F462288

General Info

Members Datasets Scaffolds Average Seq Length
548 242 1096 121

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0144744|Ga0501040_0144744_891_1307
Length 138
Sequence MRERTANMPRIWRVYSGADGRSHLEEMPLTMKPFVDVEGAHGESTELQSARGIAFRVAPPGYELGWHCAPRRQYSISLSGTAEIEVGDGTVARIGPGDVLLAEDLTGQGHVTRVVGDQPRFYATVPLADGAIVDRDRS

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 16.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0144744 3300049576 Bacteria 1675
2 JGI25407J50210_10078924 3300003373 Unclassified 819
3 JGI25405J52794_10021036 3300003911 Unclassified 1317
4 Ga0065704_10532284 3300005289 Unclassified 646
5 Ga0065707_10147757 3300005295 Bacteria 1693
6 Ga0065707_10353022 3300005295 Bacteria 905
7 Ga0070676_10000835 3300005328 Bacteria 15222
8 Ga0070683_100696636 3300005329 Bacteria 973
9 Ga0070690_100421360 3300005330 Bacteria 984
10 Ga0070670_100440609 3300005331 Bacteria 1153
11 Ga0068869_100000100 3300005334 Bacteria 40244
12 Ga0070680_100001323 3300005336 Bacteria 17945
13 Ga0070682_100000317 3300005337 Bacteria 33282
14 Ga0068868_102102712 3300005338 Unclassified 537
15 Ga0070660_100001212 3300005339 Bacteria 17501
16 Ga0070689_100027733 3300005340 Bacteria 4272
17 Ga0070689_100522042 3300005340 Bacteria 1020
18 Ga0070691_10098732 3300005341 Bacteria 1448
19 Ga0070687_100019285 3300005343 Bacteria 3170
20 Ga0070661_100002398 3300005344 Bacteria 12846
21 Ga0070692_10000340 3300005345 Bacteria 13582
22 Ga0070669_100023622 3300005353 Bacteria 4403
23 Ga0070669_100075728 3300005353 Bacteria 2496
24 Ga0070671_100392763 3300005355 Bacteria 1186
25 Ga0070659_100001444 3300005366 Bacteria 17140
26 Ga0070667_100145714 3300005367 Bacteria 2077
27 Ga0070703_10004118 3300005406 Bacteria 4104
28 Ga0070703_10012868 3300005406 Bacteria 2372
29 Ga0070709_10010654 3300005434 Bacteria 5099
30 Ga0070713_100631561 3300005436 Bacteria 1019
31 Ga0070701_10352898 3300005438 Unclassified 919
32 Ga0070705_100000258 3300005440 Bacteria 31582
33 Ga0070705_100297967 3300005440 Bacteria 1154
34 Ga0070705_100684425 3300005440 Bacteria 804
35 Ga0070705_101718475 3300005440 Bacteria 531
36 Ga0070700_100023344 3300005441 Bacteria 3616
37 Ga0070700_100792865 3300005441 Unclassified 762
38 Ga0070694_100001242 3300005444 Bacteria 14771
39 Ga0070694_100284449 3300005444 Bacteria 1262
40 Ga0070708_100115671 3300005445 Bacteria 2469
41 Ga0070708_100284693 3300005445 Bacteria 1556
42 Ga0070708_101101788 3300005445 Unclassified 744
43 Ga0070708_101242093 3300005445 Bacteria 696
44 Ga0070663_100000686 3300005455 Bacteria 18224
45 Ga0070662_100238621 3300005457 Bacteria 1457
46 Ga0070681_10040265 3300005458 Bacteria 4682
47 Ga0068867_100000363 3300005459 Bacteria 30258
48 Ga0070706_100018405 3300005467 Bacteria 6444
49 Ga0070706_100121215 3300005467 Bacteria 2438
50 Ga0070706_100179830 3300005467 Bacteria 1975
51 Ga0070706_101116464 3300005467 Bacteria 726
52 Ga0070707_100098200 3300005468 Bacteria 2836
53 Ga0070707_100144984 3300005468 Bacteria 2311
54 Ga0070707_100155392 3300005468 Bacteria 2228
55 Ga0070698_100380179 3300005471 Bacteria 1345
56 Ga0070698_100600550 3300005471 Bacteria 1041
57 Ga0070698_100607089 3300005471 Bacteria 1034
58 Ga0070698_100753794 3300005471 Unclassified 917
59 Ga0070699_100008497 3300005518 Bacteria 8896
60 Ga0070699_100020841 3300005518 Bacteria 5653
61 Ga0070699_100175777 3300005518 Bacteria 1898
62 Ga0070699_100818148 3300005518 Bacteria 852
63 Ga0070679_100007138 3300005530 Bacteria 10430
64 Ga0070684_100114098 3300005535 Bacteria 2425
65 Ga0070697_100024687 3300005536 Bacteria 4787
66 Ga0070697_100271188 3300005536 Bacteria 1455
67 Ga0070697_100322394 3300005536 Bacteria 1331
68 Ga0070697_101124304 3300005536 Bacteria 699
69 Ga0068853_100000772 3300005539 Bacteria 22209
70 Ga0070686_100139044 3300005544 Unclassified 1688
71 Ga0070686_101867373 3300005544 Bacteria 512
72 Ga0070695_100000413 3300005545 Bacteria 22090
73 Ga0070696_100000360 3300005546 Bacteria 27771
74 Ga0070696_100207046 3300005546 Bacteria 1467
75 Ga0070696_100331313 3300005546 Bacteria 1174
76 Ga0070693_100001330 3300005547 Bacteria 11125
77 Ga0070704_100000110 3300005549 Bacteria 28752
78 Ga0070704_100201262 3300005549 Bacteria 1608
79 Ga0068855_100002633 3300005563 Bacteria 22124
80 Ga0070664_100002613 3300005564 Bacteria 14538
81 Ga0068857_100015554 3300005577 Bacteria 6647
82 Ga0068854_100002100 3300005578 Bacteria 12212
83 Ga0068856_100002222 3300005614 Bacteria 20092
84 Ga0070702_101238093 3300005615 Bacteria 603
85 Ga0068852_100243328 3300005616 Bacteria 1720
86 Ga0068859_100001704 3300005617 Bacteria 22390
87 Ga0068859_100674319 3300005617 Unclassified 1125
88 Ga0068864_101001800 3300005618 Bacteria 829
89 Ga0068866_11109115 3300005718 Unclassified 567
90 Ga0068861_100006038 3300005719 Bacteria 8237
91 Ga0068861_100551916 3300005719 Unclassified 1050
92 Ga0068870_10000146 3300005840 Bacteria 24886
93 Ga0068863_100115750 3300005841 Bacteria 2555
94 Ga0068863_100187250 3300005841 Bacteria 1988
95 Ga0068858_100241249 3300005842 Bacteria 1715
96 Ga0068860_100021873 3300005843 Bacteria 6189
97 Ga0068862_100000570 3300005844 Bacteria 38413
98 Ga0068862_100637365 3300005844 Bacteria 1027
