F462042
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 546 | 313 | 540 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0159593|Ga0501031_0159593_415_876 |
| Length | 153 |
| Sequence | LYHRNDTERFANPPAIMQPKPKEVAMSVDMQMNILIVDDYKTMLRIIRNLLKQLGFNNVDEATDGSMALQKLRDKDYGLVISDWNMEPMTGIQLLREVRADAKLKALPFIMITAESKTENVIAAKEAGVNNYIVKPFNAATLKTKLASVIGNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 2 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 3 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 4 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 5 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 145 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 174 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 179 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 187 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 277 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 278 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 279 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 280 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 281 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 282 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 283 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 286 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 288 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 290 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 291 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 292 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 293 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 296 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 299 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 300 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 301 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 304 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 309 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 310 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 313 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 0.18 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.81 |
| Nodule | 0 |
| Rhizoplane | 0.73 |
| Rhizosphere | 82.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10024513 | 3300003203 | Bacteria | 2362 |
| 2 | JGI25407J50210_10047793 | 3300003373 | Bacteria | 1087 |
| 3 | Ga0055529_1008570 | 3300003763 | Bacteria | 1359 |
| 4 | Ga0055536_1007565 | 3300003781 | Bacteria | 4833 |
| 5 | Ga0055530_10042925 | 3300003791 | Bacteria | 1094 |
| 6 | Ga0055531_10021121 | 3300003794 | Bacteria | 2542 |
| 7 | Ga0065707_10137685 | 3300005295 | Bacteria | 1817 |
| 8 | Ga0070676_11272470 | 3300005328 | Bacteria | 561 |
| 9 | Ga0070666_10004175 | 3300005335 | Bacteria | 8769 |
| 10 | Ga0070680_100090643 | 3300005336 | Bacteria | 2531 |
| 11 | Ga0070680_100952534 | 3300005336 | Bacteria | 741 |
| 12 | Ga0070669_100029162 | 3300005353 | Bacteria | 3976 |
| 13 | Ga0070674_100055959 | 3300005356 | Bacteria | 2734 |
| 14 | Ga0070667_100058865 | 3300005367 | Bacteria | 3249 |
| 15 | Ga0070709_10041505 | 3300005434 | Bacteria | 2835 |
| 16 | Ga0070714_100000273 | 3300005435 | Bacteria | 39446 |
| 17 | Ga0070714_100014245 | 3300005435 | Bacteria | 6385 |
| 18 | Ga0070714_100147171 | 3300005435 | Bacteria | 2120 |
| 19 | Ga0070714_100320191 | 3300005435 | Bacteria | 1450 |
| 20 | Ga0070713_100067707 | 3300005436 | Bacteria | 3007 |
| 21 | Ga0070713_100213278 | 3300005436 | Bacteria | 1749 |
| 22 | Ga0070713_100332529 | 3300005436 | Bacteria | 1406 |
| 23 | Ga0070710_10021501 | 3300005437 | Bacteria | 3364 |
| 24 | Ga0070711_100007003 | 3300005439 | Bacteria | 6842 |
| 25 | Ga0070700_100179241 | 3300005441 | Bacteria | 1473 |
| 26 | Ga0070708_100288745 | 3300005445 | Bacteria | 1544 |
| 27 | Ga0070678_100006363 | 3300005456 | Bacteria | 6929 |
| 28 | Ga0070678_101017862 | 3300005456 | Bacteria | 762 |
| 29 | Ga0070681_10570758 | 3300005458 | Bacteria | 1045 |
| 30 | Ga0070681_11055268 | 3300005458 | Bacteria | 733 |
| 31 | Ga0068867_100197453 | 3300005459 | Bacteria | 1609 |
| 32 | Ga0070697_101992203 | 3300005536 | Bacteria | 520 |
| 33 | Ga0068853_101190243 | 3300005539 | Bacteria | 736 |
| 34 | Ga0070696_100187037 | 3300005546 | Bacteria | 1539 |
| 35 | Ga0070696_100352809 | 3300005546 | Bacteria | 1140 |
| 36 | Ga0070693_100133796 | 3300005547 | Bacteria | 1553 |
| 37 | Ga0070693_101531129 | 3300005547 | Bacteria | 522 |
| 38 | Ga0070665_100125601 | 3300005548 | Bacteria | 2568 |
| 39 | Ga0070665_100822750 | 3300005548 | Bacteria | 942 |
| 40 | Ga0068855_100165312 | 3300005563 | Bacteria | 2509 |
| 41 | Ga0068855_100262706 | 3300005563 | Bacteria | 1922 |
| 42 | Ga0068855_101027073 | 3300005563 | Bacteria | 865 |
| 43 | Ga0068857_100408709 | 3300005577 | Bacteria | 1264 |
| 44 | Ga0068856_100092353 | 3300005614 | Bacteria | 3012 |
| 45 | Ga0068856_100140421 | 3300005614 | Bacteria | 2423 |
| 46 | Ga0068852_100697526 | 3300005616 | Bacteria | 1025 |
| 47 | Ga0068859_100450535 | 3300005617 | Bacteria | 1383 |
| 48 | Ga0068866_10199070 | 3300005718 | Bacteria | 1196 |
| 49 | Ga0068861_100005476 | 3300005719 | Bacteria | 8603 |
| 50 | Ga0068863_101378333 | 3300005841 | Bacteria | 713 |
| 51 | Ga0068860_100954187 | 3300005843 | Bacteria | 875 |
| 52 | Ga0068862_100070984 | 3300005844 | Bacteria | 3007 |
| 53 | Ga0068862_100254758 | 3300005844 | Bacteria | 1600 |
| 54 | Ga0081455_10076545 | 3300005937 | Bacteria | 2756 |
| 55 | Ga0081538_10004235 | 3300005981 | Bacteria | 13310 |
| 56 | Ga0081540_1108832 | 3300005983 | Bacteria | 1177 |
| 57 | Ga0081539_10000054 | 3300005985 | Bacteria | 259053 |
| 58 | Ga0081539_10055738 | 3300005985 | Bacteria | 2197 |
| 59 | Ga0070717_10066227 | 3300006028 | Bacteria | 3004 |
| 60 | Ga0070717_10323580 | 3300006028 | Bacteria | 1374 |
| 61 | Ga0070717_10361951 | 3300006028 | Bacteria | 1298 |
| 62 | Ga0070717_10780386 | 3300006028 | Bacteria | 869 |
| 63 | Ga0070717_10790860 | 3300006028 | Bacteria | 863 |
| 64 | Ga0070717_10851299 | 3300006028 | Bacteria | 830 |
| 65 | Ga0070712_100113849 | 3300006175 | Bacteria | 2024 |
| 66 | Ga0070712_100954712 | 3300006175 | Bacteria | 741 |
| 67 | Ga0075369_10144415 | 3300006186 | Bacteria | 1086 |
| 68 | Ga0075366_10298920 | 3300006195 | Bacteria | 985 |
| 69 | Ga0075366_10412273 | 3300006195 | Bacteria | 832 |
| 70 | Ga0075428_100738641 | 3300006844 | Bacteria | 1047 |
| 71 | Ga0075430_100474761 | 3300006846 | Bacteria | 1032 |
| 72 | Ga0075431_100374468 | 3300006847 | Bacteria | 1429 |
| 73 | Ga0068865_100150331 | 3300006881 | Bacteria | 1766 |
| 74 | Ga0075436_100362718 | 3300006914 | Bacteria | 1045 |
| 75 | Ga0097620_100450545 | 3300006931 | Bacteria | 1383 |
| 76 | Ga0075435_101510859 | 3300007076 | Bacteria | 589 |
| 77 | Ga0111539_10000279 | 3300009094 | Bacteria | 61126 |
| 78 | Ga0111539_10737055 | 3300009094 | Bacteria | 1147 |
| 79 | Ga0105247_10458838 | 3300009101 | Bacteria | 920 |
| 80 | Ga0105247_10520004 | 3300009101 | Bacteria | 870 |
| 81 | Ga0105247_11462460 | 3300009101 | Bacteria | 556 |
| 82 | Ga0114129_10453808 | 3300009147 | Bacteria | 1681 |
| 83 | Ga0105248_10189060 | 3300009177 | Bacteria | 2320 |
| 84 | Ga0105248_10526595 | 3300009177 | Bacteria | 1333 |
| 85 | Ga0105237_10206726 | 3300009545 | Bacteria | 1963 |
| 86 | Ga0105238_10740690 | 3300009551 | Bacteria | 996 |
| 87 | Ga0105249_10268144 | 3300009553 | Bacteria | 1700 |
| 88 | Ga0105249_11956418 | 3300009553 | Bacteria | 659 |
| 89 | Ga0105148_109079 | 3300009978 | Bacteria | 748 |
| 90 | Ga0105239_10892503 | 3300010375 | Bacteria | 1020 |
| 91 | Ga0157370_11443112 | 3300013104 | Bacteria | 619 |
| 92 | Ga0157374_10142353 | 3300013296 | Bacteria | 2328 |
| 93 | Ga0157374_10942529 | 3300013296 | Bacteria | 882 |
| 94 | Ga0157374_11542254 | 3300013296 | Bacteria | 688 |
| 95 | Ga0157378_10322811 | 3300013297 | Bacteria | 1500 |
| 96 | Ga0163162_10817891 | 3300013306 | Bacteria | 1048 |
| 97 | Ga0163162_11324218 | 3300013306 | Bacteria | 818 |
| 98 | Ga0157372_10995984 | 3300013307 | Bacteria | 971 |
| 99 | Ga0157372_11186931 | 3300013307 | Bacteria | 882 |
| 100 | Ga0157372_11360163 | 3300013307 | Bacteria | 819 |
| 101 | Ga0157375_10907302 | 3300013308 | Bacteria | 1025 |
| 102 | Ga0163163_10057382 | 3300014325 | Bacteria | 3850 |
| 103 | Ga0163163_12294769 | 3300014325 | Bacteria | 598 |
| 104 | Ga0157380_10090696 | 3300014326 | Bacteria | 2522 |
| 105 | Ga0157380_10119267 | 3300014326 | Bacteria | 2232 |
| 106 | Ga0182008_10131389 | 3300014497 | Bacteria | 1248 |
| 107 | Ga0182008_10400643 | 3300014497 | Bacteria | 737 |
| 108 | Ga0157379_10559043 | 3300014968 | Bacteria | 1065 |
| 109 | Ga0157376_10644302 | 3300014969 | Bacteria | 1059 |
| 110 | Ga0157376_10676543 | 3300014969 | Bacteria | 1035 |
| 111 | Ga0213872_10000084 | 3300021361 | Bacteria | 86548 |
| 112 | Ga0213872_10000779 | 3300021361 | Bacteria | 23308 |
| 113 | Ga0213872_10001414 | 3300021361 | Bacteria | 15752 |
| 114 | Ga0213872_10041193 | 3300021361 | Bacteria | 2107 |
| 115 | Ga0213872_10063401 | 3300021361 | Bacteria | 1670 |
