdc:mga0qj67_40212_c1 3300050509 Bacteria 3675
508 nmdc:mga0qj67_70913_c1 3300050509 Bacteria 2780
509 nmdc:mga06r32_96024_c1 3300050510 Bacteria 2902
510 Ga0500608_148275 3300053122 Bacteria 1031
511 Ga0500618_008482 3300053125 Bacteria 2862
512 Ga0500573_0029056 3300053140 Bacteria 3186
513 Ga0500619_166015 3300053154 Bacteria 748
514 Ga0500622_0038206 3300053156 Bacteria 2505
515 Ga0500622_0071756 3300053156 Bacteria 1750
516 Ga0587070_121000 3300059491 Bacteria 626
517 Ga0587077_023307 3300059493 Bacteria 1117
518 Ga0587077_101697 3300059493 Bacteria 691
519 Ga0587080_019837 3300059503 Bacteria 1092
520 Ga0587082_001688 3300059504 Bacteria 2348
521 Ga0587091_080138 3300059511 Bacteria 731
522 Ga0587068_080496 3300059641 Bacteria 657
523 Ga0587069_074339 3300059642 Bacteria 651
524 Ga0587072_064098 3300059643 Bacteria 763
525 Ga0587076_031379 3300059645 Bacteria 944
526 Ga0587076_039413 3300059645 Bacteria 877
527 Ga0587076_041782 3300059645 Bacteria 860
528 Ga0587102_017817 3300059649 Bacteria 777
529 Ga0587111_0055499 3300060346 Bacteria 886
530 Ga0466962_0339013 3300061719 Bacteria 747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10816818 Ga0307412_108168181 143
2 iso_pu_bacteria 2547132512 2548848078 144
3 3300002773 JGI25152J39213_1000005 JGI25152J39213_100000586 145
4 3300002774 JGI25150J39212_1000257 JGI25150J39212_100025719 145
5 3300002987 JGI25159J45721_1009997 JGI25159J45721_10099972 145
6 3300003215 JGI25153J46596_10012789 JGI25153J46596_100127894 145
7 3300003322 rootL2_10025949 rootL2_100259492 145
8 3300003775 Ga0055524_1000187 Ga0055524_100018729 145
9 3300004625 Ga0055543_1002545 Ga0055543_10025454 145
10 3300005262 Ga0065165_1000005 Ga0065165_1000005227 145
11 3300013104 Ga0157370_10265893 Ga0157370_102658932 145
12 3300020070 Ga0206356_10656751 Ga0206356_106567511 145
13 3300025208 Ga0209436_109138 Ga0209436_1091383 145
14 3300025245 Ga0207425_1000001 Ga0207425_1000001230 145
15 3300025258 Ga0209129_1000003 Ga0209129_1000003230 145
16 3300025284 Ga0209130_1000084 Ga0209130_100008419 145
17 3300025297 Ga0209758_1000041 Ga0209758_1000041178 145
18 3300025299 Ga0209256_1000068 Ga0209256_1000068107 145
19 3300031250 Ga0265331_10014718 Ga0265331_100147183 145
20 3300031251 Ga0265327_10036265 Ga0265327_100362653 145
21 3300031838 Ga0307518_10220327 Ga0307518_102203272 145
22 3300044669 Ga0466981_0367065 Ga0466981_0367065_280_756 145
23 3300044765 Ga0466970_0028613 Ga0466970_0028613_1422_1898 145
24 3300046520 Ga0495637_0043530 Ga0495637_0043530_921_1397 145
25 3300046616 Ga0495668_0000006 Ga0495668_0000006_234372_234857 145
26 3300046660 Ga0495625_0432950 Ga0495625_0432950_317_793 145
27 3300046665 Ga0495661_0048407 Ga0495661_0048407_1905_2381 145
28 3300046694 Ga0495649_0220491 Ga0495649_0220491_275_751 145
29 3300047472 Ga0495686_0000874 Ga0495686_0000874_11491_11976 145
30 3300048091 Ga0495626_0006135 Ga0495626_0006135_620_1096 145
31 3300049459 Ga0495678_024887 Ga0495678_024887_1772_2257 145
32 iso_pu_bacteria 2738541280 2738738205 145
33 iso_pu_bacteria 2738541300 2738842989 145
34 iso_pu_bacteria 2738543018 2739273737 145
35 iso_pu_bacteria 2738543030 2739342781 145
36 3300005343 Ga0070687_100006487 Ga0070687_1000064872 146
37 3300025918 Ga0207662_10049387 Ga0207662_100493873 146
38 3300030745 Ga0316182_1264385 Ga0316182_12643851 146
39 3300031731 Ga0307405_10537483 Ga0307405_105374831 146
40 3300042156 Ga0439446_0109307 Ga0439446_0109307_152_667 146
41 3300045051 Ga0451576_0341803 Ga0451576_0341803_21_509 146
42 3300003322 rootL2_10163565 rootL2_101635651 147
43 3300005289 Ga0065704_10294778 Ga0065704_102947781 147
44 3300005438 Ga0070701_10817497 Ga0070701_108174971 147
45 3300005471 Ga0070698_100236037 Ga0070698_1002360372 147
46 3300005549 Ga0070704_100138856 Ga0070704_1001388562 147
47 3300006058 Ga0075432_10015104 Ga0075432_100151044 147
48 3300006852 Ga0075433_10058639 Ga0075433_100586394 147
49 3300007076 Ga0075435_101364271 Ga0075435_1013642711 147
50 3300013306 Ga0163162_10150722 Ga0163162_101507223 147
51 3300014969 Ga0157376_10095410 Ga0157376_100954102 147
52 3300021361 Ga0213872_10042049 Ga0213872_100420492 147
53 3300025250 Ga0209026_1005027 Ga0209026_10050272 147
54 3300025928 Ga0207700_10883835 Ga0207700_108838352 147
55 3300027907 Ga0207428_10778334 Ga0207428_107783342 147
56 3300037471 Ga0395905_0254933 Ga0395905_0254933_235_714 147
57 3300039447 Ga0436361_0751503 Ga0436361_0751503_32373_32870 147
58 3300042876 Ga0451577_0011575 Ga0451577_0011575_6510_7001 147
59 3300044673 Ga0453683_0000063 Ga0453683_0000063_103326_103817 147