99 Ga0068862_101051548 3300005844 Unclassified 807
100 Ga0081455_10000662 3300005937 Bacteria 44669
101 Ga0081455_10002504 3300005937 Bacteria 21800
102 Ga0081455_10004394 3300005937 Bacteria 15850
103 Ga0081455_10501637 3300005937 Bacteria 815
104 Ga0081538_10005315 3300005981 Bacteria 11598
105 Ga0081538_10009232 3300005981 Bacteria 8259
106 Ga0081538_10042341 3300005981 Bacteria 2875
107 Ga0081538_10072184 3300005981 Bacteria 1894
108 Ga0081538_10100564 3300005981 Bacteria 1458
109 Ga0081538_10140029 3300005981 Bacteria 1118
110 Ga0081540_1059052 3300005983 Bacteria 1844
111 Ga0081539_10013231 3300005985 Bacteria 6241
112 Ga0081539_10216107 3300005985 Bacteria 875
113 Ga0070717_10986833 3300006028 Unclassified 767
114 Ga0070716_100008859 3300006173 Bacteria 5000
115 Ga0070716_100741695 3300006173 Bacteria 755
116 Ga0075427_10013386 3300006194 Bacteria 1254
117 Ga0075427_10019278 3300006194 Bacteria 1075
118 Ga0068871_100811366 3300006358 Bacteria 863
119 Ga0075428_100000435 3300006844 Bacteria 41534
120 Ga0075428_100008998 3300006844 Bacteria 11077
121 Ga0075428_100065286 3300006844 Bacteria 3985
122 Ga0075428_100066303 3300006844 Bacteria 3952
123 Ga0075428_100098303 3300006844 Bacteria 3191
124 Ga0075428_100343107 3300006844 Bacteria 1603
125 Ga0075428_100700900 3300006844 Bacteria 1079
126 Ga0075428_101484044 3300006844 Unclassified 710
127 Ga0075428_102135847 3300006844 Unclassified 579
128 Ga0075428_102312893 3300006844 Bacteria 553
129 Ga0075430_100001040 3300006846 Bacteria 21918
130 Ga0075430_100010088 3300006846 Bacteria 7993
131 Ga0075430_100149674 3300006846 Bacteria 1944
132 Ga0075430_100816246 3300006846 Unclassified 768
133 Ga0075431_100002879 3300006847 Bacteria 16650
134 Ga0075431_100024616 3300006847 Bacteria 6171
135 Ga0075431_100031378 3300006847 Bacteria 5473
136 Ga0075431_100067351 3300006847 Bacteria 3696
137 Ga0075431_100754318 3300006847 Unclassified 948
138 Ga0075431_100936740 3300006847 Unclassified 835
139 Ga0075431_101108419 3300006847 Unclassified 756
140 Ga0075433_10002894 3300006852 Bacteria 13156
141 Ga0075433_10012454 3300006852 Bacteria 6874
142 Ga0075433_10013148 3300006852 Bacteria 6718
143 Ga0075433_10047339 3300006852 Bacteria 3740
144 Ga0075433_10210421 3300006852 Unclassified 1728
145 Ga0075433_10555101 3300006852 Bacteria 1009
146 Ga0075433_10832919 3300006852 Unclassified 806
147 Ga0075434_100032220 3300006871 Bacteria 5167
148 Ga0075434_100044421 3300006871 Bacteria 4408
149 Ga0075434_100050891 3300006871 Bacteria 4115
150 Ga0075434_100153561 3300006871 Bacteria 2322
151 Ga0075434_100657022 3300006871 Bacteria 1067
152 Ga0075434_100691344 3300006871 Bacteria 1038
153 Ga0075434_101808253 3300006871 Bacteria 618
154 Ga0075434_101818848 3300006871 Bacteria 616
155 Ga0075429_100000189 3300006880 Bacteria 40717
156 Ga0075429_100008463 3300006880 Bacteria 8956
157 Ga0075429_100050494 3300006880 Bacteria 3618
158 Ga0075429_100319042 3300006880 Bacteria 1360
159 Ga0075429_100487403 3300006880 Bacteria 1080
160 Ga0075429_100644711 3300006880 Bacteria 928
161 Ga0075429_101652517 3300006880 Unclassified 557
162 Ga0068865_100208777 3300006881 Bacteria 1520
163 Ga0075436_100046586 3300006914 Bacteria 2990
164 Ga0075436_100057059 3300006914 Unclassified 2697
165 Ga0075436_100185926 3300006914 Bacteria 1469
166 Ga0075436_100444481 3300006914 Bacteria 943
167 Ga0097620_100001704 3300006931 Bacteria 22390
168 Ga0097620_100674316 3300006931 Unclassified 1125
169 Ga0075435_100027503 3300007076 Bacteria 4450
170 Ga0075435_100034184 3300007076 Bacteria 4025
171 Ga0075435_100082223 3300007076 Unclassified 2647
172 Ga0075435_100105026 3300007076 Bacteria 2344
173 Ga0075435_100425638 3300007076 Bacteria 1144
174 Ga0075435_100819354 3300007076 Bacteria 811
175 Ga0075435_101660721 3300007076 Bacteria 560
176 Ga0075435_101839317 3300007076 Bacteria 531
177 Ga0099794_10013804 3300007265 Bacteria 3525
178 Ga0105251_10591772 3300009011 Bacteria 526
179 Ga0111539_10010131 3300009094 Bacteria 11877
180 Ga0111539_10066446 3300009094 Bacteria 4260
181 Ga0111539_10068178 3300009094 Bacteria 4200
182 Ga0111539_10198906 3300009094 Bacteria 2337
183 Ga0111539_11952232 3300009094 Unclassified 681
184 Ga0105245_10660652 3300009098 Bacteria 1076
185 Ga0114129_10020844 3300009147 Bacteria 9311
186 Ga0114129_10029628 3300009147 Bacteria 7751
187 Ga0114129_10075101 3300009147 Bacteria 4706
188 Ga0114129_10088783 3300009147 Bacteria 4285
189 Ga0114129_10168023 3300009147 Bacteria 2992
190 Ga0114129_10293115 3300009147 Bacteria 2171
191 Ga0114129_10557694 3300009147 Bacteria 1489
192 Ga0114129_10777871 3300009147 Bacteria 1223
193 Ga0114129_10848356 3300009147 Unclassified 1161
194 Ga0114129_11153727 3300009147 Unclassified 967
195 Ga0105243_12569044 3300009148 Bacteria 549
196 Ga0105241_10000892 3300009174 Bacteria 22530
197 Ga0105241_10299069 3300009174 Bacteria 1381
198 Ga0105248_10338159 3300009177 Bacteria 1695
199 Ga0105238_10236158 3300009551 Bacteria 1805
200 Ga0105249_10043865 3300009553 Bacteria 4068
201 Ga0105249_10294513 3300009553 Bacteria 1625
202 Ga0105249_12131572 3300009553 Bacteria 633
203 Ga0105239_11167509 3300010375 Bacteria 887