| 116 | Ga0213872_10071241 | 3300021361 | Bacteria | 1567 |
| 117 | Ga0213872_10138800 | 3300021361 | Bacteria | 1068 |
| 118 | Ga0213872_10183941 | 3300021361 | Bacteria | 901 |
| 119 | Ga0213872_10215765 | 3300021361 | Bacteria | 818 |
| 120 | Ga0213872_10276102 | 3300021361 | Bacteria | 702 |
| 121 | Ga0213874_10071195 | 3300021377 | Bacteria | 1109 |
| 122 | Ga0213876_10092976 | 3300021384 | Bacteria | 1597 |
| 123 | Ga0213875_10047259 | 3300021388 | Bacteria | 2019 |
| 124 | Ga0213871_10094538 | 3300021441 | Bacteria | 869 |
| 125 | Ga0213871_10253986 | 3300021441 | Bacteria | 559 |
| 126 | Ga0209148_1000425 | 3300025254 | Bacteria | 46888 |
| 127 | Ga0209455_1000468 | 3300025272 | Bacteria | 30358 |
| 128 | Ga0209675_1009860 | 3300025291 | Bacteria | 3324 |
| 129 | Ga0209676_1000019 | 3300025292 | Bacteria | 620012 |
| 130 | Ga0209676_1006495 | 3300025292 | Bacteria | 5754 |
| 131 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 132 | Ga0209758_1027820 | 3300025297 | Bacteria | 2407 |
| 133 | Ga0209050_1003841 | 3300025298 | Bacteria | 10706 |
| 134 | Ga0209050_1113990 | 3300025298 | Bacteria | 514 |
| 135 | Ga0209257_1000301 | 3300025304 | Bacteria | 108454 |
| 136 | Ga0207692_10069543 | 3300025898 | Bacteria | 1850 |
| 137 | Ga0207710_10487501 | 3300025900 | Bacteria | 639 |
| 138 | Ga0207680_10543216 | 3300025903 | Bacteria | 829 |
| 139 | Ga0207671_10381940 | 3300025914 | Bacteria | 1119 |
| 140 | Ga0207693_10312076 | 3300025915 | Bacteria | 1231 |
| 141 | Ga0207660_10237893 | 3300025917 | Bacteria | 1434 |
| 142 | Ga0207660_10837879 | 3300025917 | Bacteria | 750 |
| 143 | Ga0207652_10043894 | 3300025921 | Bacteria | 3807 |
| 144 | Ga0207681_10013805 | 3300025923 | Bacteria | 5005 |
| 145 | Ga0207694_10797721 | 3300025924 | Bacteria | 798 |
| 146 | Ga0207694_10844579 | 3300025924 | Bacteria | 774 |
| 147 | Ga0207687_10640805 | 3300025927 | Bacteria | 898 |
| 148 | Ga0207700_10020209 | 3300025928 | Bacteria | 4517 |
| 149 | Ga0207700_10148191 | 3300025928 | Bacteria | 1937 |
| 150 | Ga0207700_10535078 | 3300025928 | Bacteria | 1039 |
| 151 | Ga0207664_10007141 | 3300025929 | Bacteria | 7744 |
| 152 | Ga0207664_10031965 | 3300025929 | Bacteria | 4031 |
| 153 | Ga0207664_10576859 | 3300025929 | Bacteria | 1010 |
| 154 | Ga0207664_10766716 | 3300025929 | Bacteria | 868 |
| 155 | Ga0207664_11857443 | 3300025929 | Bacteria | 525 |
| 156 | Ga0207644_10777917 | 3300025931 | Bacteria | 800 |
| 157 | Ga0207669_10034423 | 3300025937 | Bacteria | 2870 |
| 158 | Ga0207669_10399038 | 3300025937 | Bacteria | 1077 |
| 159 | Ga0207669_11933794 | 3300025937 | Bacteria | 504 |
| 160 | Ga0207704_10176364 | 3300025938 | Bacteria | 1539 |
| 161 | Ga0207711_10122678 | 3300025941 | Bacteria | 2321 |
| 162 | Ga0207689_10569792 | 3300025942 | Bacteria | 952 |
| 163 | Ga0207667_10121342 | 3300025949 | Bacteria | 2693 |
| 164 | Ga0207667_10361708 | 3300025949 | Bacteria | 1480 |
| 165 | Ga0207658_10044564 | 3300025986 | Bacteria | 3230 |
| 166 | Ga0207703_11817666 | 3300026035 | Bacteria | 585 |
| 167 | Ga0207639_10626387 | 3300026041 | Bacteria | 994 |
| 168 | Ga0207708_10125834 | 3300026075 | Bacteria | 2000 |
| 169 | Ga0207702_10171200 | 3300026078 | Bacteria | 1991 |
| 170 | Ga0207702_10653106 | 3300026078 | Bacteria | 1034 |
| 171 | Ga0207641_10652177 | 3300026088 | Bacteria | 1034 |
| 172 | Ga0207674_10357675 | 3300026116 | Bacteria | 1411 |
| 173 | Ga0207675_100029377 | 3300026118 | Bacteria | 5123 |
| 174 | Ga0207683_10040979 | 3300026121 | Bacteria | 4043 |
| 175 | Ga0207698_10625222 | 3300026142 | Bacteria | 1064 |
| 176 | Ga0207428_10000153 | 3300027907 | Bacteria | 94107 |
| 177 | Ga0268266_10398378 | 3300028379 | Bacteria | 1301 |
| 178 | Ga0268266_10709814 | 3300028379 | Bacteria | 969 |
| 179 | Ga0268265_10001529 | 3300028380 | Bacteria | 19280 |
| 180 | Ga0268265_10604423 | 3300028380 | Bacteria | 1048 |
| 181 | Ga0268265_10622452 | 3300028380 | Bacteria | 1034 |
| 182 | Ga0268264_10825967 | 3300028381 | Bacteria | 927 |
| 183 | Ga0268264_11467860 | 3300028381 | Bacteria | 693 |
| 184 | Ga0265318_10198661 | 3300028577 | Bacteria | 733 |
| 185 | Ga0307517_10067056 | 3300028786 | Bacteria | 3292 |
| 186 | Ga0307517_10172098 | 3300028786 | Bacteria | 1421 |
| 187 | Ga0307515_10174233 | 3300028794 | Bacteria | 2129 |
| 188 | Ga0265338_10118871 | 3300028800 | Bacteria | 2111 |
| 189 | Ga0265338_10212416 | 3300028800 | Bacteria | 1451 |
| 190 | Ga0265328_10004011 | 3300031239 | Bacteria | 6452 |
| 191 | Ga0265328_10073609 | 3300031239 | Bacteria | 1256 |
| 192 | Ga0265320_10001466 | 3300031240 | Bacteria | 17239 |
| 193 | Ga0265320_10051078 | 3300031240 | Bacteria | 2008 |
| 194 | Ga0265325_10014559 | 3300031241 | Bacteria | 4441 |
| 195 | Ga0265325_10264640 | 3300031241 | Bacteria | 775 |
| 196 | Ga0265331_10000156 | 3300031250 | Bacteria | 87128 |
| 197 | Ga0265331_10000667 | 3300031250 | Bacteria | 29636 |
| 198 | Ga0265327_10000100 | 3300031251 | Bacteria | 189591 |
| 199 | Ga0265327_10333473 | 3300031251 | Bacteria | 664 |
| 200 | Ga0307513_10021763 | 3300031456 | Bacteria | 7563 |
| 201 | Ga0307513_10212930 | 3300031456 | Bacteria | 1761 |
| 202 | Ga0307408_100266460 | 3300031548 | Unclassified | 1420 |
| 203 | Ga0265313_10000140 | 3300031595 | Bacteria | 74628 |
| 204 | Ga0265313_10000296 | 3300031595 | Bacteria | 54068 |
| 205 | Ga0265313_10022264 | 3300031595 | Bacteria | 3443 |
| 206 | Ga0265314_10009618 | 3300031711 | Bacteria | 8142 |
| 207 | Ga0307516_10157422 | 3300031730 | Bacteria | 2025 |
| 208 | Ga0307405_10400864 | 3300031731 | Bacteria | 1074 |
| 209 | Ga0307413_10141298 | 3300031824 | Bacteria | 1664 |
| 210 | Ga0307413_11146189 | 3300031824 | Bacteria | 674 |
| 211 | Ga0307410_10023847 | 3300031852 | Bacteria | 3813 |
| 212 | Ga0307409_100044270 | 3300031995 | Bacteria | 3351 |
| 213 | Ga0307409_101431557 | 3300031995 | Bacteria | 718 |
| 214 | Ga0307416_101224879 | 3300032002 | Bacteria | 856 |
| 215 | Ga0307411_10033846 | 3300032005 | Bacteria | 3173 |
| 216 | Ga0307411_12087606 | 3300032005 | Bacteria | 530 |
| 217 | Ga0307415_100432034 | 3300032126 | Bacteria | 1133 |
| 218 | Ga0307415_100733840 | 3300032126 | Bacteria | 895 |
| 219 | Ga0307507_10141250 | 3300033179 | Bacteria | 1845 |
| 220 | Ga0307510_10453875 | 3300033180 | Bacteria | 723 |
| 221 | Ga0373934_0103592 | 3300035086 | Bacteria | 1151 |
| 222 | Ga0373923_0043699 | 3300035111 | Bacteria | 1855 |
| 223 | Ga0373936_0032841 | 3300035113 | Bacteria | 2055 |
| 224 | Ga0373936_0601946 | 3300035113 | Bacteria | 516 |
| 225 | Ga0373945_0033298 | 3300035116 | Bacteria | 1831 |
| 226 | Ga0373945_0313322 | 3300035116 | Bacteria | 674 |
| 227 | Ga0373953_0047795 | 3300035117 | Bacteria | 1722 |
| 228 | Ga0373954_0177256 | 3300035118 | Bacteria | 1045 |
| 229 | Ga0373943_0762545 | 3300035170 | Bacteria | 575 |
| 230 | Ga0373946_0062935 | 3300035171 | Bacteria | 1583 |
| 231 | Ga0373955_0066028 | 3300035172 | Bacteria | 2010 |
| 232 | Ga0373955_0403721 | 3300035172 | Bacteria | 830 |
| 233 | Ga0316574_0348215 | 3300035398 | Bacteria | 938 |
| 234 | Ga0373924_0046705 | 3300035410 | Bacteria | 1785 |
| 235 | Ga0373924_0050166 | 3300035410 | Bacteria | 1728 |
| 236 | Ga0373935_0046595 | 3300035692 | Bacteria | 2739 |
| 237 | Ga0373935_0262734 | 3300035692 | Bacteria | 1211 |
| 238 | Ga0373935_0851843 | 3300035692 | Bacteria | 674 |
| 239 | Ga0373935_0983764 | 3300035692 | Bacteria | 626 |
| 240 | Ga0373927_0049307 | 3300035695 | Bacteria | 2723 |
| 241 | Ga0373927_0172811 | 3300035695 | Bacteria | 1417 |
| 242 | Ga0373927_0689265 | 3300035695 | Bacteria | 675 |
| 243 | Ga0373933_0002124 | 3300035724 | Bacteria | 11384 |
| 244 | Ga0373933_0031148 | 3300035724 | Bacteria | 3093 |
| 245 | Ga0373933_0087325 | 3300035724 | Bacteria | 1921 |
| 246 | Ga0373947_0138464 | 3300035725 | Bacteria | 1559 |
| 247 | Ga0373947_0226508 | 3300035725 | Bacteria | 1230 |
| 248 | Ga0373947_1144402 | 3300035725 | Bacteria | 530 |
| 249 | Ga0373937_0003385 | 3300036401 | Bacteria | 13385 |
| 250 | Ga0373937_0052401 | 3300036401 | Bacteria | 3741 |
| 251 | Ga0373937_0097936 | 3300036401 | Bacteria | 2720 |
| 252 | Ga0373937_0197834 | 3300036401 | Bacteria | 1889 |
| 253 | Ga0373937_0283675 | 3300036401 | Bacteria | 1564 |
| 254 | Ga0373937_0685927 | 3300036401 | Bacteria | 971 |
| 255 | Ga0373937_0981666 | 3300036401 | Bacteria | 793 |
| 256 | Ga0373925_0079815 | 3300037068 | Bacteria | 2487 |
| 257 | Ga0373925_0237291 | 3300037068 | Bacteria | 1459 |
| 258 | Ga0373925_0668120 | 3300037068 | Bacteria | 856 |
| 259 | Ga0395900_0010650 | 3300037418 | Bacteria | 9404 |
| 260 | Ga0395900_0165626 | 3300037418 | Bacteria | 2253 |
| 261 | Ga0395898_0165440 | 3300037466 | Bacteria | 2115 |
| 262 | Ga0395898_0769015 | 3300037466 | Bacteria | 904 |
| 263 | Ga0395898_1364826 | 3300037466 | Bacteria | 637 |
| 264 | Ga0395898_1679864 | 3300037466 | Bacteria | 558 |
| 265 | Ga0395905_0556985 | 3300037471 | Bacteria | 1048 |
| 266 | Ga0436364_0050215 | 3300037853 | Bacteria | 1762 |
| 267 | Ga0436364_0092884 | 3300037853 | Bacteria | 9580 |