60 3300044683 Ga0466965_0632568 Ga0466965_0632568_20_502 147
61 3300044712 Ga0453684_0000140 Ga0453684_0000140_75913_76404 147
62 3300044712 Ga0453684_0001176 Ga0453684_0001176_14722_15213 147
63 3300046455 Ga0495603_0038000 Ga0495603_0038000_2007_2501 147
64 3300046455 Ga0495603_0074979 Ga0495603_0074979_885_1379 147
65 3300046459 Ga0495629_0150432 Ga0495629_0150432_882_1376 147
66 3300046473 Ga0495582_0134313 Ga0495582_0134313_263_757 147
67 3300046491 Ga0495584_0010756 Ga0495584_0010756_3457_3951 147
68 3300046491 Ga0495584_0073511 Ga0495584_0073511_77_568 147
69 3300046492 Ga0495585_0007815 Ga0495585_0007815_1741_2235 147
70 3300046499 Ga0495594_0008008 Ga0495594_0008008_2018_2512 147
71 3300046499 Ga0495594_0029645 Ga0495594_0029645_718_1212 147
72 3300046516 Ga0495628_0588307 Ga0495628_0588307_282_755 147
73 3300046518 Ga0495631_0009707 Ga0495631_0009707_4229_4723 147
74 3300046522 Ga0495643_0038484 Ga0495643_0038484_1813_2304 147
75 3300046526 Ga0495666_0112598 Ga0495666_0112598_397_891 147
76 3300046542 Ga0495597_0114218 Ga0495597_0114218_269_760 147
77 3300046557 Ga0495622_0052526 Ga0495622_0052526_351_845 147
78 3300046558 Ga0495633_0257139 Ga0495633_0257139_243_737 147
79 3300046648 Ga0495611_0007976 Ga0495611_0007976_3127_3621 147
80 3300046665 Ga0495661_0412569 Ga0495661_0412569_104_598 147
81 3300046674 Ga0495588_0125310 Ga0495588_0125310_782_1276 147
82 3300046691 Ga0495670_0049128 Ga0495670_0049128_50_544 147
83 3300047318 Ga0495636_0002048 Ga0495636_0002048_2469_2963 147
84 3300047319 Ga0495674_0080093 Ga0495674_0080093_184_657 147
85 3300047321 Ga0495676_0017575 Ga0495676_0017575_3445_3939 147
86 3300047443 Ga0495687_002762 Ga0495687_002762_2900_3391 147
87 3300047445 Ga0495677_0010235 Ga0495677_0010235_1970_2464 147
88 3300047447 Ga0495685_073847 Ga0495685_073847_349_840 147
89 3300047470 Ga0495681_0201572 Ga0495681_0201572_31_525 147
90 3300048917 Ga0496114_0127806 Ga0496114_0127806_1249_1725 147
91 3300048918 Ga0496115_0361667 Ga0496115_0361667_28_522 147
92 3300048924 Ga0496121_0248997 Ga0496121_0248997_361_852 147
93 3300048928 Ga0496125_0002429 Ga0496125_0002429_20871_21347 147
94 3300053156 Ga0500622_0071756 Ga0500622_0071756_433_909 147
95 iso_pu_bacteria 8057160832 8057161320 147
96 3300002773 JGI25152J39213_1000395 JGI25152J39213_10003959 148
97 3300002774 JGI25150J39212_1003081 JGI25150J39212_10030812 148
98 3300002987 JGI25159J45721_1006008 JGI25159J45721_10060082 148
99 3300002987 JGI25159J45721_1011209 JGI25159J45721_10112092 148
100 3300003215 JGI25153J46596_10005220 JGI25153J46596_100052205 148
101 3300003354 JGI25160J50197_1015450 JGI25160J50197_10154502 148
102 3300003374 JGI25161J50226_1002529 JGI25161J50226_10025293 148
103 3300003374 JGI25161J50226_1008082 JGI25161J50226_10080822 148
104 3300003771 Ga0055526_1021791 Ga0055526_10217911 148
105 3300003771 Ga0055526_1054898 Ga0055526_10548982 148
106 3300003773 Ga0055537_1009364 Ga0055537_10093642 148
107 3300003773 Ga0055537_1011579 Ga0055537_10115792 148
108 3300003773 Ga0055537_1021026 Ga0055537_10210262 148
109 3300003775 Ga0055524_1005250 Ga0055524_10052502 148
110 3300003775 Ga0055524_1010226 Ga0055524_10102262 148
111 3300003775 Ga0055524_1054133 Ga0055524_10541331 148
112 3300003784 Ga0055534_1002635 Ga0055534_10026352 148
113 3300003790 Ga0055528_1004752 Ga0055528_10047522 148
114 3300003791 Ga0055530_10012808 Ga0055530_100128082 148
115 3300003791 Ga0055530_10024424 Ga0055530_100244242 148
116 3300003791 Ga0055530_10037340 Ga0055530_100373402 148
117 3300003794 Ga0055531_10013680 Ga0055531_100136804 148
118 3300004625 Ga0055543_1003435 Ga0055543_10034353 148
119 3300005262 Ga0065165_1008738 Ga0065165_10087383 148
120 3300005262 Ga0065165_1076394 Ga0065165_10763942 148
121 3300005344 Ga0070661_100352170 Ga0070661_1003521702 148
122 3300005457 Ga0070662_100243355 Ga0070662_1002433552 148
123 3300005578 Ga0068854_101790607 Ga0068854_1017906071 148
124 3300006175 Ga0070712_100031691 Ga0070712_1000316912 148
125 3300009176 Ga0105242_11322444 Ga0105242_113224442 148
126 3300015683 Ga0183362_10001 Ga0183362_10001325 148
127 3300025208 Ga0209436_100351 Ga0209436_10035111 148
128 3300025208 Ga0209436_103001 Ga0209436_1030012 148
129 3300025245 Ga0207425_1000001 Ga0207425_10000011360 148
130 3300025245 Ga0207425_1000339 Ga0207425_10003399 148
131 3300025258 Ga0209129_1000001 Ga0209129_1000001537 148
132 3300025263 Ga0209565_1000765 Ga0209565_100076519 148
133 3300025263 Ga0209565_1033708 Ga0209565_10337082 148
134 3300025273 Ga0209673_1013647 Ga0209673_10136472 148