204 Ga0105246_10470658 3300011119 Bacteria 1061
205 Ga0105246_11483048 3300011119 Bacteria 636
206 Ga0157373_10000460 3300013100 Bacteria 32280
207 Ga0157373_10343393 3300013100 Bacteria 1064
208 Ga0157371_10258757 3300013102 Bacteria 1254
209 Ga0157369_10034179 3300013105 Bacteria 5582
210 Ga0157378_10172215 3300013297 Bacteria 2031
211 Ga0157378_10318567 3300013297 Unclassified 1510
212 Ga0163162_10093553 3300013306 Bacteria 3091
213 Ga0163162_11613077 3300013306 Unclassified 740
214 Ga0157372_10000831 3300013307 Bacteria 33455
215 Ga0157375_10096258 3300013308 Bacteria 3033
216 Ga0163163_10051649 3300014325 Bacteria 4053
217 Ga0157377_10444621 3300014745 Bacteria 893
218 Ga0157377_10859042 3300014745 Bacteria 674
219 Ga0182006_1127223 3300015261 Bacteria 880
220 Ga0182007_10023204 3300015262 Bacteria 2184
221 Ga0206353_11125292 3300020082 Bacteria 1411
222 Ga0213872_10097310 3300021361 Bacteria 1314
223 Ga0207653_10002377 3300025885 Bacteria 5997
224 Ga0207642_10249908 3300025899 Bacteria 1006
225 Ga0207688_10154441 3300025901 Bacteria 1358
226 Ga0207645_10000644 3300025907 Bacteria 29005
227 Ga0207643_10000728 3300025908 Bacteria 20177
228 Ga0207684_10027949 3300025910 Bacteria 4805
229 Ga0207684_10063480 3300025910 Bacteria 3135
230 Ga0207684_10120703 3300025910 Unclassified 2247
231 Ga0207684_10342117 3300025910 Bacteria 1288
232 Ga0207684_10543837 3300025910 Unclassified 994
233 Ga0207684_10594566 3300025910 Bacteria 945
234 Ga0207684_11256369 3300025910 Bacteria 611
235 Ga0207654_10001333 3300025911 Bacteria 13116
236 Ga0207707_10000595 3300025912 Bacteria 36460
237 Ga0207660_10001659 3300025917 Bacteria 14918
238 Ga0207662_10228277 3300025918 Bacteria 1215
239 Ga0207657_10000515 3300025919 Bacteria 40907
240 Ga0207652_10002463 3300025921 Bacteria 15597
241 Ga0207646_10031171 3300025922 Bacteria 4828
242 Ga0207646_10052471 3300025922 Bacteria 3649
243 Ga0207646_10221912 3300025922 Bacteria 1707
244 Ga0207646_10305132 3300025922 Bacteria 1438
245 Ga0207681_10020440 3300025923 Bacteria 4196
246 Ga0207681_10032107 3300025923 Bacteria 3436
247 Ga0207681_10539710 3300025923 Unclassified 959
248 Ga0207694_10216466 3300025924 Bacteria 1561
249 Ga0207650_10020645 3300025925 Bacteria 4647
250 Ga0207687_10399234 3300025927 Bacteria 1130
251 Ga0207644_10280876 3300025931 Bacteria 1337
252 Ga0207644_10460284 3300025931 Unclassified 1046
253 Ga0207690_10007768 3300025932 Bacteria 6368
254 Ga0207706_10002145 3300025933 Bacteria 19297
255 Ga0207704_10292082 3300025938 Bacteria 1244
256 Ga0207704_11124331 3300025938 Unclassified 668
257 Ga0207665_10001065 3300025939 Bacteria 18463
258 Ga0207691_10501426 3300025940 Bacteria 1031
259 Ga0207711_10656578 3300025941 Bacteria 978
260 Ga0207689_10000397 3300025942 Bacteria 40921
261 Ga0207661_12098391 3300025944 Bacteria 511
262 Ga0207667_10009000 3300025949 Bacteria 11810
263 Ga0207712_10160370 3300025961 Bacteria 1747
264 Ga0207640_10011795 3300025981 Bacteria 4959
265 Ga0207658_10284445 3300025986 Bacteria 1419
266 Ga0207703_10150291 3300026035 Bacteria 2030
267 Ga0207703_10991524 3300026035 Unclassified 806
268 Ga0207639_10004865 3300026041 Bacteria 9046
269 Ga0207678_10014830 3300026067 Bacteria 6856
270 Ga0207708_10099200 3300026075 Bacteria 2252
271 Ga0207702_10003863 3300026078 Bacteria 13507
272 Ga0207641_11198174 3300026088 Bacteria 759
273 Ga0207648_10002755 3300026089 Bacteria 18686
274 Ga0207676_10076386 3300026095 Bacteria 2706
275 Ga0207674_10004369 3300026116 Bacteria 17043
276 Ga0207674_11077964 3300026116 Bacteria 773
277 Ga0207675_100034084 3300026118 Bacteria 4745
278 Ga0207675_100662235 3300026118 Unclassified 1051
279 Ga0209974_10039775 3300027876 Bacteria 1564
280 Ga0207428_10001927 3300027907 Bacteria 21011
281 Ga0207428_10070849 3300027907 Bacteria 2739
282 Ga0207428_10550064 3300027907 Bacteria 835
283 Ga0268265_10001662 3300028380 Bacteria 18185
284 Ga0268265_10149315 3300028380 Bacteria 1969
285 Ga0268264_10022550 3300028381 Bacteria 5138
286 Ga0307408_101247544 3300031548 Bacteria 695
287 Ga0307410_11400618 3300031852 Unclassified 614
288 Ga0307406_10100496 3300031901 Bacteria 1969
289 Ga0307414_11211570 3300032004 Unclassified 699
290 Ga0373948_0029422 3300034817 Bacteria 1099
291 Ga0373959_0003218 3300034820 Bacteria 2598
292 Ga0373949_0009258 3300035090 Bacteria 2158
293 Ga0373951_0008501 3300035091 Bacteria 2315
294 Ga0373951_0087132 3300035091 Bacteria 815
295 Ga0373960_0009894 3300035121 Bacteria 2319
296 Ga0373962_0018048 3300035242 Bacteria 1832
297 Ga0373931_0268585 3300035691 Bacteria 1043
298 Ga0373931_0523196 3300035691 Bacteria 768
299 Ga0395899_0019185 3300037312 Bacteria 5198
300 Ga0395900_0023182 3300037418 Bacteria 6354
301 Ga0395898_0001915 3300037466 Bacteria 26488
302 Ga0395901_0000430 3300038443 Bacteria 49340
303 Ga0436360_0183824 3300039438 Bacteria 1104
304 Ga0436361_0051636 3300039447 Unclassified 706
305 Ga0436361_0113826 3300039447 Bacteria 5354
306 Ga0436362_0636969 3300039453 Bacteria 1443
307 Ga0439462_0162085 3300042015 Unclassified 631
308 Ga0450889_003235 3300042144 Bacteria 1608
309 Ga0439458_0055468 3300042157 Bacteria 983
310 Ga0439459_0022695 3300042438 Bacteria 1216
311 Ga0439464_0004255 3300042439 Bacteria 3656