| 268 | Ga0436364_0135611 | 3300037853 | Bacteria | 694 |
| 269 | Ga0436364_1040380 | 3300037853 | Bacteria | 1327 |
| 270 | Ga0436364_1322587 | 3300037853 | Bacteria | 4031 |
| 271 | Ga0395901_0079440 | 3300038443 | Bacteria | 3425 |
| 272 | Ga0395901_0419790 | 3300038443 | Bacteria | 1372 |
| 273 | Ga0436365_0405382 | 3300039437 | Bacteria | 706 |
| 274 | Ga0436365_0470668 | 3300039437 | Bacteria | 615 |
| 275 | Ga0436365_1490329 | 3300039437 | Bacteria | 544 |
| 276 | Ga0436365_1682656 | 3300039437 | Bacteria | 2846 |
| 277 | Ga0436360_0104644 | 3300039438 | Bacteria | 1376 |
| 278 | Ga0436360_0110871 | 3300039438 | Bacteria | 573 |
| 279 | Ga0436360_0122328 | 3300039438 | Bacteria | 584 |
| 280 | Ga0436360_0498074 | 3300039438 | Bacteria | 957 |
| 281 | Ga0436360_0529644 | 3300039438 | Bacteria | 788 |
| 282 | Ga0436360_0877606 | 3300039438 | Unclassified | 1739 |
| 283 | Ga0436360_1134589 | 3300039438 | Bacteria | 1458 |
| 284 | Ga0436360_1189690 | 3300039438 | Bacteria | 1003 |
| 285 | Ga0436360_1299497 | 3300039438 | Bacteria | 1439 |
| 286 | Ga0436361_0063582 | 3300039447 | Bacteria | 14694 |
| 287 | Ga0436361_0103120 | 3300039447 | Bacteria | 123137 |
| 288 | Ga0436361_0125172 | 3300039447 | Bacteria | 55027 |
| 289 | Ga0436361_0126507 | 3300039447 | Bacteria | 5965 |
| 290 | Ga0436361_0171142 | 3300039447 | Bacteria | 1223 |
| 291 | Ga0436361_0243625 | 3300039447 | Bacteria | 43518 |
| 292 | Ga0436361_0280120 | 3300039447 | Bacteria | 2696 |
| 293 | Ga0436361_0404717 | 3300039447 | Bacteria | 879 |
| 294 | Ga0436361_0637202 | 3300039447 | Bacteria | 1243 |
| 295 | Ga0436361_0704599 | 3300039447 | Bacteria | 4718 |
| 296 | Ga0436361_0969683 | 3300039447 | Bacteria | 3742 |
| 297 | Ga0436361_0988569 | 3300039447 | Bacteria | 2093 |
| 298 | Ga0436361_1141666 | 3300039447 | Bacteria | 2880 |
| 299 | Ga0436363_0454500 | 3300039450 | Bacteria | 517 |
| 300 | Ga0436363_1422843 | 3300039450 | Bacteria | 2308 |
| 301 | Ga0436362_0157900 | 3300039453 | Bacteria | 4091 |
| 302 | Ga0436362_0376578 | 3300039453 | Bacteria | 1576 |
| 303 | Ga0439439_0230212 | 3300041406 | Bacteria | 545 |
| 304 | Ga0451793_0940572 | 3300041452 | Bacteria | 543 |
| 305 | Ga0451804_0711345 | 3300041463 | Bacteria | 1238 |
| 306 | Ga0451847_0670262 | 3300041503 | Bacteria | 1086 |
| 307 | Ga0451853_3090298 | 3300041512 | Bacteria | 1003 |
| 308 | Ga0439452_073299 | 3300042010 | Bacteria | 752 |
| 309 | Ga0439459_0053033 | 3300042438 | Bacteria | 896 |
| 310 | Ga0451577_0033417 | 3300042876 | Bacteria | 4637 |
| 311 | Ga0466972_0156413 | 3300044658 | Bacteria | 1071 |
| 312 | Ga0466972_0227067 | 3300044658 | Bacteria | 874 |
| 313 | Ga0453683_0138123 | 3300044673 | Bacteria | 1537 |
| 314 | Ga0453683_0254494 | 3300044673 | Bacteria | 1120 |
| 315 | Ga0466966_0186280 | 3300044684 | Bacteria | 1258 |
| 316 | Ga0466966_0871737 | 3300044684 | Bacteria | 543 |
| 317 | Ga0466966_0936093 | 3300044684 | Bacteria | 523 |
| 318 | Ga0466963_0517691 | 3300044694 | Bacteria | 842 |
| 319 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 320 | Ga0453684_0000048 | 3300044712 | Bacteria | 559743 |
| 321 | Ga0453684_0026787 | 3300044712 | Bacteria | 8307 |
| 322 | Ga0453684_0089208 | 3300044712 | Bacteria | 3815 |
| 323 | Ga0466957_0151177 | 3300044842 | Bacteria | 1501 |
| 324 | Ga0466957_1031613 | 3300044842 | Bacteria | 591 |
| 325 | Ga0466960_0371019 | 3300044901 | Bacteria | 820 |
| 326 | Ga0466959_0067251 | 3300045049 | Bacteria | 2598 |
| 327 | Ga0451576_0000185 | 3300045051 | Bacteria | 156955 |
| 328 | Ga0451576_0001363 | 3300045051 | Bacteria | 41988 |
| 329 | Ga0451576_0016087 | 3300045051 | Bacteria | 8263 |
| 330 | Ga0451576_0019092 | 3300045051 | Bacteria | 7492 |
| 331 | Ga0451576_0809807 | 3300045051 | Bacteria | 983 |
| 332 | Ga0451576_1908864 | 3300045051 | Bacteria | 613 |
| 333 | Ga0466958_0007891 | 3300045836 | Bacteria | 5883 |
| 334 | Ga0466958_0556017 | 3300045836 | Bacteria | 746 |
| 335 | Ga0466967_1477216 | 3300045976 | Bacteria | 677 |
| 336 | Ga0495592_0017138 | 3300046454 | Bacteria | 5501 |
| 337 | Ga0495592_0018365 | 3300046454 | Bacteria | 5318 |
| 338 | Ga0495629_0451070 | 3300046459 | Bacteria | 871 |
| 339 | Ga0495638_0095864 | 3300046460 | Bacteria | 1781 |
| 340 | Ga0495651_0046685 | 3300046462 | Bacteria | 3352 |
| 341 | Ga0495651_0079218 | 3300046462 | Bacteria | 2483 |
| 342 | Ga0495651_0385038 | 3300046462 | Bacteria | 919 |
| 343 | Ga0495653_0083291 | 3300046463 | Bacteria | 2359 |
| 344 | Ga0495664_0028108 | 3300046477 | Bacteria | 3283 |
| 345 | Ga0495664_0126708 | 3300046477 | Bacteria | 1545 |
| 346 | Ga0495664_0166140 | 3300046477 | Bacteria | 1339 |
| 347 | Ga0495664_0318965 | 3300046477 | Bacteria | 937 |
| 348 | Ga0495583_0266459 | 3300046506 | Bacteria | 685 |
| 349 | Ga0495606_0365854 | 3300046507 | Bacteria | 761 |
| 350 | Ga0495608_0012931 | 3300046511 | Bacteria | 5794 |
| 351 | Ga0495608_0013949 | 3300046511 | Bacteria | 5577 |
| 352 | Ga0495608_0459032 | 3300046511 | Bacteria | 774 |
| 353 | Ga0495618_0229637 | 3300046514 | Bacteria | 1169 |
| 354 | Ga0495628_0027672 | 3300046516 | Bacteria | 4610 |
| 355 | Ga0495628_0076511 | 3300046516 | Bacteria | 2604 |
| 356 | Ga0495628_0159504 | 3300046516 | Bacteria | 1715 |
| 357 | Ga0495630_0152403 | 3300046517 | Bacteria | 1759 |
| 358 | Ga0495652_0041617 | 3300046529 | Bacteria | 3965 |
| 359 | Ga0495652_0270856 | 3300046529 | Bacteria | 1248 |
| 360 | Ga0495665_0133064 | 3300046531 | Bacteria | 1302 |
| 361 | Ga0495640_0047722 | 3300046533 | Bacteria | 2963 |
| 362 | Ga0495640_0142706 | 3300046533 | Bacteria | 1543 |
| 363 | Ga0495640_0207943 | 3300046533 | Bacteria | 1238 |
| 364 | Ga0495640_0345295 | 3300046533 | Bacteria | 919 |
| 365 | Ga0495640_0595814 | 3300046533 | Bacteria | 668 |
| 366 | Ga0495587_0037805 | 3300046536 | Bacteria | 2896 |
| 367 | Ga0495587_0224283 | 3300046536 | Bacteria | 1059 |
| 368 | Ga0495645_0014712 | 3300046543 | Bacteria | 5556 |
| 369 | Ga0495667_0037036 | 3300046559 | Bacteria | 3253 |
| 370 | Ga0495667_0041463 | 3300046559 | Bacteria | 3053 |
| 371 | Ga0495667_0071038 | 3300046559 | Bacteria | 2271 |
| 372 | Ga0495634_0311186 | 3300046642 | Bacteria | 950 |
| 373 | Ga0495634_0730639 | 3300046642 | Bacteria | 568 |
| 374 | Ga0495625_0436515 | 3300046660 | Bacteria | 811 |
| 375 | Ga0495635_0149438 | 3300046663 | Bacteria | 1590 |
| 376 | Ga0495635_0421618 | 3300046663 | Bacteria | 885 |
| 377 | Ga0495657_0179467 | 3300046675 | Bacteria | 1300 |
| 378 | Ga0495657_0305742 | 3300046675 | Bacteria | 947 |
| 379 | Ga0495657_0494031 | 3300046675 | Bacteria | 714 |
| 380 | Ga0495599_0041561 | 3300046678 | Bacteria | 2886 |
| 381 | Ga0495599_0379912 | 3300046678 | Bacteria | 843 |
| 382 | Ga0495623_0019153 | 3300046679 | Bacteria | 4423 |
| 383 | Ga0495646_0020102 | 3300046680 | Bacteria | 4222 |
| 384 | Ga0495647_0192541 | 3300046681 | Bacteria | 892 |
| 385 | Ga0495658_0952340 | 3300046683 | Bacteria | 548 |
| 386 | Ga0495649_0331556 | 3300046694 | Bacteria | 771 |
| 387 | Ga0495600_0124576 | 3300046809 | Bacteria | 1676 |
| 388 | Ga0495600_0167277 | 3300046809 | Bacteria | 1420 |
| 389 | Ga0495581_0655983 | 3300047315 | Bacteria | 606 |
| 390 | Ga0495674_0008309 | 3300047319 | Bacteria | 9896 |
| 391 | Ga0495674_0020151 | 3300047319 | Bacteria | 6179 |
| 392 | Ga0495674_0323501 | 3300047319 | Bacteria | 1256 |
| 393 | Ga0495672_0224305 | 3300047320 | Bacteria | 926 |
| 394 | Ga0495680_0075525 | 3300047322 | Bacteria | 2557 |
| 395 | Ga0495680_0555979 | 3300047322 | Bacteria | 772 |
| 396 | Ga0495680_0820007 | 3300047322 | Bacteria | 606 |
| 397 | Ga0495675_0009246 | 3300047444 | Bacteria | 6130 |
| 398 | Ga0495675_0334128 | 3300047444 | Bacteria | 894 |
| 399 | Ga0495681_0348131 | 3300047470 | Bacteria | 564 |
| 400 | Ga0495684_0111124 | 3300047471 | Bacteria | 2068 |
| 401 | Ga0495684_0171552 | 3300047471 | Bacteria | 1613 |
| 402 | Ga0495684_0243495 | 3300047471 | Bacteria | 1311 |
| 403 | Ga0495684_0337820 | 3300047471 | Bacteria | 1073 |
| 404 | Ga0495684_0597427 | 3300047471 | Bacteria | 745 |
| 405 | Ga0495686_0000007 | 3300047472 | Bacteria | 732622 |
| 406 | Ga0495686_0069119 | 3300047472 | Bacteria | 2178 |
| 407 | Ga0495686_0190639 | 3300047472 | Bacteria | 1182 |
| 408 | Ga0495686_0279035 | 3300047472 | Bacteria | 929 |
| 409 | Ga0495593_0551476 | 3300047673 | Bacteria | 578 |
| 410 | Ga0495602_0002111 | 3300048088 | Bacteria | 20026 |
| 411 | Ga0496104_1292811 | 3300048907 | Bacteria | 633 |
| 412 | Ga0496109_0905756 | 3300048912 | Bacteria | 820 |
| 413 | Ga0496117_0392853 | 3300048920 | Bacteria | 702 |
| 414 | Ga0496123_0016522 | 3300048926 | Bacteria | 5987 |
| 415 | Ga0496126_0288350 | 3300048929 | Bacteria | 1358 |
| 416 | Ga0496126_0747680 | 3300048929 | Bacteria | 755 |
| 417 | Ga0501296_086645 | 3300049519 | Bacteria | 502 |
| 418 | Ga0501031_0159593 | 3300049568 | Bacteria | 1474 |
| 419 | Ga0501032_0050576 | 3300049569 | Bacteria | 2803 |
| 420 | Ga0501033_0013716 | 3300049570 | Bacteria | 6165 |
| 421 | Ga0501034_0311533 | 3300049571 | Bacteria | 1508 |