135 3300025284 Ga0209130_1002422 Ga0209130_10024226 148
136 3300025284 Ga0209130_1003652 Ga0209130_10036526 148
137 3300025291 Ga0209675_1001211 Ga0209675_10012112 148
138 3300025291 Ga0209675_1002713 Ga0209675_10027132 148
139 3300025291 Ga0209675_1002714 Ga0209675_10027142 148
140 3300025295 Ga0209564_1005384 Ga0209564_10053848 148
141 3300025297 Ga0209758_1000073 Ga0209758_100007386 148
142 3300025298 Ga0209050_1000046 Ga0209050_1000046185 148
143 3300025298 Ga0209050_1000442 Ga0209050_100044227 148
144 3300025298 Ga0209050_1013122 Ga0209050_10131221 148
145 3300025299 Ga0209256_1000116 Ga0209256_100011614 148
146 3300025299 Ga0209256_1000145 Ga0209256_100014525 148
147 3300025299 Ga0209256_1005880 Ga0209256_10058805 148
148 3300025302 Ga0207426_1002522 Ga0207426_100252211 148
149 3300025303 Ga0209051_1084955 Ga0209051_10849552 148
150 3300025304 Ga0209257_1000068 Ga0209257_1000068145 148
151 3300031548 Ga0307408_100000981 Ga0307408_10000098121 148
152 3300031548 Ga0307408_100002767 Ga0307408_10000276710 148
153 3300037471 Ga0395905_0307657 Ga0395905_0307657_787_1266 148
154 3300037471 Ga0395905_0726369 Ga0395905_0726369_391_882 148
155 3300042001 Ga0439441_177702 Ga0439441_177702_13_492 148
156 3300044712 Ga0453684_0491789 Ga0453684_0491789_234_719 148
157 3300044842 Ga0466957_0066326 Ga0466957_0066326_1694_2197 148
158 3300049658 Ga0501211_004952 Ga0501211_004952_589_1077 148
159 3300049659 Ga0501214_011093 Ga0501214_011093_506_985 148
160 3300049665 Ga0501227_007019 Ga0501227_007019_900_1379 148
161 3300049775 Ga0501279_003130 Ga0501279_003130_896_1375 148
162 iso_pu_bacteria 2511231026 2511384893 148
163 iso_pu_bacteria 2643221645 2644254379 148
164 3300002738 JGI25154J39366_1001906 JGI25154J39366_10019062 149
165 3300002738 JGI25154J39366_1002842 JGI25154J39366_10028422 149
166 3300002773 JGI25152J39213_1001135 JGI25152J39213_10011359 149
167 3300002987 JGI25159J45721_1002087 JGI25159J45721_10020877 149
168 3300002987 JGI25159J45721_1013151 JGI25159J45721_10131511 149
169 3300003215 JGI25153J46596_10021873 JGI25153J46596_100218732 149
170 3300003354 JGI25160J50197_1006456 JGI25160J50197_10064563 149
171 3300003544 Ga0007417J51691_1092036 Ga0007417J51691_10920361 149
172 3300003574 Ga0007410J51695_1075106 Ga0007410J51695_10751061 149
173 3300003771 Ga0055526_1000030 Ga0055526_1000030129 149
174 3300003771 Ga0055526_1000299 Ga0055526_100029925 149
175 3300003771 Ga0055526_1004222 Ga0055526_10042229 149
176 3300003773 Ga0055537_1000154 Ga0055537_100015442 149
177 3300003775 Ga0055524_1000021 Ga0055524_100002115 149
178 3300003775 Ga0055524_1000099 Ga0055524_100009977 149
179 3300003775 Ga0055524_1004400 Ga0055524_10044003 149
180 3300003775 Ga0055524_1004548 Ga0055524_10045482 149
181 3300003784 Ga0055534_1000513 Ga0055534_10005139 149
182 3300003790 Ga0055528_1000134 Ga0055528_10001345 149
183 3300005262 Ga0065165_1000055 Ga0065165_100005553 149
184 3300005455 Ga0070663_101003553 Ga0070663_1010035531 149
185 3300006048 Ga0075363_100057244 Ga0075363_1000572442 149
186 3300006177 Ga0075362_10005190 Ga0075362_100051904 149
187 3300006846 Ga0075430_100007348 Ga0075430_1000073485 149
188 3300006847 Ga0075431_100003813 Ga0075431_10000381310 149
189 3300006946 Ga0079104_1010273 Ga0079104_10102732 149
190 3300006948 Ga0099826_10000002 Ga0099826_10000002941 149
191 3300009036 Ga0105244_10000853 Ga0105244_1000085314 149
192 3300009036 Ga0105244_10001358 Ga0105244_1000135814 149
193 3300015261 Ga0182006_1000026 Ga0182006_1000026182 149
194 3300015265 Ga0182005_1000007 Ga0182005_1000007197 149
195 3300021361 Ga0213872_10000028 Ga0213872_10000028121 149
196 3300021361 Ga0213872_10022306 Ga0213872_100223063 149
197 3300025208 Ga0209436_104886 Ga0209436_1048862 149
198 3300025233 Ga0209437_107534 Ga0209437_1075342 149
199 3300025245 Ga0207425_1000009 Ga0207425_1000009575 149
200 3300025246 Ga0209646_1000010 Ga0209646_100001078 149
201 3300025246 Ga0209646_1000613 Ga0209646_10006139 149
202 3300025258 Ga0209129_1000061 Ga0209129_1000061221 149
203 3300025263 Ga0209565_1000057 Ga0209565_1000057170 149
204 3300025273 Ga0209673_1000051 Ga0209673_1000051116 149
205 3300025284 Ga0209130_1000091 Ga0209130_100009116 149
206 3300025291 Ga0209675_1000027 Ga0209675_1000027116 149
207 3300025295 Ga0209564_1000010 Ga0209564_10000108 149
208 3300025295 Ga0209564_1000068 Ga0209564_100006815 149
209 3300025295 Ga0209564_1000094 Ga0209564_1000094169 149
210 3300025295 Ga0209564_1033786 Ga0209564_10337862 149
211 3300025297 Ga0209758_1000101 Ga0209758_10001019 149
212 3300025299 Ga0209256_1000044 Ga0209256_100004499 149