312 Ga0439460_0000058 3300042461 Bacteria 16284
313 Ga0439460_0164052 3300042461 Unclassified 746
314 Ga0451577_0147574 3300042876 Bacteria 2115
315 Ga0451577_0209988 3300042876 Bacteria 1758
316 Ga0451577_1487626 3300042876 Bacteria 599
317 Ga0453683_0041391 3300044673 Unclassified 2894
318 Ga0453683_0085604 3300044673 Bacteria 1975
319 Ga0453683_0263919 3300044673 Bacteria 1099
320 Ga0453684_0328512 3300044712 Bacteria 1730
321 Ga0451576_0022073 3300045051 Bacteria 6907
322 Ga0451576_0130397 3300045051 Bacteria 2620
323 Ga0451576_0215139 3300045051 Bacteria 2007
324 Ga0495664_0746436 3300046477 Bacteria 577
325 Ga0495608_0795706 3300046511 Bacteria 558
326 Ga0495628_0868110 3300046516 Bacteria 628
327 Ga0495642_0039881 3300046528 Bacteria 1906
328 Ga0495652_0664013 3300046529 Bacteria 705
329 Ga0495598_0048256 3300046537 Bacteria 1273
330 Ga0495656_0192549 3300046615 Bacteria 1008
331 Ga0495635_0211948 3300046663 Bacteria 1312
332 Ga0495669_0224526 3300046684 Unclassified 901
333 Ga0495680_0862683 3300047322 Bacteria 587
334 Ga0495684_0415927 3300047471 Bacteria 941
335 Ga0495602_0563518 3300048088 Bacteria 788
336 Ga0496101_1240344 3300048904 Unclassified 584
337 Ga0496102_0062612 3300048905 Bacteria 3407
338 Ga0496109_1940465 3300048912 Bacteria 521
339 Ga0496110_0073698 3300048913 Bacteria 3030
340 Ga0496112_0152638 3300048915 Bacteria 2277
341 Ga0496113_0352693 3300048916 Bacteria 1180
342 Ga0501299_013655 3300049522 Bacteria 1404
343 Ga0501033_0339298 3300049570 Bacteria 1054
344 Ga0501033_0870456 3300049570 Bacteria 607
345 Ga0501034_0055916 3300049571 Unclassified 3971
346 Ga0501036_0171172 3300049572 Unclassified 1830
347 Ga0501036_0626453 3300049572 Bacteria 891
348 Ga0501038_0369440 3300049574 Bacteria 1114
349 Ga0501038_0518337 3300049574 Bacteria 910
350 Ga0501038_0846272 3300049574 Bacteria 678
351 Ga0501039_0175172 3300049575 Unclassified 1687
352 Ga0501039_0184352 3300049575 Bacteria 1641
353 Ga0501039_0451332 3300049575 Bacteria 1010
354 Ga0501039_0457483 3300049575 Bacteria 1002
355 Ga0501040_0011683 3300049576 Bacteria 5747
356 Ga0501040_0093706 3300049576 Bacteria 2089
357 Ga0501040_0140325 3300049576 Bacteria 1702
358 Ga0501040_0654802 3300049576 Bacteria 759
359 Ga0501040_0918731 3300049576 Unclassified 634
360 Ga0501040_0991601 3300049576 Unclassified 609
361 Ga0501041_0092097 3300049577 Bacteria 1872
362 Ga0501041_0149347 3300049577 Bacteria 1458
363 Ga0501041_0373430 3300049577 Bacteria 902
364 Ga0501041_0386123 3300049577 Bacteria 886
365 Ga0501042_0104496 3300049578 Bacteria 2038
366 Ga0501042_0155543 3300049578 Unclassified 1649
367 Ga0501042_0177859 3300049578 Bacteria 1535
368 Ga0501042_0390834 3300049578 Bacteria 1008
369 Ga0501042_0576602 3300049578 Unclassified 818
370 Ga0501042_0733485 3300049578 Unclassified 719
371 Ga0501042_1384764 3300049578 Unclassified 513
372 Ga0501043_0067187 3300049579 Bacteria 2816
373 Ga0501043_0101799 3300049579 Unclassified 2258
374 Ga0501046_0054947 3300049580 Unclassified 3131
375 Ga0501046_0120963 3300049580 Bacteria 1992
376 Ga0501046_0136487 3300049580 Bacteria 1858
377 Ga0501046_0432735 3300049580 Bacteria 947
378 Ga0501046_1108857 3300049580 Bacteria 546
379 Ga0501047_0062994 3300049581 Unclassified 3577
380 Ga0501047_0145706 3300049581 Bacteria 2245
381 Ga0501048_0449273 3300049582 Unclassified 923
382 Ga0501048_0462586 3300049582 Bacteria 909
383 Ga0501048_0548932 3300049582 Bacteria 829
384 Ga0501067_0004586 3300049583 Bacteria 7644
385 Ga0501067_0029737 3300049583 Unclassified 3028
386 Ga0501067_0187417 3300049583 Bacteria 1152
387 Ga0501068_0043854 3300049584 Bacteria 2692
388 Ga0501068_0268873 3300049584 Unclassified 1088
389 Ga0501068_0286025 3300049584 Bacteria 1054
390 Ga0501068_0469456 3300049584 Bacteria 815
391 Ga0501069_0035001 3300049585 Unclassified 2765
392 Ga0501069_0074713 3300049585 Bacteria 1902
393 Ga0501069_0294888 3300049585 Bacteria 950
394 Ga0501069_0676100 3300049585 Bacteria 622
395 Ga0501071_0236086 3300049587 Unclassified 1378
396 Ga0501071_0345741 3300049587 Unclassified 1131
397 Ga0501071_0801479 3300049587 Unclassified 726
398 Ga0501072_0032093 3300049588 Bacteria 4112
399 Ga0501072_0062029 3300049588 Bacteria 2949
400 Ga0501072_0107744 3300049588 Bacteria 2217
401 Ga0501072_0530589 3300049588 Bacteria 930
402 Ga0501072_0654814 3300049588 Unclassified 827
403 Ga0501072_0917889 3300049588 Bacteria 684
404 Ga0501073_0050469 3300049589 Unclassified 2915
405 Ga0501073_0144069 3300049589 Bacteria 1651
406 Ga0501074_0005802 3300049590 Bacteria 8902
407 Ga0501074_0043139 3300049590 Bacteria 3264
408 Ga0501074_0159933 3300049590 Unclassified 1609
409 Ga0501074_0247820 3300049590 Bacteria 1267
410 Ga0501074_0347950 3300049590 Bacteria 1052
411 Ga0501075_0031035 3300049591 Bacteria 3964
412 Ga0501075_0047716 3300049591 Bacteria 3218
413 Ga0501075_0074888 3300049591 Bacteria 2560
414 Ga0501075_0453262 3300049591 Bacteria 978
415 Ga0501075_0690006 3300049591 Bacteria 778
416 Ga0501075_0985070 3300049591 Unclassified 641
417 Ga0501076_0011763 3300049592 Bacteria 6533
418 Ga0501076_0103186 3300049592 Bacteria 2300
419 Ga0501076_0568719 3300049592 Bacteria 935