| 422 | Ga0501037_0037844 | 3300049573 | Bacteria | 3557 |
| 423 | Ga0501037_0235266 | 3300049573 | Bacteria | 1285 |
| 424 | Ga0501037_0313471 | 3300049573 | Bacteria | 1087 |
| 425 | Ga0501037_0622594 | 3300049573 | Bacteria | 723 |
| 426 | Ga0501038_0030594 | 3300049574 | Bacteria | 4761 |
| 427 | Ga0501038_0246407 | 3300049574 | Bacteria | 1417 |
| 428 | Ga0501042_1278684 | 3300049578 | Bacteria | 535 |
| 429 | Ga0501043_0003040 | 3300049579 | Bacteria | 13945 |
| 430 | Ga0501043_0264399 | 3300049579 | Bacteria | 1322 |
| 431 | Ga0501046_0124168 | 3300049580 | Bacteria | 1962 |
| 432 | Ga0501047_0268782 | 3300049581 | Bacteria | 1551 |
| 433 | Ga0501048_0121325 | 3300049582 | Bacteria | 1847 |
| 434 | Ga0501068_0263596 | 3300049584 | Bacteria | 1099 |
| 435 | Ga0501068_0469092 | 3300049584 | Bacteria | 815 |
| 436 | Ga0501069_0051530 | 3300049585 | Bacteria | 2290 |
| 437 | Ga0501070_0044270 | 3300049586 | Bacteria | 3704 |
| 438 | Ga0501070_0073755 | 3300049586 | Bacteria | 2824 |
| 439 | Ga0501070_0094368 | 3300049586 | Bacteria | 2476 |
| 440 | Ga0501070_0158295 | 3300049586 | Bacteria | 1868 |
| 441 | Ga0501070_0184027 | 3300049586 | Bacteria | 1719 |
| 442 | Ga0501072_0197698 | 3300049588 | Bacteria | 1603 |
| 443 | Ga0501072_0711727 | 3300049588 | Bacteria | 789 |
| 444 | Ga0501073_0018267 | 3300049589 | Bacteria | 5066 |
| 445 | Ga0501073_0077000 | 3300049589 | Bacteria | 2321 |
| 446 | Ga0501073_0122337 | 3300049589 | Bacteria | 1803 |
| 447 | Ga0501073_0351580 | 3300049589 | Bacteria | 1017 |
| 448 | Ga0501075_0614638 | 3300049591 | Bacteria | 829 |
| 449 | Ga0501075_1173848 | 3300049591 | Bacteria | 583 |
| 450 | Ga0501076_0357062 | 3300049592 | Bacteria | 1200 |
| 451 | Ga0501077_0055600 | 3300049593 | Bacteria | 2513 |
| 452 | Ga0501257_150544 | 3300049686 | Bacteria | 641 |
| 453 | Ga0501079_0202436 | 3300049741 | Bacteria | 1551 |
| 454 | Ga0501079_0596461 | 3300049741 | Bacteria | 869 |
| 455 | Ga0501080_0009386 | 3300049742 | Bacteria | 8924 |
| 456 | Ga0501080_0009530 | 3300049742 | Bacteria | 8863 |
| 457 | Ga0501080_0071481 | 3300049742 | Bacteria | 3227 |
| 458 | Ga0501080_0218977 | 3300049742 | Bacteria | 1742 |
| 459 | Ga0501081_0205453 | 3300049743 | Bacteria | 1429 |
| 460 | Ga0501081_0826266 | 3300049743 | Bacteria | 698 |
| 461 | Ga0501083_0023657 | 3300049744 | Bacteria | 4259 |
| 462 | Ga0501083_0033783 | 3300049744 | Bacteria | 3500 |
| 463 | Ga0501083_0042912 | 3300049744 | Bacteria | 3065 |
| 464 | Ga0501083_0441018 | 3300049744 | Bacteria | 847 |
| 465 | Ga0501035_0039572 | 3300049822 | Bacteria | 4266 |
| 466 | Ga0501035_0119259 | 3300049822 | Bacteria | 2308 |
| 467 | Ga0501035_0230248 | 3300049822 | Bacteria | 1579 |
| 468 | Ga0501035_0391020 | 3300049822 | Bacteria | 1158 |
| 469 | Ga0501035_0459922 | 3300049822 | Bacteria | 1052 |
| 470 | Ga0501035_0553244 | 3300049822 | Bacteria | 942 |
| 471 | Ga0501044_0029283 | 3300049823 | Bacteria | 5807 |
| 472 | Ga0501044_0034594 | 3300049823 | Bacteria | 5297 |
| 473 | Ga0501044_0047808 | 3300049823 | Bacteria | 4424 |
| 474 | Ga0501044_0223212 | 3300049823 | Bacteria | 1834 |
| 475 | Ga0501044_0243435 | 3300049823 | Bacteria | 1742 |
| 476 | Ga0501045_0690819 | 3300049824 | Bacteria | 753 |
| 477 | nmdc:mga03n38_746660_c1 | 3300050490 | Bacteria | 567 |
| 478 | nmdc:mga05p37_2157732_c1 | 3300050507 | Bacteria | 519 |
| 479 | nmdc:mga0qj67_217146_c1 | 3300050509 | Bacteria | 1552 |
| 480 | nmdc:mga08y16_34_c1 | 3300050511 | Bacteria | 164092 |
| 481 | nmdc:mga0rr50_457247_c1 | 3300050513 | Bacteria | 1082 |
| 482 | nmdc:mga08x19_222241_c1 | 3300050514 | Bacteria | 1298 |
| 483 | nmdc:mga0a205_191804_c1 | 3300050515 | Bacteria | 1935 |
| 484 | nmdc:mga0sz30_236205_c1 | 3300050516 | Bacteria | 813 |
| 485 | Ga0495601_0000760 | 3300053077 | Bacteria | 17417 |
| 486 | Ga0495612_0003226 | 3300053078 | Bacteria | 6761 |
| 487 | Ga0495612_0372228 | 3300053078 | Bacteria | 647 |
| 488 | Ga0500635_0003620 | 3300053080 | Bacteria | 3903 |
| 489 | Ga0495619_0039515 | 3300053085 | Bacteria | 3081 |
| 490 | Ga0495619_0324739 | 3300053085 | Bacteria | 1065 |
| 491 | Ga0500578_0272890 | 3300053086 | Bacteria | 1011 |
| 492 | Ga0500643_025043 | 3300053087 | Bacteria | 1886 |
| 493 | Ga0500643_038352 | 3300053087 | Bacteria | 1421 |
| 494 | Ga0500646_0018671 | 3300053090 | Bacteria | 1828 |
| 495 | Ga0500583_0096604 | 3300053092 | Bacteria | 1443 |
| 496 | Ga0500583_0163923 | 3300053092 | Bacteria | 1107 |
| 497 | Ga0500651_0023089 | 3300053093 | Bacteria | 3893 |
| 498 | Ga0500651_0293147 | 3300053093 | Bacteria | 935 |
| 499 | Ga0500641_0022645 | 3300053096 | Bacteria | 2408 |
| 500 | Ga0500650_0372607 | 3300053098 | Bacteria | 621 |
| 501 | Ga0500555_039931 | 3300053103 | Bacteria | 1309 |
| 502 | Ga0500556_0356275 | 3300053104 | Bacteria | 566 |
| 503 | Ga0500562_000043 | 3300053108 | Bacteria | 65591 |
| 504 | Ga0500562_046172 | 3300053108 | Bacteria | 1161 |
| 505 | Ga0500572_016596 | 3300053111 | Bacteria | 1879 |
| 506 | Ga0500594_0018923 | 3300053118 | Bacteria | 1702 |
| 507 | Ga0500595_003746 | 3300053119 | Bacteria | 7003 |
| 508 | Ga0500621_070620 | 3300053126 | Bacteria | 1408 |
| 509 | Ga0500628_043770 | 3300053129 | Bacteria | 1034 |
| 510 | Ga0500642_0001983 | 3300053130 | Bacteria | 5942 |
| 511 | Ga0500642_0365119 | 3300053130 | Bacteria | 637 |
| 512 | Ga0500652_000092 | 3300053131 | Bacteria | 37694 |
| 513 | Ga0500652_198782 | 3300053131 | Bacteria | 814 |
| 514 | Ga0500561_0206876 | 3300053137 | Bacteria | 621 |
| 515 | Ga0500577_0086338 | 3300053142 | Bacteria | 1260 |
| 516 | Ga0500577_0182613 | 3300053142 | Bacteria | 900 |
| 517 | Ga0500588_0014667 | 3300053146 | Bacteria | 1991 |
| 518 | Ga0500604_0021388 | 3300053151 | Bacteria | 1828 |
| 519 | Ga0500604_0270613 | 3300053151 | Bacteria | 588 |
| 520 | Ga0500616_0008973 | 3300053153 | Bacteria | 6126 |
| 521 | Ga0500622_0173634 | 3300053156 | Bacteria | 1001 |
| 522 | Ga0500622_0176829 | 3300053156 | Bacteria | 989 |
| 523 | Ga0500637_0002697 | 3300053178 | Bacteria | 7963 |
| 524 | Ga0500611_056460 | 3300053727 | Bacteria | 916 |
| 525 | Ga0500645_094566 | 3300053730 | Bacteria | 846 |
| 526 | Ga0500609_000265 | 3300053731 | Bacteria | 7603 |
| 527 | Ga0500656_013911 | 3300053732 | Bacteria | 926 |
| 528 | Ga0500599_006324 | 3300053736 | Bacteria | 1509 |
| 529 | Ga0500587_059592 | 3300053739 | Bacteria | 582 |
| 530 | Ga0501084_0066635 | 3300054114 | Bacteria | 3013 |
| 531 | Ga0501084_0317544 | 3300054114 | Bacteria | 1316 |
| 532 | Ga0501084_0352256 | 3300054114 | Bacteria | 1244 |
| 533 | Ga0501084_0482023 | 3300054114 | Bacteria | 1048 |
| 534 | Ga0590071_012592 | 3300059421 | Bacteria | 1982 |
| 535 | Ga0590074_032126 | 3300059423 | Bacteria | 929 |
| 536 | Ga0590075_101237 | 3300059424 | Bacteria | 750 |
| 537 | Ga0587111_0023499 | 3300060346 | Bacteria | 1206 |
| 538 | Ga0501082_0005902 | 3300060353 | Bacteria | 10621 |
| 539 | Ga0501082_1701556 | 3300060353 | Bacteria | 550 |
| 540 | Ga0530510_1131741 | 3300061734 | Bacteria | 600 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10400864 | Ga0307405_104008642 | 123 |
| 2 | iso_pu_bacteria | 2842694124 | 2842698019 | 123 |
| 3 | 3300041503 | Ga0451847_0670262 | Ga0451847_0670262_73_447 | 124 |
| 4 | 3300053732 | Ga0500656_013911 | Ga0500656_013911_390_764 | 124 |
| 5 | iso_pu_bacteria | 2739367756 | 2739792321 | 124 |
| 6 | iso_pu_bacteria | 2883291878 | 2883295455 | 124 |
| 7 | iso_pu_bacteria | 2883354860 | 2883358317 | 124 |
| 8 | iso_pu_bacteria | 2929199973 | 2929203893 | 124 |
| 9 | iso_pu_bacteria | 8055909800 | 8055912911 | 124 |
| 10 | 3300014968 | Ga0157379_10559043 | Ga0157379_105590432 | 125 |
| 11 | 3300048920 | Ga0496117_0392853 | Ga0496117_0392853_53_436 | 125 |
| 12 | 3300048926 | Ga0496123_0016522 | Ga0496123_0016522_2665_3048 | 125 |
| 13 | 3300003203 | JGI25406J46586_10024513 | JGI25406J46586_100245133 | 126 |
| 14 | 3300003373 | JGI25407J50210_10047793 | JGI25407J50210_100477932 | 126 |
| 15 | 3300003763 | Ga0055529_1008570 | Ga0055529_10085702 | 126 |
| 16 | 3300003781 | Ga0055536_1007565 | Ga0055536_10075653 | 126 |
| 17 | 3300003791 | Ga0055530_10042925 | Ga0055530_100429251 | 126 |
| 18 | 3300003794 | Ga0055531_10021121 | Ga0055531_100211213 | 126 |
| 19 | 3300005295 | Ga0065707_10137685 | Ga0065707_101376852 | 126 |
| 20 | 3300005328 | Ga0070676_11272470 | Ga0070676_112724701 | 126 |
| 21 | 3300005335 | Ga0070666_10004175 | Ga0070666_100041755 | 126 |
| 22 | 3300005336 | Ga0070680_100090643 | Ga0070680_1000906433 | 126 |
| 23 | 3300005336 | Ga0070680_100952534 | Ga0070680_1009525341 | 126 |
| 24 | 3300005353 | Ga0070669_100029162 | Ga0070669_1000291625 | 126 |
| 25 | 3300005356 | Ga0070674_100055959 | Ga0070674_1000559593 | 126 |
| 26 | 3300005367 | Ga0070667_100058865 | Ga0070667_1000588653 | 126 |
| 27 | 3300005434 | Ga0070709_10041505 | Ga0070709_100415051 | 126 |
| 28 | 3300005435 | Ga0070714_100000273 | Ga0070714_10000027327 | 126 |
| 29 | 3300005435 | Ga0070714_100014245 | Ga0070714_1000142452 | 126 |