213 3300025299 Ga0209256_1000988 Ga0209256_100098822 149
214 3300025299 Ga0209256_1001504 Ga0209256_100150413 149
215 3300025728 Ga0207655_1003094 Ga0207655_10030942 149
216 3300025933 Ga0207706_10189257 Ga0207706_101892572 149
217 3300026067 Ga0207678_10988778 Ga0207678_109887781 149
218 3300027666 Ga0209282_1000001 Ga0209282_1000001220 149
219 3300030744 Ga0316181_1044356 Ga0316181_10443562 149
220 3300031711 Ga0265314_10066364 Ga0265314_100663642 149
221 3300032005 Ga0307411_10488768 Ga0307411_104887682 149
222 3300037312 Ga0395899_0013974 Ga0395899_0013974_2585_3088 149
223 3300037312 Ga0395899_0446244 Ga0395899_0446244_195_698 149
224 3300037466 Ga0395898_0350813 Ga0395898_0350813_386_889 149
225 3300037471 Ga0395905_0008279 Ga0395905_0008279_2164_2667 149
226 3300037471 Ga0395905_0011242 Ga0395905_0011242_5521_6027 149
227 3300037471 Ga0395905_0014393 Ga0395905_0014393_2843_3346 149
228 3300039447 Ga0436361_0616428 Ga0436361_0616428_8183_8671 149
229 3300041443 Ga0451789_1340800 Ga0451789_1340800_40_555 149
230 3300041512 Ga0451853_0633733 Ga0451853_0633733_104_580 149
231 3300042876 Ga0451577_0004580 Ga0451577_0004580_4800_5333 149
232 3300042876 Ga0451577_0011766 Ga0451577_0011766_4373_4906 149
233 3300044683 Ga0466965_0029673 Ga0466965_0029673_1409_1915 149
234 3300044712 Ga0453684_0175448 Ga0453684_0175448_1189_1722 149
235 3300045051 Ga0451576_0012875 Ga0451576_0012875_907_1440 149
236 3300045051 Ga0451576_0458082 Ga0451576_0458082_810_1307 149
237 3300046452 Ga0495617_031756 Ga0495617_031756_959_1450 149
238 3300046453 Ga0495627_000007 Ga0495627_000007_484864_485352 149
239 3300046457 Ga0495590_0053476 Ga0495590_0053476_388_873 149
240 3300046460 Ga0495638_0001950 Ga0495638_0001950_16163_16654 149
241 3300046471 Ga0495650_0000118 Ga0495650_0000118_49564_50052 149
242 3300046474 Ga0495605_0000598 Ga0495605_0000598_10992_11483 149
243 3300046474 Ga0495605_0033838 Ga0495605_0033838_1635_2120 149
244 3300046491 Ga0495584_0004974 Ga0495584_0004974_112_600 149
245 3300046491 Ga0495584_0027987 Ga0495584_0027987_898_1389 149
246 3300046501 Ga0495607_0002847 Ga0495607_0002847_6047_6532 149
247 3300046501 Ga0495607_0006823 Ga0495607_0006823_4769_5245 149
248 3300046501 Ga0495607_0029696 Ga0495607_0029696_1755_2243 149
249 3300046501 Ga0495607_0091753 Ga0495607_0091753_359_850 149
250 3300046501 Ga0495607_0105146 Ga0495607_0105146_458_949 149
251 3300046501 Ga0495607_0134272 Ga0495607_0134272_317_808 149
252 3300046506 Ga0495583_0000035 Ga0495583_0000035_32384_32875 149
253 3300046506 Ga0495583_0010646 Ga0495583_0010646_4283_4768 149
254 3300046507 Ga0495606_0009682 Ga0495606_0009682_5671_6159 149
255 3300046507 Ga0495606_0010643 Ga0495606_0010643_5867_6343 149
256 3300046507 Ga0495606_0040641 Ga0495606_0040641_573_1055 149
257 3300046512 Ga0495610_0040601 Ga0495610_0040601_1407_1895 149
258 3300046512 Ga0495610_0076921 Ga0495610_0076921_211_687 149
259 3300046513 Ga0495616_0001789 Ga0495616_0001789_7858_8343 149
260 3300046513 Ga0495616_0004098 Ga0495616_0004098_1773_2261 149
261 3300046513 Ga0495616_0057001 Ga0495616_0057001_793_1284 149
262 3300046524 Ga0495648_0084481 Ga0495648_0084481_373_858 149
263 3300046524 Ga0495648_0106432 Ga0495648_0106432_906_1397 149
264 3300046524 Ga0495648_0312925 Ga0495648_0312925_145_633 149
265 3300046525 Ga0495663_0217746 Ga0495663_0217746_113_601 149
266 3300046528 Ga0495642_0009421 Ga0495642_0009421_167_652 149
267 3300046530 Ga0495654_0017997 Ga0495654_0017997_1934_2416 149
268 3300046538 Ga0495609_0000636 Ga0495609_0000636_10915_11403 149
269 3300046538 Ga0495609_0000908 Ga0495609_0000908_14379_14864 149
270 3300046538 Ga0495609_0003925 Ga0495609_0003925_3294_3785 149
271 3300046538 Ga0495609_0006138 Ga0495609_0006138_2345_2833 149
272 3300046542 Ga0495597_0010396 Ga0495597_0010396_2368_2850 149
273 3300046557 Ga0495622_0000013 Ga0495622_0000013_6761_7243 149
274 3300046558 Ga0495633_0016870 Ga0495633_0016870_1205_1681 149
275 3300046558 Ga0495633_0135812 Ga0495633_0135812_297_788 149
276 3300046558 Ga0495633_0138257 Ga0495633_0138257_495_986 149
277 3300046558 Ga0495633_0155768 Ga0495633_0155768_159_647 149
278 3300046615 Ga0495656_0165108 Ga0495656_0165108_177_668 149
279 3300046616 Ga0495668_0000048 Ga0495668_0000048_186715_187206 149
280 3300046616 Ga0495668_0011995 Ga0495668_0011995_1711_2196 149
281 3300046616 Ga0495668_0020180 Ga0495668_0020180_1944_2432 149
282 3300046648 Ga0495611_0039554 Ga0495611_0039554_959_1450 149
283 3300046660 Ga0495625_0009364 Ga0495625_0009364_3521_4012 149