420 Ga0501076_0677491 3300049592 Bacteria 851
421 Ga0501076_1052610 3300049592 Unclassified 670
422 Ga0501077_0014457 3300049593 Bacteria 4960
423 Ga0501077_0027974 3300049593 Bacteria 3583
424 Ga0501077_0220696 3300049593 Bacteria 1205
425 Ga0501077_0222639 3300049593 Unclassified 1199
426 Ga0501077_0676261 3300049593 Bacteria 663
427 Ga0501261_064099 3300049690 Bacteria 631
428 Ga0501079_0065769 3300049741 Bacteria 2797
429 Ga0501079_0313609 3300049741 Unclassified 1227
430 Ga0501079_0323674 3300049741 Bacteria 1207
431 Ga0501079_0325359 3300049741 Bacteria 1204
432 Ga0501079_0346858 3300049741 Bacteria 1163
433 Ga0501079_0382047 3300049741 Bacteria 1104
434 Ga0501079_0635545 3300049741 Unclassified 840
435 Ga0501080_0018147 3300049742 Bacteria 6513
436 Ga0501080_0049565 3300049742 Bacteria 3908
437 Ga0501080_0442105 3300049742 Bacteria 1166
438 Ga0501080_0970672 3300049742 Bacteria 738
439 Ga0501081_0003221 3300049743 Bacteria 10381
440 Ga0501081_0085205 3300049743 Bacteria 2217
441 Ga0501081_0124124 3300049743 Bacteria 1841
442 Ga0501081_0172116 3300049743 Bacteria 1564
443 Ga0501081_0295508 3300049743 Unclassified 1188
444 Ga0501081_0876567 3300049743 Unclassified 676
445 Ga0501083_0028631 3300049744 Unclassified 3838
446 Ga0501283_101634 3300049779 Unclassified 560
447 Ga0501035_0202627 3300049822 Bacteria 1701
448 Ga0501044_0087729 3300049823 Bacteria 3142
449 Ga0501044_0171579 3300049823 Bacteria 2140
450 Ga0501045_0073970 3300049824 Bacteria 2510
451 Ga0501045_0137367 3300049824 Bacteria 1818
452 Ga0501045_0231043 3300049824 Unclassified 1377
453 Ga0501045_0307053 3300049824 Bacteria 1181
454 Ga0501045_0411272 3300049824 Bacteria 1006
455 Ga0501045_0424933 3300049824 Bacteria 988
456 Ga0501045_0946674 3300049824 Bacteria 632
457 Ga0501045_1420968 3300049824 Bacteria 504
458 nmdc:mga05p37_1161868_c1 3300050507 Unclassified 802
459 nmdc:mga05p37_132656_c1 3300050507 Bacteria 3056
460 nmdc:mga05p37_24360_c1 3300050507 Bacteria 7354
461 nmdc:mga05p37_244074_c1 3300050507 Bacteria 2157
462 nmdc:mga05p37_371114_c1 3300050507 Bacteria 1679
463 nmdc:mga05p37_44015_c1 3300050507 Bacteria 5493
464 nmdc:mga05p37_44894_c1 3300050507 Bacteria 5437
465 nmdc:mga05p37_475522_c1 3300050507 Bacteria 1441
466 nmdc:mga05p37_49118_c1 3300050507 Bacteria 5190
467 nmdc:mga05p37_51647_c1 3300050507 Bacteria 5055
468 nmdc:mga05p37_539234_c1 3300050507 Bacteria 1331
469 nmdc:mga05p37_87813_c1 3300050507 Bacteria 3833
470 nmdc:mga05p37_976439_c1 3300050507 Bacteria 903
471 nmdc:mga09592_1049905_c1 3300050508 Bacteria 679
472 nmdc:mga09592_1076949_c1 3300050508 Bacteria 669
473 nmdc:mga09592_172494_c1 3300050508 Bacteria 1870
474 nmdc:mga09592_18106_c1 3300050508 Bacteria 5776
475 nmdc:mga09592_523366_c1 3300050508 Bacteria 1020
476 nmdc:mga09592_552367_c1 3300050508 Bacteria 989
477 nmdc:mga09592_601_c1 3300050508 Bacteria 27297
478 nmdc:mga09592_9693_c1 3300050508 Bacteria 7822
479 nmdc:mga0qj67_1382816_c1 3300050509 Bacteria 544
480 nmdc:mga0qj67_1405_c1 3300050509 Bacteria 16858
481 nmdc:mga0qj67_317482_c1 3300050509 Bacteria 1261
482 nmdc:mga0qj67_59377_c1 3300050509 Bacteria 3033
483 nmdc:mga0qj67_880620_c1 3300050509 Bacteria 706
484 nmdc:mga0qj67_93225_c1 3300050509 Bacteria 2421
485 nmdc:mga06r32_223633_c1 3300050510 Bacteria 1870
486 nmdc:mga06r32_24025_c1 3300050510 Bacteria 5651
487 nmdc:mga06r32_278684_c1 3300050510 Bacteria 1659
488 nmdc:mga06r32_347923_c1 3300050510 Bacteria 1467
489 nmdc:mga06r32_377114_c1 3300050510 Unclassified 1401
490 nmdc:mga06r32_50464_c1 3300050510 Bacteria 3980
491 nmdc:mga06r32_67230_c1 3300050510 Bacteria 3460
492 nmdc:mga06r32_916899_c1 3300050510 Bacteria 832
493 nmdc:mga06r32_92151_c1 3300050510 Bacteria 2962
494 nmdc:mga06r32_971245_c1 3300050510 Unclassified 803
495 nmdc:mga08y16_146857_c1 3300050511 Bacteria 2452
496 nmdc:mga08y16_151824_c1 3300050511 Bacteria 2407
497 nmdc:mga08y16_1556720_c1 3300050511 Unclassified 620
498 nmdc:mga08y16_235029_c1 3300050511 Bacteria 1895
499 nmdc:mga08y16_25223_c1 3300050511 Bacteria 6269
500 nmdc:mga08y16_414310_c1 3300050511 Bacteria 1378
501 nmdc:mga0n895_106788_c1 3300050512 Bacteria 2813
502 nmdc:mga0n895_1339762_c1 3300050512 Bacteria 686
503 nmdc:mga0n895_38356_c1 3300050512 Bacteria 4642
504 nmdc:mga0n895_5437_c1 3300050512 Bacteria 10646
505 nmdc:mga0n895_612910_c1 3300050512 Bacteria 1090
506 nmdc:mga0n895_614319_c1 3300050512 Bacteria 1088
507 nmdc:mga0n895_671970_c1 3300050512 Bacteria 1033
508 nmdc:mga0n895_73180_c1 3300050512 Bacteria 3402
509 nmdc:mga0n895_738760_c1 3300050512 Bacteria 978
510 nmdc:mga0n895_774794_c1 3300050512 Unclassified 951
511 nmdc:mga0rr50_222320_c1 3300050513 Unclassified 1560
512 nmdc:mga0rr50_25011_c1 3300050513 Bacteria 4146
513 nmdc:mga0rr50_319338_c1 3300050513 Bacteria 1302
514 nmdc:mga0rr50_44141_c1 3300050513 Bacteria 3268
515 nmdc:mga0rr50_83348_c1 3300050513 Bacteria 2472
516 nmdc:mga0rr50_891645_c1 3300050513 Bacteria 758
517 nmdc:mga08x19_12089_c1 3300050514 Bacteria 5195
518 nmdc:mga08x19_228093_c1 3300050514 Bacteria 1281
519 nmdc:mga08x19_745200_c1 3300050514 Unclassified 695
520 nmdc:mga08x19_99898_c1 3300050514 Unclassified 1924