| 30 | 3300005435 | Ga0070714_100147171 | Ga0070714_1001471712 | 126 |
| 31 | 3300005435 | Ga0070714_100320191 | Ga0070714_1003201912 | 126 |
| 32 | 3300005436 | Ga0070713_100067707 | Ga0070713_1000677072 | 126 |
| 33 | 3300005436 | Ga0070713_100213278 | Ga0070713_1002132782 | 126 |
| 34 | 3300005436 | Ga0070713_100332529 | Ga0070713_1003325292 | 126 |
| 35 | 3300005437 | Ga0070710_10021501 | Ga0070710_100215015 | 126 |
| 36 | 3300005439 | Ga0070711_100007003 | Ga0070711_1000070035 | 126 |
| 37 | 3300005441 | Ga0070700_100179241 | Ga0070700_1001792411 | 126 |
| 38 | 3300005445 | Ga0070708_100288745 | Ga0070708_1002887451 | 126 |
| 39 | 3300005456 | Ga0070678_100006363 | Ga0070678_1000063632 | 126 |
| 40 | 3300005456 | Ga0070678_101017862 | Ga0070678_1010178621 | 126 |
| 41 | 3300005458 | Ga0070681_10570758 | Ga0070681_105707582 | 126 |
| 42 | 3300005458 | Ga0070681_11055268 | Ga0070681_110552681 | 126 |
| 43 | 3300005459 | Ga0068867_100197453 | Ga0068867_1001974532 | 126 |
| 44 | 3300005536 | Ga0070697_101992203 | Ga0070697_1019922031 | 126 |
| 45 | 3300005539 | Ga0068853_101190243 | Ga0068853_1011902431 | 126 |
| 46 | 3300005546 | Ga0070696_100187037 | Ga0070696_1001870372 | 126 |
| 47 | 3300005546 | Ga0070696_100352809 | Ga0070696_1003528092 | 126 |
| 48 | 3300005547 | Ga0070693_100133796 | Ga0070693_1001337962 | 126 |
| 49 | 3300005547 | Ga0070693_101531129 | Ga0070693_1015311291 | 126 |
| 50 | 3300005548 | Ga0070665_100125601 | Ga0070665_1001256013 | 126 |
| 51 | 3300005548 | Ga0070665_100822750 | Ga0070665_1008227502 | 126 |
| 52 | 3300005563 | Ga0068855_100165312 | Ga0068855_1001653122 | 126 |
| 53 | 3300005563 | Ga0068855_100262706 | Ga0068855_1002627062 | 126 |
| 54 | 3300005563 | Ga0068855_101027073 | Ga0068855_1010270732 | 126 |
| 55 | 3300005577 | Ga0068857_100408709 | Ga0068857_1004087092 | 126 |
| 56 | 3300005614 | Ga0068856_100092353 | Ga0068856_1000923532 | 126 |
| 57 | 3300005614 | Ga0068856_100140421 | Ga0068856_1001404213 | 126 |
| 58 | 3300005616 | Ga0068852_100697526 | Ga0068852_1006975262 | 126 |
| 59 | 3300005617 | Ga0068859_100450535 | Ga0068859_1004505352 | 126 |
| 60 | 3300005718 | Ga0068866_10199070 | Ga0068866_101990702 | 126 |
| 61 | 3300005719 | Ga0068861_100005476 | Ga0068861_1000054762 | 126 |
| 62 | 3300005841 | Ga0068863_101378333 | Ga0068863_1013783331 | 126 |
| 63 | 3300005843 | Ga0068860_100954187 | Ga0068860_1009541872 | 126 |
| 64 | 3300005844 | Ga0068862_100070984 | Ga0068862_1000709843 | 126 |
| 65 | 3300005844 | Ga0068862_100254758 | Ga0068862_1002547582 | 126 |
| 66 | 3300005937 | Ga0081455_10076545 | Ga0081455_100765452 | 126 |
| 67 | 3300005981 | Ga0081538_10004235 | Ga0081538_1000423511 | 126 |
| 68 | 3300005983 | Ga0081540_1108832 | Ga0081540_11088322 | 126 |
| 69 | 3300005985 | Ga0081539_10000054 | Ga0081539_1000005430 | 126 |
| 70 | 3300005985 | Ga0081539_10055738 | Ga0081539_100557382 | 126 |
| 71 | 3300006028 | Ga0070717_10066227 | Ga0070717_100662273 | 126 |
| 72 | 3300006028 | Ga0070717_10323580 | Ga0070717_103235802 | 126 |
| 73 | 3300006028 | Ga0070717_10361951 | Ga0070717_103619512 | 126 |
| 74 | 3300006028 | Ga0070717_10780386 | Ga0070717_107803862 | 126 |
| 75 | 3300006028 | Ga0070717_10790860 | Ga0070717_107908602 | 126 |
| 76 | 3300006028 | Ga0070717_10851299 | Ga0070717_108512992 | 126 |
| 77 | 3300006175 | Ga0070712_100113849 | Ga0070712_1001138492 | 126 |
| 78 | 3300006175 | Ga0070712_100954712 | Ga0070712_1009547121 | 126 |
| 79 | 3300006186 | Ga0075369_10144415 | Ga0075369_101444152 | 126 |
| 80 | 3300006195 | Ga0075366_10298920 | Ga0075366_102989202 | 126 |
| 81 | 3300006195 | Ga0075366_10412273 | Ga0075366_104122732 | 126 |
| 82 | 3300006844 | Ga0075428_100738641 | Ga0075428_1007386412 | 126 |
| 83 | 3300006846 | Ga0075430_100474761 | Ga0075430_1004747612 | 126 |
| 84 | 3300006847 | Ga0075431_100374468 | Ga0075431_1003744682 | 126 |
| 85 | 3300006881 | Ga0068865_100150331 | Ga0068865_1001503312 | 126 |
| 86 | 3300006914 | Ga0075436_100362718 | Ga0075436_1003627182 | 126 |
| 87 | 3300006931 | Ga0097620_100450545 | Ga0097620_1004505452 | 126 |
| 88 | 3300007076 | Ga0075435_101510859 | Ga0075435_1015108591 | 126 |
| 89 | 3300009094 | Ga0111539_10000279 | Ga0111539_1000027955 | 126 |
| 90 | 3300009094 | Ga0111539_10737055 | Ga0111539_107370552 | 126 |
| 91 | 3300009101 | Ga0105247_10458838 | Ga0105247_104588382 | 126 |
| 92 | 3300009101 | Ga0105247_10520004 | Ga0105247_105200041 | 126 |
| 93 | 3300009101 | Ga0105247_11462460 | Ga0105247_114624601 | 126 |
| 94 | 3300009147 | Ga0114129_10453808 | Ga0114129_104538082 | 126 |
| 95 | 3300009177 | Ga0105248_10189060 | Ga0105248_101890602 | 126 |
| 96 | 3300009177 | Ga0105248_10526595 | Ga0105248_105265951 | 126 |
| 97 | 3300009545 | Ga0105237_10206726 | Ga0105237_102067262 | 126 |
| 98 | 3300009551 | Ga0105238_10740690 | Ga0105238_107406902 | 126 |
| 99 | 3300009553 | Ga0105249_10268144 | Ga0105249_102681442 | 126 |
| 100 | 3300009553 | Ga0105249_11956418 | Ga0105249_119564182 | 126 |
| 101 | 3300009978 | Ga0105148_109079 | Ga0105148_1090792 | 126 |
| 102 | 3300010375 | Ga0105239_10892503 | Ga0105239_108925032 | 126 |
| 103 | 3300013104 | Ga0157370_11443112 | Ga0157370_114431121 | 126 |
| 104 | 3300013296 | Ga0157374_10142353 | Ga0157374_101423532 | 126 |
| 105 | 3300013296 | Ga0157374_10942529 | Ga0157374_109425292 | 126 |
| 106 | 3300013296 | Ga0157374_11542254 | Ga0157374_115422541 | 126 |
| 107 | 3300013297 | Ga0157378_10322811 | Ga0157378_103228112 | 126 |
| 108 | 3300013306 | Ga0163162_10817891 | Ga0163162_108178912 | 126 |
| 109 | 3300013306 | Ga0163162_11324218 | Ga0163162_113242182 | 126 |
| 110 | 3300013307 | Ga0157372_10995984 | Ga0157372_109959842 | 126 |
| 111 | 3300013307 | Ga0157372_11186931 | Ga0157372_111869312 | 126 |
| 112 | 3300013307 | Ga0157372_11360163 | Ga0157372_113601631 | 126 |
| 113 | 3300013308 | Ga0157375_10907302 | Ga0157375_109073022 | 126 |
| 114 | 3300014325 | Ga0163163_10057382 | Ga0163163_100573823 | 126 |
| 115 | 3300014325 | Ga0163163_12294769 | Ga0163163_122947691 | 126 |
| 116 | 3300014326 | Ga0157380_10090696 | Ga0157380_100906964 | 126 |
| 117 | 3300014326 | Ga0157380_10119267 | Ga0157380_101192672 | 126 |
| 118 | 3300014497 | Ga0182008_10131389 | Ga0182008_101313892 | 126 |
| 119 | 3300014497 | Ga0182008_10400643 | Ga0182008_104006432 | 126 |
| 120 | 3300014969 | Ga0157376_10644302 | Ga0157376_106443022 | 126 |
| 121 | 3300014969 | Ga0157376_10676543 | Ga0157376_106765432 | 126 |
| 122 | 3300021361 | Ga0213872_10000084 | Ga0213872_1000008443 | 126 |
| 123 | 3300021361 | Ga0213872_10000779 | Ga0213872_1000077911 | 126 |
| 124 | 3300021361 | Ga0213872_10001414 | Ga0213872_1000141413 | 126 |
| 125 | 3300021361 | Ga0213872_10041193 | Ga0213872_100411932 | 126 |
| 126 | 3300021361 | Ga0213872_10063401 | Ga0213872_100634012 | 126 |
| 127 | 3300021361 | Ga0213872_10071241 | Ga0213872_100712412 | 126 |
| 128 | 3300021361 | Ga0213872_10138800 | Ga0213872_101388002 | 126 |
| 129 | 3300021361 | Ga0213872_10183941 | Ga0213872_101839411 | 126 |
| 130 | 3300021361 | Ga0213872_10215765 | Ga0213872_102157652 | 126 |
| 131 | 3300021361 | Ga0213872_10276102 | Ga0213872_102761021 | 126 |
| 132 | 3300021377 | Ga0213874_10071195 | Ga0213874_100711952 | 126 |
| 133 | 3300021384 | Ga0213876_10092976 | Ga0213876_100929763 | 126 |
| 134 | 3300021388 | Ga0213875_10047259 | Ga0213875_100472593 | 126 |
| 135 | 3300021441 | Ga0213871_10094538 | Ga0213871_100945382 | 126 |
| 136 | 3300021441 | Ga0213871_10253986 | Ga0213871_102539861 | 126 |
| 137 | 3300025254 | Ga0209148_1000425 | Ga0209148_100042533 | 126 |
| 138 | 3300025272 | Ga0209455_1000468 | Ga0209455_10004685 | 126 |
| 139 | 3300025291 | Ga0209675_1009860 | Ga0209675_10098602 | 126 |
| 140 | 3300025292 | Ga0209676_1000019 | Ga0209676_1000019338 | 126 |
| 141 | 3300025292 | Ga0209676_1006495 | Ga0209676_10064956 | 126 |
| 142 | 3300025297 | Ga0209758_1000119 | Ga0209758_100011930 | 126 |
| 143 | 3300025297 | Ga0209758_1027820 | Ga0209758_10278203 | 126 |
| 144 | 3300025298 | Ga0209050_1003841 | Ga0209050_100384111 | 126 |
| 145 | 3300025298 | Ga0209050_1113990 | Ga0209050_11139901 | 126 |
| 146 | 3300025304 | Ga0209257_1000301 | Ga0209257_100030110 | 126 |
| 147 | 3300025898 | Ga0207692_10069543 | Ga0207692_100695432 | 126 |
| 148 | 3300025900 | Ga0207710_10487501 | Ga0207710_104875011 | 126 |
| 149 | 3300025903 | Ga0207680_10543216 | Ga0207680_105432161 | 126 |
| 150 | 3300025914 | Ga0207671_10381940 | Ga0207671_103819401 | 126 |
| 151 | 3300025915 | Ga0207693_10312076 | Ga0207693_103120761 | 126 |
| 152 | 3300025917 | Ga0207660_10237893 | Ga0207660_102378932 | 126 |
| 153 | 3300025917 | Ga0207660_10837879 | Ga0207660_108378792 | 126 |
| 154 | 3300025921 | Ga0207652_10043894 | Ga0207652_100438942 | 126 |
| 155 | 3300025923 | Ga0207681_10013805 | Ga0207681_100138052 | 126 |
| 156 | 3300025924 | Ga0207694_10797721 | Ga0207694_107977212 | 126 |
| 157 | 3300025924 | Ga0207694_10844579 | Ga0207694_108445792 | 126 |
| 158 | 3300025927 | Ga0207687_10640805 | Ga0207687_106408052 | 126 |
| 159 | 3300025928 | Ga0207700_10020209 | Ga0207700_100202092 | 126 |