284 3300046660 Ga0495625_0023387 Ga0495625_0023387_1944_2432 149
285 3300046660 Ga0495625_0048447 Ga0495625_0048447_631_1116 149
286 3300046660 Ga0495625_0048663 Ga0495625_0048663_14_490 149
287 3300046660 Ga0495625_0057969 Ga0495625_0057969_1685_2167 149
288 3300046664 Ga0495659_0000131 Ga0495659_0000131_6654_7136 149
289 3300046664 Ga0495659_0010583 Ga0495659_0010583_1052_1537 149
290 3300046664 Ga0495659_0010749 Ga0495659_0010749_614_1102 149
291 3300046664 Ga0495659_0018249 Ga0495659_0018249_947_1438 149
292 3300046665 Ga0495661_0053181 Ga0495661_0053181_445_936 149
293 3300046684 Ga0495669_0000252 Ga0495669_0000252_15815_16300 149
294 3300046684 Ga0495669_0000898 Ga0495669_0000898_4499_4987 149
295 3300046692 Ga0495671_0000424 Ga0495671_0000424_7301_7783 149
296 3300046692 Ga0495671_0015429 Ga0495671_0015429_805_1296 149
297 3300046692 Ga0495671_0016794 Ga0495671_0016794_526_1011 149
298 3300046694 Ga0495649_0001756 Ga0495649_0001756_13779_14267 149
299 3300046694 Ga0495649_0016067 Ga0495649_0016067_1180_1665 149
300 3300046794 Ga0495589_0176648 Ga0495589_0176648_45_536 149
301 3300046810 Ga0495660_0008242 Ga0495660_0008242_4070_4555 149
302 3300046810 Ga0495660_0009445 Ga0495660_0009445_2901_3389 149
303 3300046810 Ga0495660_0013668 Ga0495660_0013668_1918_2406 149
304 3300046810 Ga0495660_0106628 Ga0495660_0106628_651_1133 149
305 3300047318 Ga0495636_0000811 Ga0495636_0000811_217_708 149
306 3300047318 Ga0495636_0005914 Ga0495636_0005914_2412_2900 149
307 3300047318 Ga0495636_0100429 Ga0495636_0100429_451_936 149
308 3300047320 Ga0495672_0000973 Ga0495672_0000973_22625_23107 149
309 3300047320 Ga0495672_0006177 Ga0495672_0006177_2456_2947 149
310 3300047320 Ga0495672_0011872 Ga0495672_0011872_4539_5030 149
311 3300047323 Ga0495683_0000952 Ga0495683_0000952_2764_3255 149
312 3300047443 Ga0495687_000148 Ga0495687_000148_79863_80354 149
313 3300047443 Ga0495687_016671 Ga0495687_016671_1180_1665 149
314 3300047443 Ga0495687_042465 Ga0495687_042465_833_1321 149
315 3300047445 Ga0495677_0004720 Ga0495677_0004720_12_500 149
316 3300047445 Ga0495677_0006369 Ga0495677_0006369_1508_1993 149
317 3300047446 Ga0495679_006853 Ga0495679_006853_3812_4297 149
318 3300047446 Ga0495679_037484 Ga0495679_037484_918_1406 149
319 3300047447 Ga0495685_000077 Ga0495685_000077_29541_30032 149
320 3300047447 Ga0495685_009695 Ga0495685_009695_1167_1655 149
321 3300047447 Ga0495685_019032 Ga0495685_019032_1294_1779 149
322 3300047469 Ga0495673_0057567 Ga0495673_0057567_799_1290 149
323 3300047470 Ga0495681_0002968 Ga0495681_0002968_5794_6282 149
324 3300047470 Ga0495681_0002980 Ga0495681_0002980_6775_7260 149
325 3300047470 Ga0495681_0008901 Ga0495681_0008901_4366_4854 149
326 3300047472 Ga0495686_0001479 Ga0495686_0001479_5809_6300 149
327 3300047472 Ga0495686_0066205 Ga0495686_0066205_1001_1492 149
328 3300048906 Ga0496103_0003038 Ga0496103_0003038_1333_1809 149
329 3300048906 Ga0496103_0006660 Ga0496103_0006660_5481_5969 149
330 3300048917 Ga0496114_0372836 Ga0496114_0372836_732_1208 149
331 3300049162 Ga0501307_017480 Ga0501307_017480_159_662 149
332 3300049459 Ga0495678_000004 Ga0495678_000004_431106_431594 149
333 3300049459 Ga0495678_001499 Ga0495678_001499_16647_17138 149
334 3300049460 Ga0495682_0000869 Ga0495682_0000869_17161_17652 149
335 3300049460 Ga0495682_0008079 Ga0495682_0008079_896_1387 149
336 3300049665 Ga0501227_010384 Ga0501227_010384_580_1071 149
337 3300049671 Ga0501238_008241 Ga0501238_008241_178_666 149
338 3300049679 Ga0501249_002908 Ga0501249_002908_2386_2862 149
339 3300049679 Ga0501249_012616 Ga0501249_012616_766_1254 149
340 3300049766 Ga0501269_000404 Ga0501269_000404_1397_1885 149
341 3300049766 Ga0501269_000424 Ga0501269_000424_6392_6868 149
342 3300050489 nmdc:mga03683_11945_c1 nmdc:mga03683_11945_c1_571_1047 149
343 3300050490 nmdc:mga03n38_12870_c1 nmdc:mga03n38_12870_c1_1205_1681 149
344 3300050509 nmdc:mga0qj67_70913_c1 nmdc:mga0qj67_70913_c1_649_1170 149
345 3300053122 Ga0500608_148275 Ga0500608_148275_90_593 149
346 3300053140 Ga0500573_0029056 Ga0500573_0029056_1359_1862 149
347 3300053156 Ga0500622_0038206 Ga0500622_0038206_1340_1843 149
348 3300059491 Ga0587070_121000 Ga0587070_121000_99_605 149
349 3300059493 Ga0587077_023307 Ga0587077_023307_372_878 149
350 3300059493 Ga0587077_101697 Ga0587077_101697_83_589 149
351 3300059641 Ga0587068_080496 Ga0587068_080496_61_567 149
352 3300059643 Ga0587072_064098 Ga0587072_064098_101_607 149
353 3300059645 Ga0587076_031379 Ga0587076_031379_328_834 149
354 3300059645 Ga0587076_041782 Ga0587076_041782_12_518 149