521 nmdc:mga0a205_129716_c1 3300050515 Unclassified 2422
522 nmdc:mga0a205_140806_c1 3300050515 Bacteria 2312
523 nmdc:mga0a205_2686_c1 3300050515 Bacteria 7775
524 nmdc:mga0a205_322146_c1 3300050515 Unclassified 1417
525 nmdc:mga0a205_7174_c1 3300050515 Bacteria 10072
526 nmdc:mga0a205_79954_c1 3300050515 Bacteria 1767
527 nmdc:mga0a205_87462_c1 3300050515 Bacteria 3011
528 Ga0495601_0862682 3300053077 Unclassified 573
529 Ga0495619_0043575 3300053085 Bacteria 2942
530 Ga0501084_0008924 3300054114 Bacteria 8295
531 Ga0501084_0068122 3300054114 Bacteria 2980
532 Ga0501084_0069369 3300054114 Unclassified 2951
533 Ga0501084_0072581 3300054114 Bacteria 2883
534 Ga0501084_0209286 3300054114 Bacteria 1646
535 Ga0501084_0222984 3300054114 Bacteria 1591
536 Ga0501084_0351774 3300054114 Bacteria 1245
537 Ga0501084_0818698 3300054114 Bacteria 784
538 Ga0501082_0042147 3300060353 Bacteria 3935
539 Ga0501082_0102154 3300060353 Unclassified 2480
540 Ga0501082_1333639 3300060353 Bacteria 627
541 Ga0530510_0027274 3300061734 Bacteria 4093
542 Ga0530510_0039176 3300061734 Bacteria 3421
543 Ga0530510_0173478 3300061734 Bacteria 1598
544 Ga0530510_0297086 3300061734 Bacteria 1208
545 Ga0530510_0419300 3300061734 Unclassified 1010
546 Ga0530510_0695929 3300061734 Bacteria 774
547 Ga0530510_0712320 3300061734 Bacteria 765
548 Ga0530510_0724339 3300061734 Unclassified 758
549 Ga0501040_0144744
550 JGI25407J50210_10078924
551 JGI25405J52794_10021036
552 Ga0065704_10532284
553 Ga0065707_10147757
554 Ga0065707_10353022
555 Ga0070676_10000835
556 Ga0070683_100696636
557 Ga0070690_100421360
558 Ga0070670_100440609
559 Ga0068869_100000100
560 Ga0070680_100001323
561 Ga0070682_100000317
562 Ga0068868_102102712
563 Ga0070660_100001212
564 Ga0070689_100027733
565 Ga0070689_100522042
566 Ga0070691_10098732
567 Ga0070687_100019285
568 Ga0070661_100002398
569 Ga0070692_10000340
570 Ga0070669_100023622
571 Ga0070669_100075728
572 Ga0070671_100392763
573 Ga0070659_100001444
574 Ga0070667_100145714
575 Ga0070703_10004118
576 Ga0070703_10012868
577 Ga0070709_10010654
578 Ga0070713_100631561
579 Ga0070701_10352898
580 Ga0070705_100000258
581 Ga0070705_100297967
582 Ga0070705_100684425
583 Ga0070705_101718475
584 Ga0070700_100023344
585 Ga0070700_100792865
586 Ga0070694_100001242
587 Ga0070694_100284449
588 Ga0070708_100115671
589 Ga0070708_100284693
590 Ga0070708_101101788
591 Ga0070708_101242093
592 Ga0070663_100000686
593 Ga0070662_100238621
594 Ga0070681_10040265
595 Ga0068867_100000363
596 Ga0070706_100018405
597 Ga0070706_100121215
598 Ga0070706_100179830
599 Ga0070706_101116464
600 Ga0070707_100098200
601 Ga0070707_100144984
602 Ga0070707_100155392
603 Ga0070698_100380179
604 Ga0070698_100600550
605 Ga0070698_100607089
606 Ga0070698_100753794
607 Ga0070699_100008497
608 Ga0070699_100020841
609 Ga0070699_100175777
610 Ga0070699_100818148
611 Ga0070679_100007138
612 Ga0070684_100114098
613 Ga0070697_100024687
614 Ga0070697_100271188
615 Ga0070697_100322394
616 Ga0070697_101124304
617 Ga0068853_100000772
618 Ga0070686_100139044
619 Ga0070686_101867373
620 Ga0070695_100000413
621 Ga0070696_100000360
622 Ga0070696_100207046
623 Ga0070696_100331313
624 Ga0070693_100001330
625 Ga0070704_100000110
626 Ga0070704_100201262
627 Ga0068855_100002633
628 Ga0070664_100002613
629 Ga0068857_100015554
630 Ga0068854_100002100
631 Ga0068856_100002222
632 Ga0070702_101238093
633 Ga0068852_100243328
634 Ga0068859_100001704
635 Ga0068859_100674319
636 Ga0068864_101001800
637 Ga0068866_11109115
638 Ga0068861_100006038
639 Ga0068861_100551916
640 Ga0068870_10000146
641 Ga0068863_100115750
642 Ga0068863_100187250
643 Ga0068858_100241249
644 Ga0068860_100021873
645 Ga0068862_100000570
646 Ga0068862_100637365
647 Ga0068862_101051548
648 Ga0081455_10000662
649 Ga0081455_10002504
650 Ga0081455_10004394
651 Ga0081455_10501637
652 Ga0081538_10005315
653 Ga0081538_10009232
654 Ga0081538_10042341
655 Ga0081538_10072184
656 Ga0081538_10100564
657 Ga0081538_10140029
658 Ga0081540_1059052
659 Ga0081539_10013231
660 Ga0081539_10216107
661 Ga0070717_10986833
662 Ga0070716_100008859
663 Ga0070716_100741695
664 Ga0075427_10013386
665 Ga0075427_10019278
666 Ga0068871_100811366
667 Ga0075428_100000435
668 Ga0075428_100008998
669 Ga0075428_100065286
670 Ga0075428_100066303
671 Ga0075428_100098303
672 Ga0075428_100343107
673 Ga0075428_100700900
674 Ga0075428_101484044
675 Ga0075428_102135847
676 Ga0075428_102312893
677 Ga0075430_100001040
678 Ga0075430_100010088
679 Ga0075430_100149674
680 Ga0075430_100816246
681 Ga0075431_100002879
682 Ga0075431_100024616
683 Ga0075431_100031378
684 Ga0075431_100067351
685 Ga0075431_100754318
686 Ga0075431_100936740
687 Ga0075431_101108419
688 Ga0075433_10002894
689 Ga0075433_10012454
690 Ga0075433_10013148
691 Ga0075433_10047339
692 Ga0075433_10210421
693 Ga0075433_10555101
694 Ga0075433_10832919
695 Ga0075434_100032220
696 Ga0075434_100044421
697 Ga0075434_100050891
698 Ga0075434_100153561
699 Ga0075434_100657022
700 Ga0075434_100691344
701 Ga0075434_101808253
702 Ga0075434_101818848
703 Ga0075429_100000189
704 Ga0075429_100008463
705 Ga0075429_100050494
706 Ga0075429_100319042
707 Ga0075429_100487403
708 Ga0075429_100644711