| 160 | 3300025928 | Ga0207700_10148191 | Ga0207700_101481912 | 126 |
| 161 | 3300025928 | Ga0207700_10535078 | Ga0207700_105350782 | 126 |
| 162 | 3300025929 | Ga0207664_10007141 | Ga0207664_100071412 | 126 |
| 163 | 3300025929 | Ga0207664_10031965 | Ga0207664_100319654 | 126 |
| 164 | 3300025929 | Ga0207664_10576859 | Ga0207664_105768592 | 126 |
| 165 | 3300025929 | Ga0207664_10766716 | Ga0207664_107667162 | 126 |
| 166 | 3300025929 | Ga0207664_11857443 | Ga0207664_118574431 | 126 |
| 167 | 3300025931 | Ga0207644_10777917 | Ga0207644_107779172 | 126 |
| 168 | 3300025937 | Ga0207669_10034423 | Ga0207669_100344232 | 126 |
| 169 | 3300025937 | Ga0207669_10399038 | Ga0207669_103990382 | 126 |
| 170 | 3300025937 | Ga0207669_11933794 | Ga0207669_119337941 | 126 |
| 171 | 3300025938 | Ga0207704_10176364 | Ga0207704_101763643 | 126 |
| 172 | 3300025941 | Ga0207711_10122678 | Ga0207711_101226782 | 126 |
| 173 | 3300025942 | Ga0207689_10569792 | Ga0207689_105697922 | 126 |
| 174 | 3300025949 | Ga0207667_10121342 | Ga0207667_101213422 | 126 |
| 175 | 3300025949 | Ga0207667_10361708 | Ga0207667_103617082 | 126 |
| 176 | 3300025986 | Ga0207658_10044564 | Ga0207658_100445643 | 126 |
| 177 | 3300026035 | Ga0207703_11817666 | Ga0207703_118176662 | 126 |
| 178 | 3300026041 | Ga0207639_10626387 | Ga0207639_106263871 | 126 |
| 179 | 3300026075 | Ga0207708_10125834 | Ga0207708_101258343 | 126 |
| 180 | 3300026078 | Ga0207702_10171200 | Ga0207702_101712004 | 126 |
| 181 | 3300026078 | Ga0207702_10653106 | Ga0207702_106531062 | 126 |
| 182 | 3300026088 | Ga0207641_10652177 | Ga0207641_106521773 | 126 |
| 183 | 3300026116 | Ga0207674_10357675 | Ga0207674_103576752 | 126 |
| 184 | 3300026118 | Ga0207675_100029377 | Ga0207675_1000293772 | 126 |
| 185 | 3300026121 | Ga0207683_10040979 | Ga0207683_100409792 | 126 |
| 186 | 3300026142 | Ga0207698_10625222 | Ga0207698_106252222 | 126 |
| 187 | 3300027907 | Ga0207428_10000153 | Ga0207428_1000015325 | 126 |
| 188 | 3300028379 | Ga0268266_10398378 | Ga0268266_103983781 | 126 |
| 189 | 3300028379 | Ga0268266_10709814 | Ga0268266_107098142 | 126 |
| 190 | 3300028380 | Ga0268265_10001529 | Ga0268265_100015295 | 126 |
| 191 | 3300028380 | Ga0268265_10604423 | Ga0268265_106044232 | 126 |
| 192 | 3300028380 | Ga0268265_10622452 | Ga0268265_106224522 | 126 |
| 193 | 3300028381 | Ga0268264_10825967 | Ga0268264_108259671 | 126 |
| 194 | 3300028381 | Ga0268264_11467860 | Ga0268264_114678601 | 126 |
| 195 | 3300028577 | Ga0265318_10198661 | Ga0265318_101986611 | 126 |
| 196 | 3300028786 | Ga0307517_10067056 | Ga0307517_100670564 | 126 |
| 197 | 3300028786 | Ga0307517_10172098 | Ga0307517_101720981 | 126 |
| 198 | 3300028794 | Ga0307515_10174233 | Ga0307515_101742332 | 126 |
| 199 | 3300028800 | Ga0265338_10118871 | Ga0265338_101188712 | 126 |
| 200 | 3300028800 | Ga0265338_10212416 | Ga0265338_102124162 | 126 |
| 201 | 3300031239 | Ga0265328_10004011 | Ga0265328_100040115 | 126 |
| 202 | 3300031239 | Ga0265328_10073609 | Ga0265328_100736092 | 126 |
| 203 | 3300031240 | Ga0265320_10001466 | Ga0265320_1000146615 | 126 |
| 204 | 3300031240 | Ga0265320_10051078 | Ga0265320_100510783 | 126 |
| 205 | 3300031241 | Ga0265325_10014559 | Ga0265325_100145593 | 126 |
| 206 | 3300031241 | Ga0265325_10264640 | Ga0265325_102646401 | 126 |
| 207 | 3300031250 | Ga0265331_10000156 | Ga0265331_1000015664 | 126 |
| 208 | 3300031250 | Ga0265331_10000667 | Ga0265331_1000066737 | 126 |
| 209 | 3300031251 | Ga0265327_10000100 | Ga0265327_10000100136 | 126 |
| 210 | 3300031251 | Ga0265327_10333473 | Ga0265327_103334731 | 126 |
| 211 | 3300031456 | Ga0307513_10021763 | Ga0307513_100217635 | 126 |
| 212 | 3300031456 | Ga0307513_10212930 | Ga0307513_102129303 | 126 |
| 213 | 3300031548 | Ga0307408_100266460 | Ga0307408_1002664602 | 126 |
| 214 | 3300031595 | Ga0265313_10000140 | Ga0265313_100001404 | 126 |
| 215 | 3300031595 | Ga0265313_10000296 | Ga0265313_100002962 | 126 |
| 216 | 3300031595 | Ga0265313_10022264 | Ga0265313_100222643 | 126 |
| 217 | 3300031711 | Ga0265314_10009618 | Ga0265314_100096182 | 126 |
| 218 | 3300031730 | Ga0307516_10157422 | Ga0307516_101574222 | 126 |
| 219 | 3300031824 | Ga0307413_10141298 | Ga0307413_101412982 | 126 |
| 220 | 3300031824 | Ga0307413_11146189 | Ga0307413_111461892 | 126 |
| 221 | 3300031852 | Ga0307410_10023847 | Ga0307410_100238473 | 126 |
| 222 | 3300031995 | Ga0307409_100044270 | Ga0307409_1000442704 | 126 |
| 223 | 3300031995 | Ga0307409_101431557 | Ga0307409_1014315572 | 126 |
| 224 | 3300032002 | Ga0307416_101224879 | Ga0307416_1012248792 | 126 |
| 225 | 3300032005 | Ga0307411_10033846 | Ga0307411_100338463 | 126 |
| 226 | 3300032005 | Ga0307411_12087606 | Ga0307411_120876062 | 126 |
| 227 | 3300032126 | Ga0307415_100432034 | Ga0307415_1004320342 | 126 |
| 228 | 3300032126 | Ga0307415_100733840 | Ga0307415_1007338402 | 126 |
| 229 | 3300033179 | Ga0307507_10141250 | Ga0307507_101412501 | 126 |
| 230 | 3300033180 | Ga0307510_10453875 | Ga0307510_104538751 | 126 |
| 231 | 3300035086 | Ga0373934_0103592 | Ga0373934_0103592_378_764 | 126 |
| 232 | 3300035111 | Ga0373923_0043699 | Ga0373923_0043699_407_793 | 126 |
| 233 | 3300035113 | Ga0373936_0032841 | Ga0373936_0032841_525_911 | 126 |
| 234 | 3300035113 | Ga0373936_0601946 | Ga0373936_0601946_118_504 | 126 |
| 235 | 3300035116 | Ga0373945_0033298 | Ga0373945_0033298_906_1292 | 126 |
| 236 | 3300035116 | Ga0373945_0313322 | Ga0373945_0313322_223_609 | 126 |
| 237 | 3300035117 | Ga0373953_0047795 | Ga0373953_0047795_501_887 | 126 |
| 238 | 3300035118 | Ga0373954_0177256 | Ga0373954_0177256_42_428 | 126 |
| 239 | 3300035170 | Ga0373943_0762545 | Ga0373943_0762545_178_564 | 126 |
| 240 | 3300035171 | Ga0373946_0062935 | Ga0373946_0062935_767_1153 | 126 |
| 241 | 3300035172 | Ga0373955_0066028 | Ga0373955_0066028_290_676 | 126 |
| 242 | 3300035172 | Ga0373955_0403721 | Ga0373955_0403721_194_580 | 126 |
| 243 | 3300035398 | Ga0316574_0348215 | Ga0316574_0348215_508_894 | 126 |
| 244 | 3300035410 | Ga0373924_0046705 | Ga0373924_0046705_388_774 | 126 |
| 245 | 3300035410 | Ga0373924_0050166 | Ga0373924_0050166_1195_1581 | 126 |
| 246 | 3300035692 | Ga0373935_0046595 | Ga0373935_0046595_837_1223 | 126 |
| 247 | 3300035692 | Ga0373935_0262734 | Ga0373935_0262734_764_1150 | 126 |
| 248 | 3300035692 | Ga0373935_0851843 | Ga0373935_0851843_254_640 | 126 |
| 249 | 3300035692 | Ga0373935_0983764 | Ga0373935_0983764_195_581 | 126 |
| 250 | 3300035695 | Ga0373927_0049307 | Ga0373927_0049307_1555_1941 | 126 |
| 251 | 3300035695 | Ga0373927_0172811 | Ga0373927_0172811_812_1198 | 126 |
| 252 | 3300035695 | Ga0373927_0689265 | Ga0373927_0689265_111_497 | 126 |
| 253 | 3300035724 | Ga0373933_0002124 | Ga0373933_0002124_3649_4035 | 126 |
| 254 | 3300035724 | Ga0373933_0031148 | Ga0373933_0031148_1637_2023 | 126 |
| 255 | 3300035724 | Ga0373933_0087325 | Ga0373933_0087325_262_648 | 126 |
| 256 | 3300035725 | Ga0373947_0138464 | Ga0373947_0138464_1124_1510 | 126 |
| 257 | 3300035725 | Ga0373947_0226508 | Ga0373947_0226508_571_957 | 126 |
| 258 | 3300035725 | Ga0373947_1144402 | Ga0373947_1144402_119_505 | 126 |
| 259 | 3300036401 | Ga0373937_0003385 | Ga0373937_0003385_8755_9141 | 126 |
| 260 | 3300036401 | Ga0373937_0052401 | Ga0373937_0052401_3218_3604 | 126 |
| 261 | 3300036401 | Ga0373937_0097936 | Ga0373937_0097936_194_580 | 126 |
| 262 | 3300036401 | Ga0373937_0197834 | Ga0373937_0197834_372_758 | 126 |
| 263 | 3300036401 | Ga0373937_0283675 | Ga0373937_0283675_1047_1433 | 126 |
| 264 | 3300036401 | Ga0373937_0685927 | Ga0373937_0685927_416_802 | 126 |
| 265 | 3300036401 | Ga0373937_0981666 | Ga0373937_0981666_256_642 | 126 |
| 266 | 3300037068 | Ga0373925_0079815 | Ga0373925_0079815_698_1084 | 126 |
| 267 | 3300037068 | Ga0373925_0237291 | Ga0373925_0237291_1018_1404 | 126 |
| 268 | 3300037068 | Ga0373925_0668120 | Ga0373925_0668120_198_584 | 126 |
| 269 | 3300037418 | Ga0395900_0010650 | Ga0395900_0010650_5708_6097 | 126 |
| 270 | 3300037418 | Ga0395900_0165626 | Ga0395900_0165626_1053_1442 | 126 |
| 271 | 3300037466 | Ga0395898_0165440 | Ga0395898_0165440_644_1033 | 126 |
| 272 | 3300037466 | Ga0395898_0769015 | Ga0395898_0769015_265_651 | 126 |
| 273 | 3300037466 | Ga0395898_1364826 | Ga0395898_1364826_19_405 | 126 |
| 274 | 3300037466 | Ga0395898_1679864 | Ga0395898_1679864_97_486 | 126 |
| 275 | 3300037471 | Ga0395905_0556985 | Ga0395905_0556985_68_454 | 126 |
| 276 | 3300037853 | Ga0436364_0050215 | Ga0436364_0050215_956_1342 | 126 |
| 277 | 3300037853 | Ga0436364_0092884 | Ga0436364_0092884_8866_9252 | 126 |
| 278 | 3300037853 | Ga0436364_0135611 | Ga0436364_0135611_38_424 | 126 |
| 279 | 3300037853 | Ga0436364_1040380 | Ga0436364_1040380_895_1275 | 126 |
| 280 | 3300037853 | Ga0436364_1322587 | Ga0436364_1322587_2177_2560 | 126 |
| 281 | 3300038443 | Ga0395901_0079440 | Ga0395901_0079440_1040_1429 | 126 |
| 282 | 3300038443 | Ga0395901_0419790 | Ga0395901_0419790_877_1263 | 126 |
| 283 | 3300039437 | Ga0436365_0405382 | Ga0436365_0405382_64_453 | 126 |