355 3300059649 Ga0587102_017817 Ga0587102_017817_105_611 149
356 3300060346 Ga0587111_0055499 Ga0587111_0055499_70_594 149
357 iso_pu_bacteria 2643221603 2644028843 149
358 iso_pu_bacteria 2643221664 2644357954 149
359 iso_pu_bacteria 2738541297 2738829269 149
360 iso_pu_bacteria 2738541357 2739153065 149
361 iso_pu_bacteria 2738543003 2739194985 149
362 iso_pu_bacteria 2738543026 2739321461 149
363 iso_pu_bacteria 2738543029 2739339983 149
364 iso_pu_bacteria 2821131069 2821131538 149
365 iso_pu_bacteria 2857553236 2857554418 149
366 iso_pu_bacteria 2857564685 2857564796 149
367 iso_pu_bacteria 2904424332 2904426087 149
368 iso_pu_bacteria 2919476304 2919478478 149
369 3300002739 JGI25158J39367_1014369 JGI25158J39367_10143692 150
370 3300002987 JGI25159J45721_1001262 JGI25159J45721_10012628 150
371 3300004625 Ga0055543_1002848 Ga0055543_10028484 150
372 3300005262 Ga0065165_1000161 Ga0065165_10001619 150
373 3300005262 Ga0065165_1023935 Ga0065165_10239352 150
374 3300005471 Ga0070698_100264333 Ga0070698_1002643332 150
375 3300006846 Ga0075430_100010695 Ga0075430_1000106953 150
376 3300006847 Ga0075431_100000307 Ga0075431_1000003072 150
377 3300006880 Ga0075429_100075130 Ga0075429_1000751302 150
378 3300013102 Ga0157371_10484893 Ga0157371_104848931 150
379 3300025208 Ga0209436_113812 Ga0209436_1138122 150
380 3300025263 Ga0209565_1010721 Ga0209565_10107213 150
381 3300025284 Ga0209130_1000175 Ga0209130_10001759 150
382 3300025299 Ga0209256_1000018 Ga0209256_1000018529 150
383 3300025302 Ga0207426_1049750 Ga0207426_10497502 150
384 3300025925 Ga0207650_10752491 Ga0207650_107524911 150
385 3300026067 Ga0207678_10221123 Ga0207678_102211232 150
386 3300031711 Ga0265314_10026912 Ga0265314_100269122 150
387 3300031824 Ga0307413_10579002 Ga0307413_105790022 150
388 3300031911 Ga0307412_10937376 Ga0307412_109373762 150
389 3300031995 Ga0307409_100954037 Ga0307409_1009540372 150
390 3300032002 Ga0307416_100077240 Ga0307416_1000772402 150
391 3300032002 Ga0307416_100153247 Ga0307416_1001532472 150
392 3300032126 Ga0307415_100163703 Ga0307415_1001637032 150
393 3300044672 Ga0466982_0067121 Ga0466982_0067121_867_1355 150
394 3300044683 Ga0466965_0005670 Ga0466965_0005670_3409_3960 150
395 3300046452 Ga0495617_000041 Ga0495617_000041_13241_13738 150
396 3300046453 Ga0495627_013592 Ga0495627_013592_735_1232 150
397 3300046463 Ga0495653_0000002 Ga0495653_0000002_101912_102409 150
398 3300046471 Ga0495650_0000156 Ga0495650_0000156_95719_96216 150
399 3300046471 Ga0495650_0000283 Ga0495650_0000283_9434_9919 150
400 3300046471 Ga0495650_0012570 Ga0495650_0012570_3079_3573 150
401 3300046492 Ga0495585_0085860 Ga0495585_0085860_1110_1607 150
402 3300046506 Ga0495583_0001445 Ga0495583_0001445_10892_11386 150
403 3300046507 Ga0495606_0000703 Ga0495606_0000703_1297_1782 150
404 3300046507 Ga0495606_0001147 Ga0495606_0001147_13026_13523 150
405 3300046512 Ga0495610_0000003 Ga0495610_0000003_560114_560611 150
406 3300046513 Ga0495616_0000343 Ga0495616_0000343_23808_24302 150
407 3300046520 Ga0495637_0000482 Ga0495637_0000482_22957_23451 150
408 3300046520 Ga0495637_0058860 Ga0495637_0058860_716_1210 150
409 3300046522 Ga0495643_0001637 Ga0495643_0001637_6650_7144 150
410 3300046524 Ga0495648_0013512 Ga0495648_0013512_2197_2694 150
411 3300046524 Ga0495648_0031766 Ga0495648_0031766_2674_3171 150
412 3300046530 Ga0495654_0000038 Ga0495654_0000038_172318_172812 150
413 3300046530 Ga0495654_0082792 Ga0495654_0082792_185_682 150
414 3300046537 Ga0495598_0015814 Ga0495598_0015814_828_1343 150
415 3300046539 Ga0495621_0029559 Ga0495621_0029559_128_643 150
416 3300046616 Ga0495668_0000029 Ga0495668_0000029_9013_9498 150
417 3300046616 Ga0495668_0002401 Ga0495668_0002401_1045_1542 150
418 3300046660 Ga0495625_0127931 Ga0495625_0127931_202_699 150
419 3300046665 Ga0495661_0024496 Ga0495661_0024496_1518_2015 150
420 3300046665 Ga0495661_0044005 Ga0495661_0044005_2089_2574 150
421 3300046674 Ga0495588_0270713 Ga0495588_0270713_191_769 150
422 3300046692 Ga0495671_0000001 Ga0495671_0000001_110286_110783 150
423 3300046694 Ga0495649_0114952 Ga0495649_0114952_170_655 150
424 3300046810 Ga0495660_0038874 Ga0495660_0038874_970_1467 150
425 3300047443 Ga0495687_153366 Ga0495687_153366_252_767 150
426 3300047446 Ga0495679_019788 Ga0495679_019788_1380_1877 150
427 3300047469 Ga0495673_0000100 Ga0495673_0000100_24470_24967 150
428 3300047472 Ga0495686_0097101 Ga0495686_0097101_194_691 150
429 3300048091 Ga0495626_0024982 Ga0495626_0024982_960_1454 150
430 3300048904 Ga0496101_0166254 Ga0496101_0166254_984_1499 150