709 Ga0075429_101652517
710 Ga0068865_100208777
711 Ga0075436_100046586
712 Ga0075436_100057059
713 Ga0075436_100185926
714 Ga0075436_100444481
715 Ga0097620_100001704
716 Ga0097620_100674316
717 Ga0075435_100027503
718 Ga0075435_100034184
719 Ga0075435_100082223
720 Ga0075435_100105026
721 Ga0075435_100425638
722 Ga0075435_100819354
723 Ga0075435_101660721
724 Ga0075435_101839317
725 Ga0099794_10013804
726 Ga0105251_10591772
727 Ga0111539_10010131
728 Ga0111539_10066446
729 Ga0111539_10068178
730 Ga0111539_10198906
731 Ga0111539_11952232
732 Ga0105245_10660652
733 Ga0114129_10020844
734 Ga0114129_10029628
735 Ga0114129_10075101
736 Ga0114129_10088783
737 Ga0114129_10168023
738 Ga0114129_10293115
739 Ga0114129_10557694
740 Ga0114129_10777871
741 Ga0114129_10848356
742 Ga0114129_11153727
743 Ga0105243_12569044
744 Ga0105241_10000892
745 Ga0105241_10299069
746 Ga0105248_10338159
747 Ga0105238_10236158
748 Ga0105249_10043865
749 Ga0105249_10294513
750 Ga0105249_12131572
751 Ga0105239_11167509
752 Ga0105246_10470658
753 Ga0105246_11483048
754 Ga0157373_10000460
755 Ga0157373_10343393
756 Ga0157371_10258757
757 Ga0157369_10034179
758 Ga0157378_10172215
759 Ga0157378_10318567
760 Ga0163162_10093553
761 Ga0163162_11613077
762 Ga0157372_10000831
763 Ga0157375_10096258
764 Ga0163163_10051649
765 Ga0157377_10444621
766 Ga0157377_10859042
767 Ga0182006_1127223
768 Ga0182007_10023204
769 Ga0206353_11125292
770 Ga0213872_10097310
771 Ga0207653_10002377
772 Ga0207642_10249908
773 Ga0207688_10154441
774 Ga0207645_10000644
775 Ga0207643_10000728
776 Ga0207684_10027949
777 Ga0207684_10063480
778 Ga0207684_10120703
779 Ga0207684_10342117
780 Ga0207684_10543837
781 Ga0207684_10594566
782 Ga0207684_11256369
783 Ga0207654_10001333
784 Ga0207707_10000595
785 Ga0207660_10001659
786 Ga0207662_10228277
787 Ga0207657_10000515
788 Ga0207652_10002463
789 Ga0207646_10031171
790 Ga0207646_10052471
791 Ga0207646_10221912
792 Ga0207646_10305132
793 Ga0207681_10020440
794 Ga0207681_10032107
795 Ga0207681_10539710
796 Ga0207694_10216466
797 Ga0207650_10020645
798 Ga0207687_10399234
799 Ga0207644_10280876
800 Ga0207644_10460284
801 Ga0207690_10007768
802 Ga0207706_10002145
803 Ga0207704_10292082
804 Ga0207704_11124331
805 Ga0207665_10001065
806 Ga0207691_10501426
807 Ga0207711_10656578
808 Ga0207689_10000397
809 Ga0207661_12098391
810 Ga0207667_10009000
811 Ga0207712_10160370
812 Ga0207640_10011795
813 Ga0207658_10284445
814 Ga0207703_10150291
815 Ga0207703_10991524
816 Ga0207639_10004865
817 Ga0207678_10014830
818 Ga0207708_10099200
819 Ga0207702_10003863
820 Ga0207641_11198174
821 Ga0207648_10002755
822 Ga0207676_10076386
823 Ga0207674_10004369
824 Ga0207674_11077964
825 Ga0207675_100034084
826 Ga0207675_100662235
827 Ga0209974_10039775
828 Ga0207428_10001927
829 Ga0207428_10070849
830 Ga0207428_10550064
831 Ga0268265_10001662
832 Ga0268265_10149315
833 Ga0268264_10022550
834 Ga0307408_101247544
835 Ga0307410_11400618
836 Ga0307406_10100496
837 Ga0307414_11211570
838 Ga0373948_0029422
839 Ga0373959_0003218
840 Ga0373949_0009258
841 Ga0373951_0008501
842 Ga0373951_0087132
843 Ga0373960_0009894
844 Ga0373962_0018048
845 Ga0373931_0268585
846 Ga0373931_0523196
847 Ga0395899_0019185
848 Ga0395900_0023182
849 Ga0395898_0001915
850 Ga0395901_0000430
851 Ga0436360_0183824
852 Ga0436361_0051636
853 Ga0436361_0113826
854 Ga0436362_0636969
855 Ga0439462_0162085
856 Ga0450889_003235
857 Ga0439458_0055468
858 Ga0439459_0022695
859 Ga0439464_0004255
860 Ga0439460_0000058
861 Ga0439460_0164052
862 Ga0451577_0147574
863 Ga0451577_0209988
864 Ga0451577_1487626
865 Ga0453683_0041391
866 Ga0453683_0085604
867 Ga0453683_0263919
868 Ga0453684_0328512
869 Ga0451576_0022073
870 Ga0451576_0130397
871 Ga0451576_0215139
872 Ga0495664_0746436
873 Ga0495608_0795706
874 Ga0495628_0868110
875 Ga0495642_0039881
876 Ga0495652_0664013
877 Ga0495598_0048256
878 Ga0495656_0192549
879 Ga0495635_0211948
880 Ga0495669_0224526
881 Ga0495680_0862683
882 Ga0495684_0415927
883 Ga0495602_0563518
884 Ga0496101_1240344
885 Ga0496102_0062612
886 Ga0496109_1940465
887 Ga0496110_0073698
888 Ga0496112_0152638
889 Ga0496113_0352693
890 Ga0501299_013655
891 Ga0501033_0339298
892 Ga0501033_0870456
893 Ga0501034_0055916
894 Ga0501036_0171172
895 Ga0501036_0626453
896 Ga0501038_0369440
897 Ga0501038_0518337
898 Ga0501038_0846272
899 Ga0501039_0175172
900 Ga0501039_0184352
901 Ga0501039_0451332
902 Ga0501039_0457483
903 Ga0501040_0011683
904 Ga0501040_0093706
905 Ga0501040_0140325
906 Ga0501040_0654802
907 Ga0501040_0918731
908 Ga0501040_0991601
909 Ga0501041_0092097
910 Ga0501041_0149347
911 Ga0501041_0373430
912 Ga0501041_0386123
913 Ga0501042_0104496
914 Ga0501042_0155543
915 Ga0501042_0177859
916 Ga0501042_0390834
917 Ga0501042_0576602
918 Ga0501042_0733485
919 Ga0501042_1384764
920 Ga0501043_0067187
921 Ga0501043_0101799
922 Ga0501046_0054947
923 Ga0501046_0120963
924 Ga0501046_0136487
925 Ga0501046_0432735
926 Ga0501046_1108857
927 Ga0501047_0062994
928 Ga0501047_0145706
929 Ga0501048_0449273
930 Ga0501048_0462586
931 Ga0501048_0548932
932 Ga0501067_0004586
933 Ga0501067_0029737
934 Ga0501067_0187417
935 Ga0501068_0043854
936 Ga0501068_0268873
937 Ga0501068_0286025