| 284 | 3300039437 | Ga0436365_0470668 | Ga0436365_0470668_12_398 | 126 |
| 285 | 3300039437 | Ga0436365_1490329 | Ga0436365_1490329_35_421 | 126 |
| 286 | 3300039437 | Ga0436365_1682656 | Ga0436365_1682656_958_1344 | 126 |
| 287 | 3300039438 | Ga0436360_0104644 | Ga0436360_0104644_126_569 | 126 |
| 288 | 3300039438 | Ga0436360_0110871 | Ga0436360_0110871_10_396 | 126 |
| 289 | 3300039438 | Ga0436360_0122328 | Ga0436360_0122328_127_507 | 126 |
| 290 | 3300039438 | Ga0436360_0498074 | Ga0436360_0498074_80_460 | 126 |
| 291 | 3300039438 | Ga0436360_0529644 | Ga0436360_0529644_263_649 | 126 |
| 292 | 3300039438 | Ga0436360_0877606 | Ga0436360_0877606_1121_1507 | 126 |
| 293 | 3300039438 | Ga0436360_1134589 | Ga0436360_1134589_505_885 | 126 |
| 294 | 3300039438 | Ga0436360_1189690 | Ga0436360_1189690_238_624 | 126 |
| 295 | 3300039438 | Ga0436360_1299497 | Ga0436360_1299497_557_943 | 126 |
| 296 | 3300039447 | Ga0436361_0063582 | Ga0436361_0063582_180_566 | 126 |
| 297 | 3300039447 | Ga0436361_0103120 | Ga0436361_0103120_38893_39279 | 126 |
| 298 | 3300039447 | Ga0436361_0125172 | Ga0436361_0125172_6379_6765 | 126 |
| 299 | 3300039447 | Ga0436361_0126507 | Ga0436361_0126507_2200_2598 | 126 |
| 300 | 3300039447 | Ga0436361_0171142 | Ga0436361_0171142_619_1005 | 126 |
| 301 | 3300039447 | Ga0436361_0243625 | Ga0436361_0243625_2570_2956 | 126 |
| 302 | 3300039447 | Ga0436361_0280120 | Ga0436361_0280120_1672_2058 | 126 |
| 303 | 3300039447 | Ga0436361_0404717 | Ga0436361_0404717_418_816 | 126 |
| 304 | 3300039447 | Ga0436361_0637202 | Ga0436361_0637202_678_1064 | 126 |
| 305 | 3300039447 | Ga0436361_0704599 | Ga0436361_0704599_1051_1437 | 126 |
| 306 | 3300039447 | Ga0436361_0969683 | Ga0436361_0969683_2231_2617 | 126 |
| 307 | 3300039447 | Ga0436361_0988569 | Ga0436361_0988569_1427_1813 | 126 |
| 308 | 3300039447 | Ga0436361_1141666 | Ga0436361_1141666_1918_2304 | 126 |
| 309 | 3300039450 | Ga0436363_0454500 | Ga0436363_0454500_50_436 | 126 |
| 310 | 3300039450 | Ga0436363_1422843 | Ga0436363_1422843_500_886 | 126 |
| 311 | 3300039453 | Ga0436362_0157900 | Ga0436362_0157900_30_416 | 126 |
| 312 | 3300039453 | Ga0436362_0376578 | Ga0436362_0376578_895_1281 | 126 |
| 313 | 3300041406 | Ga0439439_0230212 | Ga0439439_0230212_137_523 | 126 |
| 314 | 3300041452 | Ga0451793_0940572 | Ga0451793_0940572_105_500 | 126 |
| 315 | 3300041463 | Ga0451804_0711345 | Ga0451804_0711345_403_789 | 126 |
| 316 | 3300041512 | Ga0451853_3090298 | Ga0451853_3090298_293_679 | 126 |
| 317 | 3300042010 | Ga0439452_073299 | Ga0439452_073299_136_522 | 126 |
| 318 | 3300042438 | Ga0439459_0053033 | Ga0439459_0053033_224_610 | 126 |
| 319 | 3300042876 | Ga0451577_0033417 | Ga0451577_0033417_961_1347 | 126 |
| 320 | 3300044658 | Ga0466972_0156413 | Ga0466972_0156413_30_416 | 126 |
| 321 | 3300044658 | Ga0466972_0227067 | Ga0466972_0227067_75_461 | 126 |
| 322 | 3300044673 | Ga0453683_0138123 | Ga0453683_0138123_524_913 | 126 |
| 323 | 3300044673 | Ga0453683_0254494 | Ga0453683_0254494_80_469 | 126 |
| 324 | 3300044684 | Ga0466966_0186280 | Ga0466966_0186280_416_802 | 126 |
| 325 | 3300044684 | Ga0466966_0871737 | Ga0466966_0871737_95_475 | 126 |
| 326 | 3300044684 | Ga0466966_0936093 | Ga0466966_0936093_85_465 | 126 |
| 327 | 3300044694 | Ga0466963_0517691 | Ga0466963_0517691_391_777 | 126 |
| 328 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_1287382_1287768 | 126 |
| 329 | 3300044712 | Ga0453684_0000048 | Ga0453684_0000048_254129_254515 | 126 |
| 330 | 3300044712 | Ga0453684_0026787 | Ga0453684_0026787_6092_6478 | 126 |
| 331 | 3300044712 | Ga0453684_0089208 | Ga0453684_0089208_980_1366 | 126 |
| 332 | 3300044842 | Ga0466957_0151177 | Ga0466957_0151177_482_868 | 126 |
| 333 | 3300044842 | Ga0466957_1031613 | Ga0466957_1031613_44_430 | 126 |
| 334 | 3300044901 | Ga0466960_0371019 | Ga0466960_0371019_36_416 | 126 |
| 335 | 3300045049 | Ga0466959_0067251 | Ga0466959_0067251_1562_1948 | 126 |
| 336 | 3300045051 | Ga0451576_0000185 | Ga0451576_0000185_45126_45512 | 126 |
| 337 | 3300045051 | Ga0451576_0001363 | Ga0451576_0001363_40599_40979 | 126 |
| 338 | 3300045051 | Ga0451576_0016087 | Ga0451576_0016087_652_1041 | 126 |
| 339 | 3300045051 | Ga0451576_0019092 | Ga0451576_0019092_7024_7413 | 126 |
| 340 | 3300045051 | Ga0451576_0809807 | Ga0451576_0809807_577_966 | 126 |
| 341 | 3300045051 | Ga0451576_1908864 | Ga0451576_1908864_203_589 | 126 |
| 342 | 3300045836 | Ga0466958_0007891 | Ga0466958_0007891_4861_5247 | 126 |
| 343 | 3300045836 | Ga0466958_0556017 | Ga0466958_0556017_235_615 | 126 |
| 344 | 3300045976 | Ga0466967_1477216 | Ga0466967_1477216_242_628 | 126 |
| 345 | 3300046454 | Ga0495592_0017138 | Ga0495592_0017138_2644_3030 | 126 |
| 346 | 3300046454 | Ga0495592_0018365 | Ga0495592_0018365_4164_4550 | 126 |
| 347 | 3300046459 | Ga0495629_0451070 | Ga0495629_0451070_303_689 | 126 |
| 348 | 3300046460 | Ga0495638_0095864 | Ga0495638_0095864_376_762 | 126 |
| 349 | 3300046462 | Ga0495651_0046685 | Ga0495651_0046685_118_504 | 126 |
| 350 | 3300046462 | Ga0495651_0079218 | Ga0495651_0079218_534_920 | 126 |
| 351 | 3300046462 | Ga0495651_0385038 | Ga0495651_0385038_181_567 | 126 |
| 352 | 3300046463 | Ga0495653_0083291 | Ga0495653_0083291_1002_1388 | 126 |
| 353 | 3300046477 | Ga0495664_0028108 | Ga0495664_0028108_1071_1457 | 126 |
| 354 | 3300046477 | Ga0495664_0126708 | Ga0495664_0126708_374_760 | 126 |
| 355 | 3300046477 | Ga0495664_0166140 | Ga0495664_0166140_350_733 | 126 |
| 356 | 3300046477 | Ga0495664_0318965 | Ga0495664_0318965_443_829 | 126 |
| 357 | 3300046506 | Ga0495583_0266459 | Ga0495583_0266459_71_457 | 126 |
| 358 | 3300046507 | Ga0495606_0365854 | Ga0495606_0365854_57_443 | 126 |
| 359 | 3300046511 | Ga0495608_0012931 | Ga0495608_0012931_4125_4511 | 126 |
| 360 | 3300046511 | Ga0495608_0013949 | Ga0495608_0013949_2845_3231 | 126 |
| 361 | 3300046511 | Ga0495608_0459032 | Ga0495608_0459032_208_594 | 126 |
| 362 | 3300046514 | Ga0495618_0229637 | Ga0495618_0229637_462_869 | 126 |
| 363 | 3300046516 | Ga0495628_0027672 | Ga0495628_0027672_2206_2592 | 126 |
| 364 | 3300046516 | Ga0495628_0076511 | Ga0495628_0076511_822_1208 | 126 |
| 365 | 3300046516 | Ga0495628_0159504 | Ga0495628_0159504_755_1141 | 126 |
| 366 | 3300046517 | Ga0495630_0152403 | Ga0495630_0152403_174_560 | 126 |
| 367 | 3300046529 | Ga0495652_0041617 | Ga0495652_0041617_1937_2323 | 126 |
| 368 | 3300046529 | Ga0495652_0270856 | Ga0495652_0270856_657_1043 | 126 |
| 369 | 3300046531 | Ga0495665_0133064 | Ga0495665_0133064_617_1003 | 126 |
| 370 | 3300046533 | Ga0495640_0047722 | Ga0495640_0047722_1703_2089 | 126 |
| 371 | 3300046533 | Ga0495640_0142706 | Ga0495640_0142706_841_1227 | 126 |
| 372 | 3300046533 | Ga0495640_0207943 | Ga0495640_0207943_526_909 | 126 |
| 373 | 3300046533 | Ga0495640_0345295 | Ga0495640_0345295_294_680 | 126 |
| 374 | 3300046533 | Ga0495640_0595814 | Ga0495640_0595814_265_651 | 126 |
| 375 | 3300046536 | Ga0495587_0037805 | Ga0495587_0037805_465_851 | 126 |
| 376 | 3300046536 | Ga0495587_0224283 | Ga0495587_0224283_439_825 | 126 |
| 377 | 3300046543 | Ga0495645_0014712 | Ga0495645_0014712_2780_3166 | 126 |
| 378 | 3300046559 | Ga0495667_0037036 | Ga0495667_0037036_2339_2725 | 126 |
| 379 | 3300046559 | Ga0495667_0041463 | Ga0495667_0041463_737_1123 | 126 |
| 380 | 3300046559 | Ga0495667_0071038 | Ga0495667_0071038_99_482 | 126 |
| 381 | 3300046642 | Ga0495634_0311186 | Ga0495634_0311186_355_741 | 126 |
| 382 | 3300046642 | Ga0495634_0730639 | Ga0495634_0730639_83_469 | 126 |
| 383 | 3300046660 | Ga0495625_0436515 | Ga0495625_0436515_244_630 | 126 |
| 384 | 3300046663 | Ga0495635_0149438 | Ga0495635_0149438_471_857 | 126 |
| 385 | 3300046663 | Ga0495635_0421618 | Ga0495635_0421618_92_475 | 126 |
| 386 | 3300046675 | Ga0495657_0179467 | Ga0495657_0179467_215_601 | 126 |
| 387 | 3300046675 | Ga0495657_0305742 | Ga0495657_0305742_37_423 | 126 |
| 388 | 3300046675 | Ga0495657_0494031 | Ga0495657_0494031_210_593 | 126 |
| 389 | 3300046678 | Ga0495599_0041561 | Ga0495599_0041561_995_1381 | 126 |
| 390 | 3300046678 | Ga0495599_0379912 | Ga0495599_0379912_379_765 | 126 |
| 391 | 3300046679 | Ga0495623_0019153 | Ga0495623_0019153_1421_1807 | 126 |
| 392 | 3300046680 | Ga0495646_0020102 | Ga0495646_0020102_717_1103 | 126 |
| 393 | 3300046681 | Ga0495647_0192541 | Ga0495647_0192541_102_488 | 126 |
| 394 | 3300046683 | Ga0495658_0952340 | Ga0495658_0952340_151_537 | 126 |
| 395 | 3300046694 | Ga0495649_0331556 | Ga0495649_0331556_370_756 | 126 |
| 396 | 3300046809 | Ga0495600_0124576 | Ga0495600_0124576_1209_1595 | 126 |
| 397 | 3300046809 | Ga0495600_0167277 | Ga0495600_0167277_910_1296 | 126 |
| 398 | 3300047315 | Ga0495581_0655983 | Ga0495581_0655983_60_446 | 126 |
| 399 | 3300047319 | Ga0495674_0008309 | Ga0495674_0008309_3995_4381 | 126 |
| 400 | 3300047319 | Ga0495674_0020151 | Ga0495674_0020151_3002_3388 | 126 |
| 401 | 3300047319 | Ga0495674_0323501 | Ga0495674_0323501_838_1224 | 126 |
| 402 | 3300047320 | Ga0495672_0224305 | Ga0495672_0224305_13_399 | 126 |
| 403 | 3300047322 | Ga0495680_0075525 | Ga0495680_0075525_626_1012 | 126 |
