F462574

General Info

Members Datasets Scaffolds Average Seq Length
551 219 1102 321

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10000149|Ga0070703_1000014915
Length 305
Sequence MSIYEDLQPISLDKVKTYPLASRPSKVTVADFAKPITEDSSLRDYLASLPNILAVQSVRELAAGIRRAKSLNKPIIWGIGGHVIKTGIAPIIIDLMKRGFVNAIAGNGSVLVHDSEIALAGSTSEDVDATLGEGVFGGAEETGKLLNDAAHLLGLKPKHEGKSILCVAYNQRVPFTIHLTIGGDIGHFHPGTDGGALGATSHTDFRLLAEIVRRMNGGGVYLNIGSAVTLPEVFLKCVTLVRNLGHDLSDITTANFDFIQSYRPLTNVVRRPTADGAGRGFAITGHHELTIPLLAAELICGAEAE

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
182 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
183 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
184 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
197 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
198 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
199 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
206 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
207 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
208 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 0.73
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 10.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10000149 3300005406 Bacteria 35837
2 CNAas_1000220 3300000532 Bacteria 5338
3 JGI24748J21848_1000007 3300002074 Bacteria 208838
4 JGI24034J26672_10000002 3300002239 Bacteria 925353
5 JGI24751J29686_10000240 3300002459 Bacteria 21952
6 JGI25406J46586_10000618 3300003203 Bacteria 16641
7 Ga0065714_10064422 3300005288 Bacteria 270668
8 Ga0065704_10013240 3300005289 Bacteria 2187
9 Ga0065704_10112098 3300005289 Bacteria 1941
10 Ga0065712_10000122 3300005290 Bacteria 92508
11 Ga0065712_10009397 3300005290 Bacteria 2375
12 Ga0065712_10011826 3300005290 Unclassified 2374
13 Ga0065712_10070148 3300005290 Bacteria 6287
14 Ga0065712_10077329 3300005290 Bacteria 3508
15 Ga0065715_10032399 3300005293 Unclassified 1642
16 Ga0065715_10089124 3300005293 Bacteria 13934
17 Ga0065715_10093194 3300005293 Unclassified 4772
18 Ga0065715_10147484 3300005293 Unclassified 1770
19 Ga0065715_10290656 3300005293 Unclassified 1064
20 Ga0065707_10005228 3300005295 Bacteria 3467
21 Ga0065707_10083765 3300005295 Bacteria 8288
22 Ga0065707_10088643 3300005295 Bacteria 4595
23 Ga0070676_10079662 3300005328 Bacteria 1984
24 Ga0070690_100244843 3300005330 Bacteria 1266
25 Ga0070670_100002174 3300005331 Bacteria 16111
26 Ga0070670_100016070 3300005331 Bacteria 6424
27 Ga0070670_100086083 3300005331 Bacteria 2700
28 Ga0070670_100174711 3300005331 Bacteria 1864
29 Ga0070670_100211799 3300005331 Bacteria 1685
30 Ga0070670_100227858 3300005331 Bacteria 1622
31 Ga0070670_100289182 3300005331 Bacteria 1432
32 Ga0068869_100011955 3300005334 Bacteria 5714
33 Ga0068869_100030021 3300005334 Bacteria 3812
34 Ga0068869_100042813 3300005334 Bacteria 3249
35 Ga0068869_100188795 3300005334 Bacteria 1619
36 Ga0068869_100293705 3300005334 Unclassified 1310
37 Ga0070680_100005457 3300005336 Bacteria 9624
38 Ga0070680_100035977 3300005336 Bacteria 3999
39 Ga0070680_100116067 3300005336 Bacteria 2231
40 Ga0070682_100001124 3300005337 Bacteria 15287
41 Ga0070682_100001745 3300005337 Bacteria 12089
42 Ga0070682_100020876 3300005337 Bacteria 3860
43 Ga0068868_100362027 3300005338 Bacteria 1244
44 Ga0070689_100001369 3300005340 Bacteria 15480
45 Ga0070689_100091659 3300005340 Bacteria 2396
46 Ga0070689_100131373 3300005340 Bacteria 2008
47 Ga0070689_100205587 3300005340 Unclassified 1609
48 Ga0070687_100016758 3300005343 Bacteria 3352
49 Ga0070687_100121568 3300005343 Bacteria 1494
50 Ga0070661_100050801 3300005344 Bacteria 3034
51 Ga0070692_10005852 3300005345 Bacteria 5289
52 Ga0070692_10071889 3300005345 Bacteria 1844
53 Ga0070692_10097759 3300005345 Bacteria 1605
54 Ga0070669_100002270 3300005353 Bacteria 13948
55 Ga0070669_100023213 3300005353 Bacteria 4442
56 Ga0070669_100100642 3300005353 Bacteria 2179
57 Ga0070675_100062377 3300005354 Bacteria 3080
58 Ga0070675_100236220 3300005354 Bacteria 1596
59 Ga0070675_100259467 3300005354 Bacteria 1522
60 Ga0070671_100075601 3300005355 Bacteria 2814
61 Ga0070673_100123315 3300005364 Bacteria 2165
62 Ga0070673_100146774 3300005364 Unclassified 1995
63 Ga0070673_100182932 3300005364 Bacteria 1795
64 Ga0070673_100276631 3300005364 Bacteria 1471
65 Ga0070659_100034370 3300005366 Bacteria 3943
66 Ga0070701_10010878 3300005438 Bacteria 4041
67 Ga0070701_10195773 3300005438 Bacteria 1192
68 Ga0070705_100027512 3300005440 Bacteria 3106
69 Ga0070705_100085767 3300005440 Archaea 1947
70 Ga0070705_100105579 3300005440 Unclassified 1789
71 Ga0070700_100000944 3300005441 Bacteria 14332
72 Ga0070700_100036514 3300005441 Bacteria 2981
73 Ga0070700_100040161 3300005441 Bacteria 2863
74 Ga0070700_100102147 3300005441 Bacteria 1891
75 Ga0070694_100002028 3300005444 Bacteria 12012
76 Ga0070694_100006396 3300005444 Bacteria 7145
77 Ga0070694_100006725 3300005444 Bacteria 6983
78 Ga0070694_100007317 3300005444 Bacteria 6728
79 Ga0070694_100049002 3300005444 Bacteria 2843
80 Ga0070694_100345180 3300005444 Unclassified 1152
81 Ga0070708_100001064 3300005445 Bacteria 20966
82 Ga0070708_100134695 3300005445 Bacteria 2288
83 Ga0070708_100164697 3300005445 Bacteria 2068
84 Ga0070708_100167516 3300005445 Bacteria 2050
85 Ga0070708_100173715 3300005445 Unclassified 2013