938 Ga0501068_0469456
939 Ga0501069_0035001
940 Ga0501069_0074713
941 Ga0501069_0294888
942 Ga0501069_0676100
943 Ga0501071_0236086
944 Ga0501071_0345741
945 Ga0501071_0801479
946 Ga0501072_0032093
947 Ga0501072_0062029
948 Ga0501072_0107744
949 Ga0501072_0530589
950 Ga0501072_0654814
951 Ga0501072_0917889
952 Ga0501073_0050469
953 Ga0501073_0144069
954 Ga0501074_0005802
955 Ga0501074_0043139
956 Ga0501074_0159933
957 Ga0501074_0247820
958 Ga0501074_0347950
959 Ga0501075_0031035
960 Ga0501075_0047716
961 Ga0501075_0074888
962 Ga0501075_0453262
963 Ga0501075_0690006
964 Ga0501075_0985070
965 Ga0501076_0011763
966 Ga0501076_0103186
967 Ga0501076_0568719
968 Ga0501076_0677491
969 Ga0501076_1052610
970 Ga0501077_0014457
971 Ga0501077_0027974
972 Ga0501077_0220696
973 Ga0501077_0222639
974 Ga0501077_0676261
975 Ga0501261_064099
976 Ga0501079_0065769
977 Ga0501079_0313609
978 Ga0501079_0323674
979 Ga0501079_0325359
980 Ga0501079_0346858
981 Ga0501079_0382047
982 Ga0501079_0635545
983 Ga0501080_0018147
984 Ga0501080_0049565
985 Ga0501080_0442105
986 Ga0501080_0970672
987 Ga0501081_0003221
988 Ga0501081_0085205
989 Ga0501081_0124124
990 Ga0501081_0172116
991 Ga0501081_0295508
992 Ga0501081_0876567
993 Ga0501083_0028631
994 Ga0501283_101634
995 Ga0501035_0202627
996 Ga0501044_0087729
997 Ga0501044_0171579
998 Ga0501045_0073970
999 Ga0501045_0137367
1000 Ga0501045_0231043
1001 Ga0501045_0307053
1002 Ga0501045_0411272
1003 Ga0501045_0424933
1004 Ga0501045_0946674
1005 Ga0501045_1420968
1006 nmdc:mga05p37_1161868_c1
1007 nmdc:mga05p37_132656_c1
1008 nmdc:mga05p37_24360_c1
1009 nmdc:mga05p37_244074_c1
1010 nmdc:mga05p37_371114_c1
1011 nmdc:mga05p37_44015_c1
1012 nmdc:mga05p37_44894_c1
1013 nmdc:mga05p37_475522_c1
1014 nmdc:mga05p37_49118_c1
1015 nmdc:mga05p37_51647_c1
1016 nmdc:mga05p37_539234_c1
1017 nmdc:mga05p37_87813_c1
1018 nmdc:mga05p37_976439_c1
1019 nmdc:mga09592_1049905_c1
1020 nmdc:mga09592_1076949_c1
1021 nmdc:mga09592_172494_c1
1022 nmdc:mga09592_18106_c1
1023 nmdc:mga09592_523366_c1
1024 nmdc:mga09592_552367_c1
1025 nmdc:mga09592_601_c1
1026 nmdc:mga09592_9693_c1
1027 nmdc:mga0qj67_1382816_c1
1028 nmdc:mga0qj67_1405_c1
1029 nmdc:mga0qj67_317482_c1
1030 nmdc:mga0qj67_59377_c1
1031 nmdc:mga0qj67_880620_c1
1032 nmdc:mga0qj67_93225_c1
1033 nmdc:mga06r32_223633_c1
1034 nmdc:mga06r32_24025_c1
1035 nmdc:mga06r32_278684_c1
1036 nmdc:mga06r32_347923_c1
1037 nmdc:mga06r32_377114_c1
1038 nmdc:mga06r32_50464_c1
1039 nmdc:mga06r32_67230_c1
1040 nmdc:mga06r32_916899_c1
1041 nmdc:mga06r32_92151_c1
1042 nmdc:mga06r32_971245_c1
1043 nmdc:mga08y16_146857_c1
1044 nmdc:mga08y16_151824_c1
1045 nmdc:mga08y16_1556720_c1
1046 nmdc:mga08y16_235029_c1
1047 nmdc:mga08y16_25223_c1
1048 nmdc:mga08y16_414310_c1
1049 nmdc:mga0n895_106788_c1
1050 nmdc:mga0n895_1339762_c1
1051 nmdc:mga0n895_38356_c1
1052 nmdc:mga0n895_5437_c1
1053 nmdc:mga0n895_612910_c1
1054 nmdc:mga0n895_614319_c1
1055 nmdc:mga0n895_671970_c1
1056 nmdc:mga0n895_73180_c1
1057 nmdc:mga0n895_738760_c1
1058 nmdc:mga0n895_774794_c1
1059 nmdc:mga0rr50_222320_c1
1060 nmdc:mga0rr50_25011_c1
1061 nmdc:mga0rr50_319338_c1
1062 nmdc:mga0rr50_44141_c1
1063 nmdc:mga0rr50_83348_c1
1064 nmdc:mga0rr50_891645_c1
1065 nmdc:mga08x19_12089_c1
1066 nmdc:mga08x19_228093_c1
1067 nmdc:mga08x19_745200_c1
1068 nmdc:mga08x19_99898_c1
1069 nmdc:mga0a205_129716_c1
1070 nmdc:mga0a205_140806_c1
1071 nmdc:mga0a205_2686_c1
1072 nmdc:mga0a205_322146_c1
1073 nmdc:mga0a205_7174_c1
1074 nmdc:mga0a205_79954_c1
1075 nmdc:mga0a205_87462_c1
1076 Ga0495601_0862682
1077 Ga0495619_0043575
1078 Ga0501084_0008924
1079 Ga0501084_0068122
1080 Ga0501084_0069369
1081 Ga0501084_0072581
1082 Ga0501084_0209286
1083 Ga0501084_0222984
1084 Ga0501084_0351774
1085 Ga0501084_0818698
1086 Ga0501082_0042147
1087 Ga0501082_0102154
1088 Ga0501082_1333639
1089 Ga0530510_0027274
1090 Ga0530510_0039176
1091 Ga0530510_0173478
1092 Ga0530510_0297086
1093 Ga0530510_0419300
1094 Ga0530510_0695929
1095 Ga0530510_0712320
1096 Ga0530510_0724339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8954 45 120
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8952 45 120
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8922 45 120
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8918 41 120
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8912 41 120
ID Description Score Start End Superfamily
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8449 46 119 2.60.120.10
af_P77634_1_156_2.60.120.810 Mainly Beta;Sandwich;Jelly Rolls; 0.8379 45 121 2.60.120.810
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8337 46 118 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8307 46 121 2.60.120.10
af_P0A9U6_79_184_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8291 46 118 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V6Z0E3-F1-model_v4 Cupin domain-containing protein 0.9859 47 121
AF-A0A3N5HNR6-F1-model_v4 Cupin domain-containing protein 0.9801 20 121
AF-A0A2V8LHW8-F1-model_v4 Cupin type-2 domain-containing protein 0.9767 2 121 GO:0016020
AF-A0A5N9BZ03-F1-model_v4 Cupin domain-containing protein 0.9724 2 120
AF-A0A7X7E9G2-F1-model_v4 Cupin domain-containing protein 0.9724 43 121

Map