431 3300048905 Ga0496102_0020653 Ga0496102_0020653_1302_1814 150
432 3300048905 Ga0496102_0077882 Ga0496102_0077882_672_1187 150
433 3300048905 Ga0496102_1124444 Ga0496102_1124444_15_512 150
434 3300048909 Ga0496106_0236372 Ga0496106_0236372_631_1146 150
435 3300048912 Ga0496109_0358556 Ga0496109_0358556_431_946 150
436 3300048913 Ga0496110_0441884 Ga0496110_0441884_363_878 150
437 3300048913 Ga0496110_0754295 Ga0496110_0754295_279_794 150
438 3300048914 Ga0496111_0109096 Ga0496111_0109096_18_533 150
439 3300048917 Ga0496114_0399533 Ga0496114_0399533_477_992 150
440 3300048923 Ga0496120_0109001 Ga0496120_0109001_747_1244 150
441 3300048925 Ga0496122_0054161 Ga0496122_0054161_1734_2231 150
442 3300048925 Ga0496122_0076790 Ga0496122_0076790_1113_1610 150
443 3300048926 Ga0496123_0006679 Ga0496123_0006679_10266_10763 150
444 3300049127 Ga0501306_057942 Ga0501306_057942_47_532 150
445 3300049459 Ga0495678_052314 Ga0495678_052314_582_1067 150
446 3300049662 Ga0501222_010742 Ga0501222_010742_335_829 150
447 3300049665 Ga0501227_002178 Ga0501227_002178_3027_3521 150
448 3300049775 Ga0501279_000443 Ga0501279_000443_2516_3010 150
449 3300050509 nmdc:mga0qj67_40212_c1 nmdc:mga0qj67_40212_c1_1988_2497 150
450 3300050510 nmdc:mga06r32_96024_c1 nmdc:mga06r32_96024_c1_23_532 150
451 iso_pu_bacteria 2526164713 2527080962 150
452 iso_pu_bacteria 2643221603 2644027908 150
453 3300037312 Ga0395899_0005685 Ga0395899_0005685_8183_8692 151
454 3300044656 Ga0466969_0549737 Ga0466969_0549737_10_507 151
455 3300044658 Ga0466972_0000029 Ga0466972_0000029_153594_154097 151
456 3300044658 Ga0466972_0105427 Ga0466972_0105427_786_1283 151
457 3300044683 Ga0466965_0260223 Ga0466965_0260223_239_736 151
458 3300044684 Ga0466966_0019240 Ga0466966_0019240_2930_3427 151
459 3300044706 Ga0466964_0320689 Ga0466964_0320689_121_624 151
460 3300044765 Ga0466970_0027859 Ga0466970_0027859_1282_1791 151
461 3300045049 Ga0466959_0010294 Ga0466959_0010294_3069_3578 151
462 3300045049 Ga0466959_0064752 Ga0466959_0064752_1114_1611 151
463 3300061719 Ga0466962_0339013 Ga0466962_0339013_62_559 151
464 3300003163 Ga0006759J45824_1040057 Ga0006759J45824_10400571 152
465 3300003544 Ga0007417J51691_1033061 Ga0007417J51691_10330611 152
466 3300003574 Ga0007410J51695_1032984 Ga0007410J51695_10329841 152
467 3300003575 Ga0007409J51694_1018473 Ga0007409J51694_10184732 152
468 3300003577 Ga0007416J51690_1023281 Ga0007416J51690_10232811 152
469 3300003613 Ga0007415J51800_128042 Ga0007415J51800_1280421 152
470 3300003693 Ga0032354_1035241 Ga0032354_10352411 152
471 3300003773 Ga0055537_1000352 Ga0055537_10003525 152
472 3300003775 Ga0055524_1006690 Ga0055524_10066903 152
473 3300003784 Ga0055534_1002618 Ga0055534_10026185 152
474 3300003790 Ga0055528_1000059 Ga0055528_100005970 152
475 3300005564 Ga0070664_100056867 Ga0070664_1000568672 152
476 3300006946 Ga0079104_1009630 Ga0079104_10096301 152
477 3300009545 Ga0105237_11578017 Ga0105237_115780171 152
478 3300010375 Ga0105239_10684948 Ga0105239_106849482 152
479 3300013102 Ga0157371_10850636 Ga0157371_108506361 152
480 3300013307 Ga0157372_10158298 Ga0157372_101582984 152
481 3300017792 Ga0163161_10013042 Ga0163161_100130422 152
482 3300021361 Ga0213872_10006430 Ga0213872_100064303 152
483 3300021361 Ga0213872_10038434 Ga0213872_100384342 152
484 3300025250 Ga0209026_1003538 Ga0209026_10035384 152
485 3300025250 Ga0209026_1004793 Ga0209026_10047933 152
486 3300025263 Ga0209565_1000184 Ga0209565_100018441 152
487 3300025273 Ga0209673_1000029 Ga0209673_10000298 152
488 3300025291 Ga0209675_1000019 Ga0209675_1000019335 152
489 3300025295 Ga0209564_1000889 Ga0209564_10008894 152
490 3300025299 Ga0209256_1000944 Ga0209256_10009448 152
491 3300025919 Ga0207657_10565395 Ga0207657_105653952 152
492 3300025945 Ga0207679_10285849 Ga0207679_102858492 152
493 3300027111 Ga0209281_1007000 Ga0209281_10070003 152
494 3300037068 Ga0373925_0456418 Ga0373925_0456418_104_598 152
495 3300037312 Ga0395899_0000956 Ga0395899_0000956_19284_19799 152
496 3300037312 Ga0395899_0001859 Ga0395899_0001859_15815_16327 152
497 3300037312 Ga0395899_0010146 Ga0395899_0010146_1388_1906 152
498 3300037312 Ga0395899_0016969 Ga0395899_0016969_3863_4360 152
499 3300037312 Ga0395899_0169586 Ga0395899_0169586_306_803 152
500 3300037312 Ga0395899_0677771 Ga0395899_0677771_62_574 152
501 3300037418 Ga0395900_0002911 Ga0395900_0002911_15206_15703 152
502 3300037418 Ga0395900_0012846 Ga0395900_0012846_6941_7453 152
503 3300037418 Ga0395900_0055358 Ga0395900_0055358_3015_3533 152
504 3300037418 Ga0395900_0256585 Ga0395900_0256585_445_960 152