86 Ga0070708_100302059 3300005445 Unclassified 1507
87 Ga0070662_100019880 3300005457 Bacteria 4568
88 Ga0070681_10003028 3300005458 Bacteria 15582
89 Ga0070681_10005087 3300005458 Bacteria 12687
90 Ga0070681_10005403 3300005458 Bacteria 12342
91 Ga0068867_100109355 3300005459 Bacteria 2122
92 Ga0070706_100004033 3300005467 Bacteria 14266
93 Ga0070706_100006551 3300005467 Bacteria 10986
94 Ga0070706_100020399 3300005467 Bacteria 6107
95 Ga0070706_100046044 3300005467 Bacteria 4027
96 Ga0070707_100001605 3300005468 Bacteria 21881
97 Ga0070707_100023673 3300005468 Bacteria 5808
98 Ga0070707_100030425 3300005468 Bacteria 5140
99 Ga0070707_100343406 3300005468 Bacteria 1450
100 Ga0070707_100407788 3300005468 Bacteria 1319
101 Ga0070698_100000395 3300005471 Bacteria 45945
102 Ga0070698_100002128 3300005471 Bacteria 21992
103 Ga0070698_100009922 3300005471 Bacteria 10180
104 Ga0070698_100013298 3300005471 Bacteria 8711
105 Ga0070698_100014744 3300005471 Bacteria 8257
106 Ga0070698_100317863 3300005471 Bacteria 1487
107 Ga0070698_100501319 3300005471 Unclassified 1152
108 Ga0070698_100543278 3300005471 Bacteria 1101
109 Ga0070699_100001563 3300005518 Bacteria 20936
110 Ga0070699_100002639 3300005518 Bacteria 16017
111 Ga0070699_100103799 3300005518 Unclassified 2493
112 Ga0070679_100011680 3300005530 Bacteria 8373
113 Ga0070679_100012117 3300005530 Bacteria 8237
114 Ga0070697_100000720 3300005536 Bacteria 24631
115 Ga0070697_100001148 3300005536 Bacteria 20063
116 Ga0070697_100009275 3300005536 Bacteria 7690
117 Ga0070697_100018701 3300005536 Bacteria 5466
118 Ga0070697_100134246 3300005536 Bacteria 2078
119 Ga0070697_100410306 3300005536 Bacteria 1176
120 Ga0068853_100004537 3300005539 Bacteria 10775
121 Ga0068853_100134851 3300005539 Bacteria 2212
122 Ga0070686_100016894 3300005544 Bacteria 4252
123 Ga0070686_100076097 3300005544 Bacteria 2210
124 Ga0070686_100140510 3300005544 Unclassified 1681
125 Ga0070696_100077562 3300005546 Bacteria 2348
126 Ga0070693_100006792 3300005547 Bacteria 5557
127 Ga0070693_100065698 3300005547 Bacteria 2121
128 Ga0070704_100005138 3300005549 Bacteria 7605
129 Ga0070704_100064146 3300005549 Bacteria 2639
130 Ga0070704_100143856 3300005549 Unclassified 1866
131 Ga0070704_100151953 3300005549 Bacteria 1821
132 Ga0070704_100234147 3300005549 Unclassified 1500
133 Ga0070704_100441882 3300005549 Unclassified 1118
134 Ga0070664_100030683 3300005564 Bacteria 4486
135 Ga0070664_100078648 3300005564 Bacteria 2837
136 Ga0070664_100165609 3300005564 Bacteria 1959
137 Ga0070664_100336289 3300005564 Unclassified 1371
138 Ga0068857_100006876 3300005577 Bacteria 9792
139 Ga0068857_100309825 3300005577 Bacteria 1456
140 Ga0068857_100460156 3300005577 Bacteria 1190
141 Ga0068857_100470000 3300005577 Bacteria 1178
142 Ga0068854_100085145 3300005578 Bacteria 2341
143 Ga0068854_100175984 3300005578 Bacteria 1668
144 Ga0068854_100178809 3300005578 Bacteria 1656
145 Ga0068854_100187549 3300005578 Bacteria 1619
146 Ga0068856_100006567 3300005614 Bacteria 11405
147 Ga0070702_100002408 3300005615 Bacteria 8056
148 Ga0070702_100026434 3300005615 Bacteria 3118
149 Ga0070702_100075313 3300005615 Unclassified 2005
150 Ga0070702_100203519 3300005615 Bacteria 1312
151 Ga0068859_100043444 3300005617 Bacteria 4516
152 Ga0068859_100055914 3300005617 Bacteria 3971
153 Ga0068859_100068864 3300005617 Bacteria 3573
154 Ga0068859_100075480 3300005617 Bacteria 3412
155 Ga0068859_100139381 3300005617 Bacteria 2499
156 Ga0068859_100271469 3300005617 Bacteria 1788
157 Ga0068859_100281198 3300005617 Bacteria 1757
158 Ga0068859_100333276 3300005617 Unclassified 1611
159 Ga0068859_100362784 3300005617 Bacteria 1544
160 Ga0068864_100005993 3300005618 Bacteria 9974
161 Ga0068864_100084424 3300005618 Bacteria 2790
162 Ga0068864_100085726 3300005618 Bacteria 2769
163 Ga0068864_100133041 3300005618 Unclassified 2236
164 Ga0068864_100503657 3300005618 Unclassified 1165
165 Ga0068866_10020416 3300005718 Bacteria 3035
166 Ga0068861_100018915 3300005719 Bacteria 4912
167 Ga0068861_100041024 3300005719 Bacteria 3465
168 Ga0068861_100081425 3300005719 Bacteria 2535
169 Ga0068861_100185686 3300005719 Unclassified 1734
170 Ga0068851_10000880 3300005834 Bacteria 12951
171 Ga0068870_10068215 3300005840 Bacteria 1931
172 Ga0068863_100050976 3300005841 Bacteria 3923
173 Ga0068863_100066489 3300005841 Bacteria 3410
174 Ga0068863_100296932 3300005841 Bacteria 1567
175 Ga0068858_100000192 3300005842 Bacteria 65258
176 Ga0068858_100036091 3300005842 Bacteria 4583
177 Ga0068858_100064448 3300005842 Bacteria 3391
178 Ga0068858_100117273 3300005842 Bacteria 2488
179 Ga0068858_100124963 3300005842 Bacteria 2408
180 Ga0068858_100147574 3300005842 Bacteria 2210
181 Ga0068858_100156343 3300005842 Unclassified 2145
182 Ga0068858_100276159 3300005842 Bacteria 1600
183 Ga0068858_100294857 3300005842 Bacteria 1546
184 Ga0068858_100296873 3300005842 Bacteria 1541
185 Ga0068860_100021143 3300005843 Bacteria 6302
186 Ga0068860_100030126 3300005843 Bacteria 5219
187 Ga0068860_100035501 3300005843 Bacteria 4782
188 Ga0068860_100102687 3300005843 Bacteria 2729
189 Ga0068860_100112560 3300005843 Unclassified 2602
190 Ga0068862_100004416 3300005844 Bacteria 11868
191 Ga0068862_100026990 3300005844 Bacteria 4829
192 Ga0068862_100043077 3300005844 Bacteria 3847
193 Ga0068862_100264256 3300005844 Bacteria 1572
194 Ga0081539_10003634 3300005985 Bacteria 18583
195 Ga0081539_10004576 3300005985 Bacteria 15111
196 Ga0081539_10007442 3300005985 Bacteria 9982
197 Ga0081539_10012524 3300005985 Bacteria 6522
198 Ga0070715_10000039 3300006163 Bacteria 66918
199 Ga0070716_100015893 3300006173 Bacteria 3878
200 Ga0097621_100003245 3300006237 Bacteria 11184
201 Ga0097621_100025623 3300006237 Bacteria 4615
202 Ga0097621_100043062 3300006237 Bacteria 3639
203 Ga0068871_100010958 3300006358 Bacteria 6641
204 Ga0068871_100231207 3300006358 Bacteria 1605
205 Ga0075430_100027700 3300006846 Bacteria 4813
206 Ga0075430_100141510 3300006846 Bacteria 2003
207 Ga0075431_100033464 3300006847 Bacteria 5297
208 Ga0075433_10007948 3300006852 Bacteria 8441
209 Ga0075433_10028974 3300006852 Bacteria 4712
210 Ga0075433_10156887 3300006852 Bacteria 2025
211 Ga0075433_10239640 3300006852 Unclassified 1610
212 Ga0075434_100034775 3300006871 Bacteria 4979
213 Ga0075434_100047334 3300006871 Bacteria 4268
214 Ga0075434_100281330 3300006871 Bacteria 1683
215 Ga0075434_100371496 3300006871 Unclassified 1451
216 Ga0075429_100012422 3300006880 Bacteria 7389
217 Ga0075429_100082335 3300006880 Bacteria 2805
218 Ga0075429_100313568 3300006880 Unclassified 1373
219 Ga0068865_100205277 3300006881 Bacteria 1532
220 Ga0075436_100000006 3300006914 Bacteria 306066
221 Ga0075436_100016296 3300006914 Bacteria 5088
222 Ga0097620_100043444 3300006931 Bacteria 4516
223 Ga0097620_100055907 3300006931 Bacteria 3971
224 Ga0097620_100068863 3300006931 Bacteria 3573
225 Ga0097620_100075479 3300006931 Bacteria 3412
226 Ga0097620_100139380 3300006931 Bacteria 2499
227 Ga0097620_100271473 3300006931 Bacteria 1788
228 Ga0097620_100281220 3300006931 Bacteria 1757
229 Ga0097620_100333280 3300006931 Unclassified 1611
230 Ga0097620_100362799 3300006931 Bacteria 1544
231 Ga0075435_100002364 3300007076 Bacteria 12509
232 Ga0075435_100098859 3300007076 Bacteria 2416
233 Ga0075435_100281126 3300007076 Bacteria 1421
234 Ga0105240_10128366 3300009093 Bacteria 3044
235 Ga0111539_10004986 3300009094 Bacteria 17271
236 Ga0111539_10006630 3300009094 Bacteria 14911
237 Ga0111539_10030060 3300009094 Bacteria 6607
238 Ga0105245_10131273 3300009098 Bacteria 2350
239 Ga0105247_10000001 3300009101 Bacteria 739726
240 Ga0105247_10001899 3300009101 Bacteria 14592
241 Ga0105247_10022567 3300009101 Bacteria 3790
242 Ga0105247_10160940 3300009101 Bacteria 1486
243 Ga0105247_10325090 3300009101 Bacteria 1074
244 Ga0114129_10011635 3300009147 Bacteria 12526
245 Ga0114129_10016200 3300009147 Bacteria 10606
246 Ga0114129_10032661 3300009147 Bacteria 7354
247 Ga0114129_10033587 3300009147 Bacteria 7249
248 Ga0114129_10051233 3300009147 Bacteria 5797
249 Ga0114129_10053351 3300009147 Bacteria 5670
250 Ga0114129_10058400 3300009147 Bacteria 5396
251 Ga0114129_10079518 3300009147 Unclassified 4559
252 Ga0114129_10228662 3300009147 Bacteria 2506
253 Ga0114129_10720243 3300009147 Bacteria 1280
254 Ga0105243_10000211 3300009148 Bacteria 67960
255 Ga0105243_10000859 3300009148 Bacteria 28797
256 Ga0105243_10057915 3300009148 Bacteria 3087
257 Ga0105243_10194884 3300009148 Bacteria 1773
258 Ga0105243_10307180 3300009148 Bacteria 1440
259 Ga0105243_10529851 3300009148 Bacteria 1122
260 Ga0105241_10017137 3300009174 Bacteria 5320
261 Ga0105241_10105313 3300009174 Unclassified 2249
262 Ga0105241_10118328 3300009174 Bacteria 2130
263 Ga0105241_10151675 3300009174 Unclassified 1897
264 Ga0105242_10000031 3300009176 Bacteria 98776
265 Ga0105242_10000644 3300009176 Bacteria 27298
266 Ga0105242_10015437 3300009176 Bacteria 5932
267 Ga0105242_10031101 3300009176 Bacteria 4262
268 Ga0105248_10003383 3300009177 Bacteria 17729
269 Ga0105248_10027533 3300009177 Bacteria 6329
270 Ga0105248_10031370 3300009177 Bacteria 5941
271 Ga0105248_10225994 3300009177 Bacteria 2107
272 Ga0105248_10243965 3300009177 Bacteria 2022
273 Ga0105248_10404044 3300009177 Bacteria 1538
274 Ga0105237_10003319 3300009545 Bacteria 19159
275 Ga0105237_10046484 3300009545 Bacteria 4366
276 Ga0105238_10073060 3300009551 Bacteria 3425
277 Ga0105249_10000032 3300009553 Bacteria 215247
278 Ga0105249_10024026 3300009553 Bacteria 5474
279 Ga0105249_10107283 3300009553 Bacteria 2636
280 Ga0105249_10119944 3300009553 Bacteria 2498
281 Ga0105249_10144655 3300009553 Bacteria 2283
282 Ga0105249_10487206 3300009553 Unclassified 1277
283 Ga0105249_10549818 3300009553 Bacteria 1205
284 Ga0099796_10037753 3300010159 Bacteria 1617
285 Ga0105246_10020689 3300011119 Bacteria 4224
286 Ga0105246_10180036 3300011119 Bacteria 1627
287 Ga0157373_10031336 3300013100 Bacteria 3828
288 Ga0157374_10033883 3300013296 Bacteria 4662
289 Ga0157378_10006045 3300013297 Bacteria 10604
290 Ga0157378_10007090 3300013297 Bacteria 9786
291 Ga0157378_10039696 3300013297 Bacteria 4175
292 Ga0157378_10040883 3300013297 Bacteria 4113
293 Ga0157378_10053253 3300013297 Bacteria 3603
294 Ga0157378_10062382 3300013297 Bacteria 3328
295 Ga0157378_10122044 3300013297 Bacteria 2403
296 Ga0157378_10146008 3300013297 Bacteria 2200
297 Ga0157378_10201130 3300013297 Bacteria 1884
298 Ga0157378_10213039 3300013297 Bacteria 1833
299 Ga0157378_10352315 3300013297 Bacteria 1438
300 Ga0163162_10000006 3300013306 Bacteria 410012
301 Ga0163162_10002699 3300013306 Bacteria 16835
302 Ga0163162_10006592 3300013306 Bacteria 11247