505 3300037466 Ga0395898_0014005 Ga0395898_0014005_7202_7714 152
506 3300037466 Ga0395898_0294748 Ga0395898_0294748_864_1361 152
507 3300037471 Ga0395905_0003076 Ga0395905_0003076_7031_7543 152
508 3300037471 Ga0395905_0548908 Ga0395905_0548908_120_632 152
509 3300038443 Ga0395901_0000054 Ga0395901_0000054_70708_71205 152
510 3300038443 Ga0395901_0136176 Ga0395901_0136176_965_1480 152
511 3300038443 Ga0395901_0173048 Ga0395901_0173048_453_965 152
512 3300038443 Ga0395901_0186978 Ga0395901_0186978_1133_1645 152
513 3300038443 Ga0395901_0391537 Ga0395901_0391537_420_938 152
514 3300039447 Ga0436361_0094167 Ga0436361_0094167_2778_3290 152
515 3300039447 Ga0436361_0239828 Ga0436361_0239828_5817_6329 152
516 3300039447 Ga0436361_0415428 Ga0436361_0415428_17771_18277 152
517 3300039447 Ga0436361_0454653 Ga0436361_0454653_666_1178 152
518 3300042005 Ga0439448_0003458 Ga0439448_0003458_1893_2390 152
519 3300042145 Ga0450906_048048 Ga0450906_048048_93_602 152
520 3300042876 Ga0451577_0171947 Ga0451577_0171947_723_1235 152
521 3300042876 Ga0451577_0303962 Ga0451577_0303962_174_686 152
522 3300044658 Ga0466972_0000041 Ga0466972_0000041_1072_1581 152
523 3300044658 Ga0466972_0077596 Ga0466972_0077596_108_605 152
524 3300044683 Ga0466965_0062996 Ga0466965_0062996_1102_1599 152
525 3300044706 Ga0466964_0004963 Ga0466964_0004963_35_532 152
526 3300044712 Ga0453684_0333104 Ga0453684_0333104_258_770 152
527 3300044712 Ga0453684_0524448 Ga0453684_0524448_307_819 152
528 3300044735 Ga0466968_0037791 Ga0466968_0037791_521_1018 152
529 3300044735 Ga0466968_0094557 Ga0466968_0094557_451_948 152
530 3300047447 Ga0495685_051116 Ga0495685_051116_82_588 152
531 3300048921 Ga0496118_0523900 Ga0496118_0523900_49_549 152
532 3300048927 Ga0496124_0493481 Ga0496124_0493481_261_770 152
533 3300049569 Ga0501032_0001205 Ga0501032_0001205_10949_11455 152
534 3300049574 Ga0501038_0632078 Ga0501038_0632078_134_646 152
535 3300049587 Ga0501071_1040454 Ga0501071_1040454_46_573 152
536 3300049822 Ga0501035_0000965 Ga0501035_0000965_15766_16263 152
537 3300053125 Ga0500618_008482 Ga0500618_008482_1836_2342 152
538 3300059503 Ga0587080_019837 Ga0587080_019837_526_1023 152
539 3300059504 Ga0587082_001688 Ga0587082_001688_93_590 152
540 3300059511 Ga0587091_080138 Ga0587091_080138_145_642 152
541 3300059642 Ga0587069_074339 Ga0587069_074339_104_601 152
542 3300059645 Ga0587076_039413 Ga0587076_039413_167_664 152
543 2162886007 SwRhRL2b_contig_1461477 SwRhRL2b_0663.00006200 154
544 3300003322 rootL2_10172118 rootL2_101721182 154
545 3300005289 Ga0065704_10080069 Ga0065704_100800695 154
546 3300025927 Ga0207687_10328281 Ga0207687_103282812 154
547 3300026088 Ga0207641_10450365 Ga0207641_104503652 154
548 3300048917 Ga0496114_0187535 Ga0496114_0187535_69_581 154
549 3300048925 Ga0496122_0011024 Ga0496122_0011024_1069_1557 154
550 3300048927 Ga0496124_0141048 Ga0496124_0141048_1346_1834 154
551 3300048928 Ga0496125_0000542 Ga0496125_0000542_59032_59520 154
552 3300048929 Ga0496126_0017336 Ga0496126_0017336_4085_4573 154
553 3300053154 Ga0500619_166015 Ga0500619_166015_14_526 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

48

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.9158 16 147
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8807 15 136
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.8554 15 150
8c5v-assembly1.cif.gz_H chemotaxis core signalling unit from e protein lysed e. coli cells 0.842 16 147
2qdl-assembly1.cif.gz_A crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8299 6 142
ID Description Score Start End Superfamily
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.9836 35 98 2.40.50.180
af_P0A964_36_100_2.40.50.180 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.9542 35 98 2.40.50.180
2qdlB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.9388 36 102 2.40.50.180
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.8782 35 102 2.40.50.180
1b3qA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7813 36 101 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A140L2A0-F1-model_v4 Chemotaxis protein CheW 0.9673 15 108 GO:0005829
GO:0006935
GO:0007165
AF-A0A4Q6EW92-F1-model_v4 Purine-binding chemotaxis protein CheW 0.9253 15 137 GO:0005829
GO:0006935
GO:0007165
AF-A0A522XQQ5-F1-model_v4 Chemotaxis protein CheW 0.92 12 154 GO:0005829
GO:0006935
GO:0007165
AF-W1SLV9-F1-model_v4 deleted 0.92 14 144
AF-A0A2W7GW92-F1-model_v4 deleted 0.9199 10 153

Feature Viewer

pLDDT pTM Quality
71.83 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map