303 Ga0163162_10015456 3300013306 Bacteria 7458
304 Ga0163162_10016771 3300013306 Bacteria 7160
305 Ga0163162_10025635 3300013306 Bacteria 5828
306 Ga0163162_10324500 3300013306 Bacteria 1672
307 Ga0163162_10359473 3300013306 Archaea 1589
308 Ga0163162_10382018 3300013306 Bacteria 1542
309 Ga0157372_10008406 3300013307 Bacteria 10963
310 Ga0157375_10004677 3300013308 Bacteria 11905
311 Ga0157375_10009798 3300013308 Bacteria 8425
312 Ga0157375_10024307 3300013308 Bacteria 5605
313 Ga0157375_10326172 3300013308 Unclassified 1700
314 Ga0163163_10002437 3300014325 Bacteria 15737
315 Ga0163163_10003124 3300014325 Bacteria 14035
316 Ga0163163_10008355 3300014325 Bacteria 9195
317 Ga0163163_10013203 3300014325 Bacteria 7550
318 Ga0163163_10061942 3300014325 Bacteria 3707
319 Ga0163163_10064660 3300014325 Bacteria 3629
320 Ga0157380_10037127 3300014326 Bacteria 3773
321 Ga0157380_10055790 3300014326 Unclassified 3139
322 Ga0157380_10098030 3300014326 Bacteria 2434
323 Ga0157380_10156603 3300014326 Bacteria 1975
324 Ga0157380_10193387 3300014326 Bacteria 1798
325 Ga0157377_10060096 3300014745 Bacteria 2169
326 Ga0157379_10060850 3300014968 Bacteria 3377
327 Ga0157379_10219509 3300014968 Unclassified 1722
328 Ga0157379_10428175 3300014968 Bacteria 1219
329 Ga0157376_10028455 3300014969 Bacteria 4442
330 Ga0163161_10035482 3300017792 Bacteria 3569
331 Ga0213876_10000189 3300021384 Bacteria 64122
332 Ga0213876_10000459 3300021384 Bacteria 32662
333 Ga0213876_10047377 3300021384 Unclassified 2272
334 Ga0207672_1000273 3300025223 Bacteria 7017
335 Ga0207653_10000121 3300025885 Bacteria 55532
336 Ga0207710_10000003 3300025900 Bacteria 1071597
337 Ga0207710_10003455 3300025900 Bacteria 7040
338 Ga0207710_10050896 3300025900 Bacteria 1859
339 Ga0207680_10329786 3300025903 Bacteria 1069
340 Ga0207647_10002699 3300025904 Bacteria 13400
341 Ga0207685_10000024 3300025905 Bacteria 113741
342 Ga0207643_10003686 3300025908 Bacteria 8246
343 Ga0207643_10008630 3300025908 Bacteria 5465
344 Ga0207684_10000085 3300025910 Bacteria 175922
345 Ga0207684_10013449 3300025910 Bacteria 7078
346 Ga0207684_10031548 3300025910 Bacteria 4507
347 Ga0207684_10047068 3300025910 Unclassified 3659
348 Ga0207684_10281350 3300025910 Unclassified 1434
349 Ga0207654_10014050 3300025911 Bacteria 4131
350 Ga0207707_10000016 3300025912 Bacteria 256002
351 Ga0207707_10004805 3300025912 Bacteria 11849
352 Ga0207671_10004471 3300025914 Bacteria 13348
353 Ga0207671_10292844 3300025914 Bacteria 1285
354 Ga0207660_10004211 3300025917 Bacteria 9366
355 Ga0207660_10034089 3300025917 Bacteria 3526
356 Ga0207662_10070532 3300025918 Bacteria 2114
357 Ga0207649_10059092 3300025920 Bacteria 2404
358 Ga0207652_10000126 3300025921 Bacteria 82522
359 Ga0207652_10033750 3300025921 Bacteria 4310
360 Ga0207646_10026708 3300025922 Bacteria 5267
361 Ga0207646_10138880 3300025922 Bacteria 2188
362 Ga0207646_10291324 3300025922 Bacteria 1475
363 Ga0207681_10000400 3300025923 Bacteria 30171
364 Ga0207694_10006034 3300025924 Bacteria 9269
365 Ga0207650_10000927 3300025925 Bacteria 22109
366 Ga0207650_10001955 3300025925 Bacteria 14484
367 Ga0207650_10126488 3300025925 Bacteria 1995
368 Ga0207650_10196223 3300025925 Bacteria 1615
369 Ga0207687_10381246 3300025927 Unclassified 1155
370 Ga0207644_10000129 3300025931 Bacteria 54482
371 Ga0207644_10075007 3300025931 Bacteria 2484
372 Ga0207690_10141476 3300025932 Bacteria 1773
373 Ga0207706_10041097 3300025933 Bacteria 4100
374 Ga0207706_10107492 3300025933 Bacteria 2455
375 Ga0207686_10000020 3300025934 Bacteria 185045
376 Ga0207686_10000054 3300025934 Bacteria 107699
377 Ga0207686_10002382 3300025934 Bacteria 10257
378 Ga0207709_10000128 3300025935 Bacteria 111661
379 Ga0207709_10001951 3300025935 Bacteria 13493
380 Ga0207709_10255613 3300025935 Bacteria 1282
381 Ga0207709_10295142 3300025935 Bacteria 1203
382 Ga0207670_10003607 3300025936 Bacteria 8213
383 Ga0207670_10119066 3300025936 Bacteria 1916
384 Ga0207670_10157969 3300025936 Unclassified 1690
385 Ga0207704_10057588 3300025938 Bacteria 2388
386 Ga0207665_10094949 3300025939 Bacteria 2072
387 Ga0207691_10004547 3300025940 Bacteria 13428
388 Ga0207711_10031009 3300025941 Bacteria 4511
389 Ga0207711_10035067 3300025941 Bacteria 4251
390 Ga0207711_10059587 3300025941 Bacteria 3287
391 Ga0207711_10070244 3300025941 Bacteria 3036
392 Ga0207711_10083361 3300025941 Bacteria 2796
393 Ga0207689_10001518 3300025942 Bacteria 22080
394 Ga0207689_10004926 3300025942 Bacteria 12026
395 Ga0207689_10041252 3300025942 Bacteria 3819
396 Ga0207689_10054163 3300025942 Bacteria 3304
397 Ga0207689_10118210 3300025942 Unclassified 2180
398 Ga0207689_10130430 3300025942 Bacteria 2069
399 Ga0207712_10000838 3300025961 Bacteria 22598
400 Ga0207712_10064260 3300025961 Bacteria 2616
401 Ga0207712_10150759 3300025961 Bacteria 1796
402 Ga0207640_10070122 3300025981 Bacteria 2356
403 Ga0207703_10000197 3300026035 Bacteria 70237
404 Ga0207703_10012390 3300026035 Bacteria 6646
405 Ga0207703_10051251 3300026035 Bacteria 3343
406 Ga0207703_10093685 3300026035 Bacteria 2530
407 Ga0207703_10108684 3300026035 Bacteria 2362
408 Ga0207703_10149699 3300026035 Bacteria 2034
409 Ga0207703_10254350 3300026035 Bacteria 1585
410 Ga0207703_10286668 3300026035 Bacteria 1497
411 Ga0207703_10452815 3300026035 Bacteria 1199
412 Ga0207639_10061196 3300026041 Bacteria 2906
413 Ga0207708_10000932 3300026075 Bacteria 21923
414 Ga0207708_10007660 3300026075 Bacteria 7989
415 Ga0207708_10023882 3300026075 Bacteria 4623
416 Ga0207708_10045909 3300026075 Bacteria 3329
417 Ga0207708_10215444 3300026075 Unclassified 1536
418 Ga0207702_10030715 3300026078 Bacteria 4475
419 Ga0207641_10013651 3300026088 Bacteria 6664
420 Ga0207641_10221535 3300026088 Bacteria 1755
421 Ga0207641_10383266 3300026088 Bacteria 1347
422 Ga0207676_10014973 3300026095 Bacteria 5589
423 Ga0207676_10027915 3300026095 Bacteria 4210
424 Ga0207676_10132952 3300026095 Unclassified 2118
425 Ga0207676_10143116 3300026095 Bacteria 2049
426 Ga0207674_10000169 3300026116 Bacteria 78781
427 Ga0207674_10115329 3300026116 Bacteria 2658
428 Ga0207674_10186767 3300026116 Bacteria 2023
429 Ga0207675_100001533 3300026118 Bacteria 23147
430 Ga0207675_100009374 3300026118 Bacteria 9176
431 Ga0207675_100039939 3300026118 Bacteria 4378
432 Ga0207675_100043723 3300026118 Bacteria 4184
433 Ga0207675_100058902 3300026118 Bacteria 3584
434 Ga0207675_100121004 3300026118 Bacteria 2477
435 Ga0207675_100176088 3300026118 Bacteria 2046
436 Ga0207675_100185233 3300026118 Bacteria 1995
437 Ga0207683_10176098 3300026121 Bacteria 1938
438 Ga0207698_10586181 3300026142 Bacteria 1098
439 Ga0207428_10008767 3300027907 Bacteria 9122
440 Ga0207428_10024478 3300027907 Bacteria 5069
441 Ga0207428_10069581 3300027907 Unclassified 2767
442 Ga0268265_10023413 3300028380 Bacteria 4353
443 Ga0268265_10257975 3300028380 Bacteria 1548
444 Ga0268265_10323491 3300028380 Bacteria 1398
445 Ga0268264_10022441 3300028381 Bacteria 5153
446 Ga0268264_10033566 3300028381 Bacteria 4218
447 Ga0268264_10067360 3300028381 Bacteria 3022
448 Ga0268264_10115830 3300028381 Bacteria 2355
449 Ga0268264_10223542 3300028381 Bacteria 1734
450 Ga0307513_10002853 3300031456 Bacteria 23681
451 Ga0307410_10045809 3300031852 Bacteria 2915
452 Ga0307406_10295324 3300031901 Bacteria 1242
453 Ga0307412_10038364 3300031911 Bacteria 3084
454 Ga0307409_100061040 3300031995 Bacteria 2944
455 Ga0307416_100195812 3300032002 Bacteria 1911
456 Ga0307414_10071295 3300032004 Bacteria 2506
457 Ga0307414_10137737 3300032004 Bacteria 1906
458 Ga0307415_100369821 3300032126 Bacteria 1213
459 Ga0373940_0035837 3300035088 Bacteria 1345
460 Ga0373951_0002961 3300035091 Bacteria 4208
461 Ga0373941_0019280 3300035115 Bacteria 1897
462 Ga0373931_0183585 3300035691 Bacteria 1240
463 Ga0395900_0102251 3300037418 Bacteria 2944
464 Ga0395900_0103744 3300037418 Bacteria 2921
465 Ga0395900_0124412 3300037418 Bacteria 2645
466 Ga0395900_0160666 3300037418 Bacteria 2292
467 Ga0395898_0226377 3300037466 Unclassified 1784
468 Ga0395898_0508222 3300037466 Unclassified 1146
469 Ga0395905_0012422 3300037471 Bacteria 8197
470 Ga0395901_0042840 3300038443 Bacteria 4695
471 Ga0395901_0071055 3300038443 Bacteria 3627
472 Ga0395901_0288701 3300038443 Unclassified 1703
473 Ga0395901_0313263 3300038443 Bacteria 1625
474 Ga0242420_019075 3300038996 Bacteria 1213
475 Ga0436365_0826287 3300039437 Bacteria 75557
476 Ga0436365_1406101 3300039437 Bacteria 95267
477 Ga0436365_1907258 3300039437 Bacteria 5195
478 Ga0439434_0006837 3300042435 Bacteria 3333
479 Ga0453684_0170136 3300044712 Bacteria 2569
480 Ga0451576_0036797 3300045051 Bacteria 5186
481 Ga0495632_0004536 3300046519 Bacteria 9416
482 Ga0495663_0000722 3300046525 Bacteria 11352
483 Ga0495598_0000611 3300046537 Bacteria 6758
484 Ga0495621_0000330 3300046539 Bacteria 11530
485 Ga0495621_0033335 3300046539 Bacteria 1775
486 Ga0495659_0075468 3300046664 Unclassified 1270
487 Ga0495670_0059116 3300046691 Bacteria 1924
488 Ga0495636_0123035 3300047318 Unclassified 1149
489 Ga0496102_0172854 3300048905 Bacteria 2034
490 Ga0496106_0064783 3300048909 Bacteria 2781
491 Ga0496107_0352503 3300048910 Bacteria 1095
492 Ga0496112_0207705 3300048915 Bacteria 1916
493 Ga0501292_005115 3300049515 Bacteria 1817
494 Ga0501297_002981 3300049520 Bacteria 1669
495 Ga0501298_004552 3300049521 Bacteria 2190
496 Ga0501299_001588 3300049522 Bacteria 2970
497 Ga0501299_003665 3300049522 Bacteria 2243
498 Ga0501299_020125 3300049522 Bacteria 1213
499 Ga0501031_0099482 3300049568 Unclassified 1898
500 Ga0501038_0003284 3300049574 Bacteria 15072
501 Ga0501042_0069310 3300049578 Bacteria 2522
502 Ga0501046_0133650 3300049580 Unclassified 1880
503 Ga0501072_0201770 3300049588 Bacteria 1586
504 Ga0501072_0202216 3300049588 Unclassified 1584
505 Ga0501075_0169497 3300049591 Bacteria 1666
506 Ga0501076_0027070 3300049592 Bacteria 4447
507 Ga0501202_011580 3300049652 Bacteria 1654
508 Ga0501202_025752 3300049652 Bacteria 1200
509 Ga0501209_004374 3300049656 Bacteria 2446
510 Ga0501223_003574 3300049663 Bacteria 3364
511 Ga0501223_023344 3300049663 Bacteria 1206
512 Ga0501233_005162 3300049668 Bacteria 2418
513 Ga0501239_001466 3300049672 Unclassified 2028
514 Ga0501256_000730 3300049685 Bacteria 2218
515 Ga0501259_004520 3300049688 Bacteria 2212
516 Ga0501260_006093 3300049689 Bacteria 1152
517 Ga0501225_0005395 3300049705 Bacteria 3757
518 Ga0501225_0015020 3300049705 Bacteria 2160
519 Ga0501234_002473 3300049707 Bacteria 2907
520 Ga0501234_005056 3300049707 Bacteria 2070
521 Ga0501245_004717 3300049708 Bacteria 1876
522 Ga0501079_0044946 3300049741 Bacteria 3409
523 Ga0501079_0075302 3300049741 Bacteria 2610
524 Ga0501081_0159081 3300049743 Bacteria 1627
525 Ga0501268_006926 3300049765 Unclassified 1679
526 Ga0501270_017926 3300049767 Unclassified 1043
527 Ga0501283_001969 3300049779 Bacteria 2656
528 Ga0501212_011924 3300049851 Bacteria 1258
529 nmdc:mga05p37_125802_c1 3300050507 Bacteria 3148
530 nmdc:mga05p37_380469_c1 3300050507 Unclassified 1654
531 nmdc:mga05p37_53765_c1 3300050507 Bacteria 4953
532 nmdc:mga05p37_55608_c1 3300050507 Bacteria 4870
533 nmdc:mga05p37_609708_c1 3300050507 Bacteria 1230
534 nmdc:mga05p37_71455_c1 3300050507 Bacteria 4269
535 nmdc:mga09592_63085_c1 3300050508 Bacteria 3135
536 nmdc:mga0qj67_65072_c1 3300050509 Bacteria 2902
537 nmdc:mga08y16_17333_c1 3300050511 Bacteria 7582
538 nmdc:mga08y16_78041_c1 3300050511 Bacteria 3452
539 nmdc:mga0n895_201734_c1 3300050512 Unclassified 2019
540 nmdc:mga0n895_51384_c1 3300050512 Bacteria 4044
541 nmdc:mga0rr50_823_c1 3300050513 Bacteria 16677
542 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
543 nmdc:mga08x19_4765_c1 3300050514 Bacteria 8044
544 nmdc:mga0a205_111895_c1 3300050515 Bacteria 2630
545 nmdc:mga0a205_145387_c1 3300050515 Unclassified 2271
546 nmdc:mga0a205_327352_c1 3300050515 Bacteria 1402
547 nmdc:mga0a205_40002_c1 3300050515 Bacteria 4513
548 Ga0500616_0001229 3300053153 Bacteria 25755
549 Ga0501084_0050251 3300054114 Bacteria 3490
550 Ga0501084_0078240 3300054114 Bacteria 2772
551 Ga0501082_0311543 3300060353 Bacteria 1371
552 Ga0070703_10000149
553 CNAas_1000220
554 JGI24748J21848_1000007
555 JGI24034J26672_10000002
556 JGI24751J29686_10000240
557 JGI25406J46586_10000618
558 Ga0065714_10064422
559 Ga0065704_10013240
560 Ga0065704_10112098
561 Ga0065712_10000122
562 Ga0065712_10009397
563 Ga0065712_10011826
564 Ga0065712_10070148
565 Ga0065712_10077329
566 Ga0065715_10032399
567 Ga0065715_10089124
568 Ga0065715_10093194
569 Ga0065715_10147484
570 Ga0065715_10290656
571 Ga0065707_10005228
572 Ga0065707_10083765
573 Ga0065707_10088643
574 Ga0070676_10079662
575 Ga0070690_100244843
576 Ga0070670_100002174
577 Ga0070670_100016070
578 Ga0070670_100086083
579 Ga0070670_100174711
580 Ga0070670_100211799
581 Ga0070670_100227858
582 Ga0070670_100289182
583 Ga0068869_100011955
584 Ga0068869_100030021
585 Ga0068869_100042813
586 Ga0068869_100188795
587 Ga0068869_100293705
588 Ga0070680_100005457
589 Ga0070680_100035977
590 Ga0070680_100116067
591 Ga0070682_100001124
592 Ga0070682_100001745
593 Ga0070682_100020876
594 Ga0068868_100362027
595 Ga0070689_100001369
596 Ga0070689_100091659
597 Ga0070689_100131373
598 Ga0070689_100205587
599 Ga0070687_100016758
600 Ga0070687_100121568
601 Ga0070661_100050801
602 Ga0070692_10005852
603 Ga0070692_10071889
604 Ga0070692_10097759
605 Ga0070669_100002270
606 Ga0070669_100023213
607 Ga0070669_100100642
608 Ga0070675_100062377
609 Ga0070675_100236220
610 Ga0070675_100259467
611 Ga0070671_100075601
612 Ga0070673_100123315
613 Ga0070673_100146774
614 Ga0070673_100182932
615 Ga0070673_100276631
616 Ga0070659_100034370
617 Ga0070701_10010878
618 Ga0070701_10195773
619 Ga0070705_100027512
620 Ga0070705_100085767
621 Ga0070705_100105579
622 Ga0070700_100000944
623 Ga0070700_100036514
624 Ga0070700_100040161
625 Ga0070700_100102147
626 Ga0070694_100002028
627 Ga0070694_100006396
628 Ga0070694_100006725
629 Ga0070694_100007317
630 Ga0070694_100049002
631 Ga0070694_100345180
632 Ga0070708_100001064
633 Ga0070708_100134695
634 Ga0070708_100164697
635 Ga0070708_100167516
636 Ga0070708_100173715
637 Ga0070708_100302059
638 Ga0070662_100019880
639 Ga0070681_10003028
640 Ga0070681_10005087
641 Ga0070681_10005403
642 Ga0068867_100109355
643 Ga0070706_100004033
644 Ga0070706_100006551
645 Ga0070706_100020399
646 Ga0070706_100046044
647 Ga0070707_100001605
648 Ga0070707_100023673
649 Ga0070707_100030425
650 Ga0070707_100343406
651 Ga0070707_100407788
652 Ga0070698_100000395
653 Ga0070698_100002128
654 Ga0070698_100009922
655 Ga0070698_100013298
656 Ga0070698_100014744
657 Ga0070698_100317863
658 Ga0070698_100501319
659 Ga0070698_100543278
660 Ga0070699_100001563
661 Ga0070699_100002639
662 Ga0070699_100103799
663 Ga0070679_100011680
664 Ga0070679_100012117
665 Ga0070697_100000720
666 Ga0070697_100001148
667 Ga0070697_100009275
668 Ga0070697_100018701
669 Ga0070697_100134246
670 Ga0070697_100410306
671 Ga0068853_100004537
672 Ga0068853_100134851
673 Ga0070686_100016894
674 Ga0070686_100076097
675 Ga0070686_100140510
676 Ga0070696_100077562
677 Ga0070693_100006792
678 Ga0070693_100065698
679 Ga0070704_100005138
680 Ga0070704_100064146
681 Ga0070704_100143856
682 Ga0070704_100151953
683 Ga0070704_100234147
684 Ga0070704_100441882
685 Ga0070664_100030683
686 Ga0070664_100078648
687 Ga0070664_100165609
688 Ga0070664_100336289
689 Ga0068857_100006876
690 Ga0068857_100309825
691 Ga0068857_100460156
692 Ga0068857_100470000
693 Ga0068854_100085145
694 Ga0068854_100175984
695 Ga0068854_100178809
696 Ga0068854_100187549
697 Ga0068856_100006567
698 Ga0070702_100002408
699 Ga0070702_100026434
700 Ga0070702_100075313
701 Ga0070702_100203519
702 Ga0068859_100043444
703 Ga0068859_100055914
704 Ga0068859_100068864
705 Ga0068859_100075480
706 Ga0068859_100139381
707 Ga0068859_100271469
708 Ga0068859_100281198
709 Ga0068859_100333276
710 Ga0068859_100362784
711 Ga0068864_100005993
712 Ga0068864_100084424
713 Ga0068864_100085726
714 Ga0068864_100133041
715 Ga0068864_100503657
716 Ga0068866_10020416
717 Ga0068861_100018915
718 Ga0068861_100041024
719 Ga0068861_100081425
720 Ga0068861_100185686
721 Ga0068851_10000880
722 Ga0068870_10068215
723 Ga0068863_100050976
724 Ga0068863_100066489
725 Ga0068863_100296932
726 Ga0068858_100000192
727 Ga0068858_100036091
728 Ga0068858_100064448
729 Ga0068858_100117273
730 Ga0068858_100124963
731 Ga0068858_100147574
732 Ga0068858_100156343
733 Ga0068858_100276159
734 Ga0068858_100294857
735 Ga0068858_100296873
736 Ga0068860_100021143
737 Ga0068860_100030126
738 Ga0068860_100035501
739 Ga0068860_100102687
740 Ga0068860_100112560
741 Ga0068862_100004416
742 Ga0068862_100026990
743 Ga0068862_100043077
744 Ga0068862_100264256
745 Ga0081539_10003634
746 Ga0081539_10004576
747 Ga0081539_10007442
748 Ga0081539_10012524
749 Ga0070715_10000039
750 Ga0070716_100015893
751 Ga0097621_100003245
752 Ga0097621_100025623
753 Ga0097621_100043062
754 Ga0068871_100010958
755 Ga0068871_100231207
756 Ga0075430_100027700
757 Ga0075430_100141510
758 Ga0075431_100033464
759 Ga0075433_10007948
760 Ga0075433_10028974
761 Ga0075433_10156887
762 Ga0075433_10239640
763 Ga0075434_100034775
764 Ga0075434_100047334
765 Ga0075434_100281330
766 Ga0075434_100371496
767 Ga0075429_100012422
768 Ga0075429_100082335
769 Ga0075429_100313568
770 Ga0068865_100205277
771 Ga0075436_100000006
772 Ga0075436_100016296
773 Ga0097620_100043444
774 Ga0097620_100055907
775 Ga0097620_100068863
776 Ga0097620_100075479
777 Ga0097620_100139380
778 Ga0097620_100271473
779 Ga0097620_100281220
780 Ga0097620_100333280
781 Ga0097620_100362799
782 Ga0075435_100002364
783 Ga0075435_100098859
784 Ga0075435_100281126
785 Ga0105240_10128366
786 Ga0111539_10004986
787 Ga0111539_10006630
788 Ga0111539_10030060
789 Ga0105245_10131273
790 Ga0105247_10000001
791 Ga0105247_10001899
792 Ga0105247_10022567
793 Ga0105247_10160940
794 Ga0105247_10325090
795 Ga0114129_10011635
796 Ga0114129_10016200
797 Ga0114129_10032661
798 Ga0114129_10033587
799 Ga0114129_10051233
800 Ga0114129_10053351
801 Ga0114129_10058400
802 Ga0114129_10079518
803 Ga0114129_10228662
804 Ga0114129_10720243
805 Ga0105243_10000211
806 Ga0105243_10000859
807 Ga0105243_10057915
808 Ga0105243_10194884
809 Ga0105243_10307180
810 Ga0105243_10529851
811 Ga0105241_10017137
812 Ga0105241_10105313
813 Ga0105241_10118328
814 Ga0105241_10151675
815 Ga0105242_10000031
816 Ga0105242_10000644
817 Ga0105242_10015437
818 Ga0105242_10031101
819 Ga0105248_10003383
820 Ga0105248_10027533
821 Ga0105248_10031370
822 Ga0105248_10225994
823 Ga0105248_10243965
824 Ga0105248_10404044
825 Ga0105237_10003319
826 Ga0105237_10046484
827 Ga0105238_10073060
828 Ga0105249_10000032
829 Ga0105249_10024026
830 Ga0105249_10107283
831 Ga0105249_10119944
832 Ga0105249_10144655
833 Ga0105249_10487206
834 Ga0105249_10549818
835 Ga0099796_10037753
836 Ga0105246_10020689
837 Ga0105246_10180036
838 Ga0157373_10031336
839 Ga0157374_10033883
840 Ga0157378_10006045
841 Ga0157378_10007090
842 Ga0157378_10039696
843 Ga0157378_10040883
844 Ga0157378_10053253
845 Ga0157378_10062382
846 Ga0157378_10122044
847 Ga0157378_10146008
848 Ga0157378_10201130
849 Ga0157378_10213039
850 Ga0157378_10352315
851 Ga0163162_10000006
852 Ga0163162_10002699
853 Ga0163162_10006592
854 Ga0163162_10015456
855 Ga0163162_10016771
856 Ga0163162_10025635
857 Ga0163162_10324500
858 Ga0163162_10359473
859 Ga0163162_10382018
860 Ga0157372_10008406
861 Ga0157375_10004677
862 Ga0157375_10009798
863 Ga0157375_10024307
864 Ga0157375_10326172
865 Ga0163163_10002437
866 Ga0163163_10003124
867 Ga0163163_10008355
868 Ga0163163_10013203
869 Ga0163163_10061942
870 Ga0163163_10064660
871 Ga0157380_10037127
872 Ga0157380_10055790
873 Ga0157380_10098030
874 Ga0157380_10156603
875 Ga0157380_10193387
876 Ga0157377_10060096
877 Ga0157379_10060850
878 Ga0157379_10219509
879 Ga0157379_10428175
880 Ga0157376_10028455
881 Ga0163161_10035482
882 Ga0213876_10000189
883 Ga0213876_10000459
884 Ga0213876_10047377
885 Ga0207672_1000273
886 Ga0207653_10000121
887 Ga0207710_10000003
888 Ga0207710_10003455
889 Ga0207710_10050896
890 Ga0207680_10329786
891 Ga0207647_10002699
892 Ga0207685_10000024
893 Ga0207643_10003686
894 Ga0207643_10008630
895 Ga0207684_10000085
896 Ga0207684_10013449
897 Ga0207684_10031548
898 Ga0207684_10047068
899 Ga0207684_10281350
900 Ga0207654_10014050
901 Ga0207707_10000016
902 Ga0207707_10004805
903 Ga0207671_10004471
904 Ga0207671_10292844
905 Ga0207660_10004211
906 Ga0207660_10034089
907 Ga0207662_10070532
908 Ga0207649_10059092
909 Ga0207652_10000126
910 Ga0207652_10033750
911 Ga0207646_10026708
912 Ga0207646_10138880
913 Ga0207646_10291324
914 Ga0207681_10000400
915 Ga0207694_10006034
916 Ga0207650_10000927
917 Ga0207650_10001955
918 Ga0207650_10126488
919 Ga0207650_10196223
920 Ga0207687_10381246
921 Ga0207644_10000129
922 Ga0207644_10075007
923 Ga0207690_10141476
924 Ga0207706_10041097
925 Ga0207706_10107492
926 Ga0207686_10000020
927 Ga0207686_10000054
928 Ga0207686_10002382
929 Ga0207709_10000128
930 Ga0207709_10001951
931 Ga0207709_10255613
932 Ga0207709_10295142
933 Ga0207670_10003607
934 Ga0207670_10119066
935 Ga0207670_10157969
936 Ga0207704_10057588
937 Ga0207665_10094949
938 Ga0207691_10004547
939 Ga0207711_10031009
940 Ga0207711_10035067
941 Ga0207711_10059587
942 Ga0207711_10070244
943 Ga0207711_10083361
944 Ga0207689_10001518
945 Ga0207689_10004926
946 Ga0207689_10041252
947 Ga0207689_10054163
948 Ga0207689_10118210
949 Ga0207689_10130430
950 Ga0207712_10000838
951 Ga0207712_10064260
952 Ga0207712_10150759
953 Ga0207640_10070122
954 Ga0207703_10000197
955 Ga0207703_10012390
956 Ga0207703_10051251
957 Ga0207703_10093685
958 Ga0207703_10108684
959 Ga0207703_10149699
960 Ga0207703_10254350
961 Ga0207703_10286668
962 Ga0207703_10452815
963 Ga0207639_10061196
964 Ga0207708_10000932
965 Ga0207708_10007660
966 Ga0207708_10023882
967 Ga0207708_10045909
968 Ga0207708_10215444
969 Ga0207702_10030715
970 Ga0207641_10013651
971 Ga0207641_10221535
972 Ga0207641_10383266
973 Ga0207676_10014973
974 Ga0207676_10027915
975 Ga0207676_10132952
976 Ga0207676_10143116
977 Ga0207674_10000169
978 Ga0207674_10115329
979 Ga0207674_10186767
980 Ga0207675_100001533
981 Ga0207675_100009374
982 Ga0207675_100039939
983 Ga0207675_100043723
984 Ga0207675_100058902
985 Ga0207675_100121004
986 Ga0207675_100176088
987 Ga0207675_100185233
988 Ga0207683_10176098
989 Ga0207698_10586181
990 Ga0207428_10008767
991 Ga0207428_10024478
992 Ga0207428_10069581
993 Ga0268265_10023413
994 Ga0268265_10257975
995 Ga0268265_10323491
996 Ga0268264_10022441
997 Ga0268264_10033566
998 Ga0268264_10067360
999 Ga0268264_10115830
1000 Ga0268264_10223542
1001 Ga0307513_10002853
1002 Ga0307410_10045809
1003 Ga0307406_10295324
1004 Ga0307412_10038364
1005 Ga0307409_100061040
1006 Ga0307416_100195812
1007 Ga0307414_10071295
1008 Ga0307414_10137737
1009 Ga0307415_100369821
1010 Ga0373940_0035837
1011 Ga0373951_0002961
1012 Ga0373941_0019280
1013 Ga0373931_0183585
1014 Ga0395900_0102251
1015 Ga0395900_0103744
1016 Ga0395900_0124412
1017 Ga0395900_0160666
1018 Ga0395898_0226377
1019 Ga0395898_0508222
1020 Ga0395905_0012422
1021 Ga0395901_0042840
1022 Ga0395901_0071055
1023 Ga0395901_0288701
1024 Ga0395901_0313263
1025 Ga0242420_019075
1026 Ga0436365_0826287
1027 Ga0436365_1406101
1028 Ga0436365_1907258
1029 Ga0439434_0006837
1030 Ga0453684_0170136
1031 Ga0451576_0036797
1032 Ga0495632_0004536
1033 Ga0495663_0000722
1034 Ga0495598_0000611
1035 Ga0495621_0000330
1036 Ga0495621_0033335
1037 Ga0495659_0075468
1038 Ga0495670_0059116
1039 Ga0495636_0123035
1040 Ga0496102_0172854
1041 Ga0496106_0064783
1042 Ga0496107_0352503
1043 Ga0496112_0207705
1044 Ga0501292_005115
1045 Ga0501297_002981
1046 Ga0501298_004552
1047 Ga0501299_001588
1048 Ga0501299_003665
1049 Ga0501299_020125
1050 Ga0501031_0099482
1051 Ga0501038_0003284
1052 Ga0501042_0069310
1053 Ga0501046_0133650
1054 Ga0501072_0201770
1055 Ga0501072_0202216
1056 Ga0501075_0169497
1057 Ga0501076_0027070
1058 Ga0501202_011580
1059 Ga0501202_025752
1060 Ga0501209_004374
1061 Ga0501223_003574
1062 Ga0501223_023344
1063 Ga0501233_005162
1064 Ga0501239_001466
1065 Ga0501256_000730
1066 Ga0501259_004520
1067 Ga0501260_006093
1068 Ga0501225_0005395
1069 Ga0501225_0015020
1070 Ga0501234_002473
1071 Ga0501234_005056
1072 Ga0501245_004717
1073 Ga0501079_0044946
1074 Ga0501079_0075302
1075 Ga0501081_0159081
1076 Ga0501268_006926
1077 Ga0501270_017926
1078 Ga0501283_001969
1079 Ga0501212_011924
1080 nmdc:mga05p37_125802_c1
1081 nmdc:mga05p37_380469_c1
1082 nmdc:mga05p37_53765_c1
1083 nmdc:mga05p37_55608_c1
1084 nmdc:mga05p37_609708_c1
1085 nmdc:mga05p37_71455_c1
1086 nmdc:mga09592_63085_c1
1087 nmdc:mga0qj67_65072_c1
1088 nmdc:mga08y16_17333_c1
1089 nmdc:mga08y16_78041_c1
1090 nmdc:mga0n895_201734_c1
1091 nmdc:mga0n895_51384_c1
1092 nmdc:mga0rr50_823_c1
1093 nmdc:mga08x19_13_c1
1094 nmdc:mga08x19_4765_c1
1095 nmdc:mga0a205_111895_c1
1096 nmdc:mga0a205_145387_c1
1097 nmdc:mga0a205_327352_c1
1098 nmdc:mga0a205_40002_c1
1099 Ga0500616_0001229
1100 Ga0501084_0050251
1101 Ga0501084_0078240
1102 Ga0501082_0311543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21570

ArgZ-like_C_2nd

Arginine dihydrolase ArgZ-like, C-terminal, Rossmann fold

59

163

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lrh-assembly1.cif.gz_B crystal structure of the binary complex of agre c264a mutant with l-arginine 0.756 55 317
6lrf-assembly1.cif.gz_A-2 crystal structure of unliganded agre 0.7419 57 316
6lrf-assembly1.cif.gz_B-2 crystal structure of unliganded agre 0.7382 57 316
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7311 53 315
6lrh-assembly1.cif.gz_A-2 crystal structure of the binary complex of agre c264a mutant with l-arginine 0.7289 57 316
ID Description Score Start End Superfamily
af_P39994_188_341_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7352 57 110 3.40.50.1220
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6679 28 317 3.40.910.10
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6425 28 317 3.40.910.10
af_Q07471_200_363_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.642 57 110 3.40.50.1220
3c2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;putative lor/sdh protein like domains 0.6337 52 316 3.40.50.10690
ID Description Score Start End GO Terms
AF-A0A2V8SJW6-F1-model_v4 Uncharacterized protein 0.9781 148 322
AF-A0A7V9GBR8-F1-model_v4 Uncharacterized protein 0.9728 74 316
AF-A0A496SJZ8-F1-model_v4 Uncharacterized protein 0.9672 59 316
AF-A0A2V8SJW6-F1-model_v4 Uncharacterized protein 0.9672 148 322
AF-A0A2V8QJV0-F1-model_v4 Uncharacterized protein 0.9666 183 322

Map