| 404 | 3300047322 | Ga0495680_0555979 | Ga0495680_0555979_266_652 | 126 |
| 405 | 3300047322 | Ga0495680_0820007 | Ga0495680_0820007_135_521 | 126 |
| 406 | 3300047444 | Ga0495675_0009246 | Ga0495675_0009246_2062_2448 | 126 |
| 407 | 3300047444 | Ga0495675_0334128 | Ga0495675_0334128_376_762 | 126 |
| 408 | 3300047470 | Ga0495681_0348131 | Ga0495681_0348131_52_438 | 126 |
| 409 | 3300047471 | Ga0495684_0111124 | Ga0495684_0111124_417_803 | 126 |
| 410 | 3300047471 | Ga0495684_0171552 | Ga0495684_0171552_428_811 | 126 |
| 411 | 3300047471 | Ga0495684_0243495 | Ga0495684_0243495_596_982 | 126 |
| 412 | 3300047471 | Ga0495684_0337820 | Ga0495684_0337820_168_554 | 126 |
| 413 | 3300047471 | Ga0495684_0597427 | Ga0495684_0597427_336_722 | 126 |
| 414 | 3300047472 | Ga0495686_0000007 | Ga0495686_0000007_619963_620355 | 126 |
| 415 | 3300047472 | Ga0495686_0069119 | Ga0495686_0069119_1432_1824 | 126 |
| 416 | 3300047472 | Ga0495686_0190639 | Ga0495686_0190639_690_1082 | 126 |
| 417 | 3300047472 | Ga0495686_0279035 | Ga0495686_0279035_470_856 | 126 |
| 418 | 3300047673 | Ga0495593_0551476 | Ga0495593_0551476_86_472 | 126 |
| 419 | 3300048088 | Ga0495602_0002111 | Ga0495602_0002111_3885_4271 | 126 |
| 420 | 3300048907 | Ga0496104_1292811 | Ga0496104_1292811_180_566 | 126 |
| 421 | 3300048912 | Ga0496109_0905756 | Ga0496109_0905756_314_700 | 126 |
| 422 | 3300048929 | Ga0496126_0288350 | Ga0496126_0288350_291_677 | 126 |
| 423 | 3300048929 | Ga0496126_0747680 | Ga0496126_0747680_278_709 | 126 |
| 424 | 3300049519 | Ga0501296_086645 | Ga0501296_086645_42_479 | 126 |
| 425 | 3300049568 | Ga0501031_0159593 | Ga0501031_0159593_415_876 | 126 |
| 426 | 3300049569 | Ga0501032_0050576 | Ga0501032_0050576_1589_1975 | 126 |
| 427 | 3300049570 | Ga0501033_0013716 | Ga0501033_0013716_4870_5331 | 126 |
| 428 | 3300049571 | Ga0501034_0311533 | Ga0501034_0311533_148_534 | 126 |
| 429 | 3300049573 | Ga0501037_0037844 | Ga0501037_0037844_1337_1798 | 126 |
| 430 | 3300049573 | Ga0501037_0235266 | Ga0501037_0235266_586_975 | 126 |
| 431 | 3300049573 | Ga0501037_0313471 | Ga0501037_0313471_512_898 | 126 |
| 432 | 3300049573 | Ga0501037_0622594 | Ga0501037_0622594_289_675 | 126 |
| 433 | 3300049574 | Ga0501038_0030594 | Ga0501038_0030594_776_1237 | 126 |
| 434 | 3300049574 | Ga0501038_0246407 | Ga0501038_0246407_814_1260 | 126 |
| 435 | 3300049578 | Ga0501042_1278684 | Ga0501042_1278684_21_407 | 126 |
| 436 | 3300049579 | Ga0501043_0003040 | Ga0501043_0003040_719_1180 | 126 |
| 437 | 3300049579 | Ga0501043_0264399 | Ga0501043_0264399_288_674 | 126 |
| 438 | 3300049580 | Ga0501046_0124168 | Ga0501046_0124168_818_1279 | 126 |
| 439 | 3300049581 | Ga0501047_0268782 | Ga0501047_0268782_320_781 | 126 |
| 440 | 3300049582 | Ga0501048_0121325 | Ga0501048_0121325_31_492 | 126 |
| 441 | 3300049584 | Ga0501068_0263596 | Ga0501068_0263596_122_583 | 126 |
| 442 | 3300049584 | Ga0501068_0469092 | Ga0501068_0469092_362_748 | 126 |
| 443 | 3300049585 | Ga0501069_0051530 | Ga0501069_0051530_880_1341 | 126 |
| 444 | 3300049586 | Ga0501070_0044270 | Ga0501070_0044270_548_1009 | 126 |
| 445 | 3300049586 | Ga0501070_0073755 | Ga0501070_0073755_1008_1394 | 126 |
| 446 | 3300049586 | Ga0501070_0094368 | Ga0501070_0094368_1747_2133 | 126 |
| 447 | 3300049586 | Ga0501070_0158295 | Ga0501070_0158295_1003_1392 | 126 |
| 448 | 3300049586 | Ga0501070_0184027 | Ga0501070_0184027_48_434 | 126 |
| 449 | 3300049588 | Ga0501072_0197698 | Ga0501072_0197698_243_629 | 126 |
| 450 | 3300049588 | Ga0501072_0711727 | Ga0501072_0711727_15_401 | 126 |
| 451 | 3300049589 | Ga0501073_0018267 | Ga0501073_0018267_4322_4783 | 126 |
| 452 | 3300049589 | Ga0501073_0077000 | Ga0501073_0077000_514_900 | 126 |
| 453 | 3300049589 | Ga0501073_0122337 | Ga0501073_0122337_876_1262 | 126 |
| 454 | 3300049589 | Ga0501073_0351580 | Ga0501073_0351580_498_884 | 126 |
| 455 | 3300049591 | Ga0501075_0614638 | Ga0501075_0614638_25_411 | 126 |
| 456 | 3300049591 | Ga0501075_1173848 | Ga0501075_1173848_69_500 | 126 |
| 457 | 3300049592 | Ga0501076_0357062 | Ga0501076_0357062_461_922 | 126 |
| 458 | 3300049593 | Ga0501077_0055600 | Ga0501077_0055600_978_1364 | 126 |
| 459 | 3300049686 | Ga0501257_150544 | Ga0501257_150544_116_502 | 126 |
| 460 | 3300049741 | Ga0501079_0202436 | Ga0501079_0202436_1039_1425 | 126 |
| 461 | 3300049741 | Ga0501079_0596461 | Ga0501079_0596461_106_492 | 126 |
| 462 | 3300049742 | Ga0501080_0009386 | Ga0501080_0009386_6909_7295 | 126 |
| 463 | 3300049742 | Ga0501080_0009530 | Ga0501080_0009530_6776_7162 | 126 |
| 464 | 3300049742 | Ga0501080_0071481 | Ga0501080_0071481_928_1389 | 126 |
| 465 | 3300049742 | Ga0501080_0218977 | Ga0501080_0218977_516_902 | 126 |
| 466 | 3300049743 | Ga0501081_0205453 | Ga0501081_0205453_875_1261 | 126 |
| 467 | 3300049743 | Ga0501081_0826266 | Ga0501081_0826266_220_651 | 126 |
| 468 | 3300049744 | Ga0501083_0023657 | Ga0501083_0023657_2780_3241 | 126 |
| 469 | 3300049744 | Ga0501083_0033783 | Ga0501083_0033783_668_1054 | 126 |
| 470 | 3300049744 | Ga0501083_0042912 | Ga0501083_0042912_539_925 | 126 |
| 471 | 3300049744 | Ga0501083_0441018 | Ga0501083_0441018_181_567 | 126 |
| 472 | 3300049822 | Ga0501035_0039572 | Ga0501035_0039572_3028_3417 | 126 |
| 473 | 3300049822 | Ga0501035_0119259 | Ga0501035_0119259_1399_1785 | 126 |
| 474 | 3300049822 | Ga0501035_0230248 | Ga0501035_0230248_791_1252 | 126 |
| 475 | 3300049822 | Ga0501035_0391020 | Ga0501035_0391020_270_656 | 126 |
| 476 | 3300049822 | Ga0501035_0459922 | Ga0501035_0459922_135_521 | 126 |
| 477 | 3300049822 | Ga0501035_0553244 | Ga0501035_0553244_33_419 | 126 |
| 478 | 3300049823 | Ga0501044_0029283 | Ga0501044_0029283_5182_5568 | 126 |
| 479 | 3300049823 | Ga0501044_0034594 | Ga0501044_0034594_3560_4021 | 126 |
| 480 | 3300049823 | Ga0501044_0047808 | Ga0501044_0047808_3123_3509 | 126 |
| 481 | 3300049823 | Ga0501044_0223212 | Ga0501044_0223212_409_855 | 126 |
| 482 | 3300049823 | Ga0501044_0243435 | Ga0501044_0243435_578_964 | 126 |
| 483 | 3300049824 | Ga0501045_0690819 | Ga0501045_0690819_55_441 | 126 |
| 484 | 3300050490 | nmdc:mga03n38_746660_c1 | nmdc:mga03n38_746660_c1_155_541 | 126 |
| 485 | 3300050507 | nmdc:mga05p37_2157732_c1 | nmdc:mga05p37_2157732_c1_76_462 | 126 |
| 486 | 3300050509 | nmdc:mga0qj67_217146_c1 | nmdc:mga0qj67_217146_c1_244_630 | 126 |
| 487 | 3300050511 | nmdc:mga08y16_34_c1 | nmdc:mga08y16_34_c1_104742_105128 | 126 |
| 488 | 3300050513 | nmdc:mga0rr50_457247_c1 | nmdc:mga0rr50_457247_c1_75_461 | 126 |
| 489 | 3300050514 | nmdc:mga08x19_222241_c1 | nmdc:mga08x19_222241_c1_893_1279 | 126 |
| 490 | 3300050515 | nmdc:mga0a205_191804_c1 | nmdc:mga0a205_191804_c1_472_858 | 126 |
| 491 | 3300050516 | nmdc:mga0sz30_236205_c1 | nmdc:mga0sz30_236205_c1_12_398 | 126 |
| 492 | 3300053077 | Ga0495601_0000760 | Ga0495601_0000760_6623_7009 | 126 |
| 493 | 3300053078 | Ga0495612_0003226 | Ga0495612_0003226_2290_2676 | 126 |
| 494 | 3300053078 | Ga0495612_0372228 | Ga0495612_0372228_149_535 | 126 |
| 495 | 3300053080 | Ga0500635_0003620 | Ga0500635_0003620_1814_2254 | 126 |
| 496 | 3300053085 | Ga0495619_0039515 | Ga0495619_0039515_45_431 | 126 |
| 497 | 3300053085 | Ga0495619_0324739 | Ga0495619_0324739_400_786 | 126 |
| 498 | 3300053086 | Ga0500578_0272890 | Ga0500578_0272890_316_702 | 126 |
| 499 | 3300053087 | Ga0500643_025043 | Ga0500643_025043_834_1220 | 126 |
| 500 | 3300053087 | Ga0500643_038352 | Ga0500643_038352_873_1259 | 126 |
| 501 | 3300053090 | Ga0500646_0018671 | Ga0500646_0018671_1035_1421 | 126 |
| 502 | 3300053092 | Ga0500583_0096604 | Ga0500583_0096604_990_1376 | 126 |
| 503 | 3300053092 | Ga0500583_0163923 | Ga0500583_0163923_245_631 | 126 |
| 504 | 3300053093 | Ga0500651_0023089 | Ga0500651_0023089_2858_3244 | 126 |
| 505 | 3300053093 | Ga0500651_0293147 | Ga0500651_0293147_472_858 | 126 |
| 506 | 3300053096 | Ga0500641_0022645 | Ga0500641_0022645_1259_1645 | 126 |
| 507 | 3300053098 | Ga0500650_0372607 | Ga0500650_0372607_27_413 | 126 |
| 508 | 3300053103 | Ga0500555_039931 | Ga0500555_039931_236_622 | 126 |
| 509 | 3300053104 | Ga0500556_0356275 | Ga0500556_0356275_152_538 | 126 |
| 510 | 3300053108 | Ga0500562_000043 | Ga0500562_000043_54525_54911 | 126 |
| 511 | 3300053108 | Ga0500562_046172 | Ga0500562_046172_417_803 | 126 |
| 512 | 3300053111 | Ga0500572_016596 | Ga0500572_016596_964_1350 | 126 |
| 513 | 3300053118 | Ga0500594_0018923 | Ga0500594_0018923_1299_1685 | 126 |
| 514 | 3300053119 | Ga0500595_003746 | Ga0500595_003746_709_1095 | 126 |
| 515 | 3300053126 | Ga0500621_070620 | Ga0500621_070620_635_1021 | 126 |
| 516 | 3300053129 | Ga0500628_043770 | Ga0500628_043770_268_654 | 126 |
| 517 | 3300053130 | Ga0500642_0001983 | Ga0500642_0001983_554_940 | 126 |
| 518 | 3300053130 | Ga0500642_0365119 | Ga0500642_0365119_135_521 | 126 |
| 519 | 3300053131 | Ga0500652_000092 | Ga0500652_000092_1301_1693 | 126 |
| 520 | 3300053131 | Ga0500652_198782 | Ga0500652_198782_20_406 | 126 |
| 521 | 3300053137 | Ga0500561_0206876 | Ga0500561_0206876_142_528 | 126 |
| 522 | 3300053142 | Ga0500577_0086338 | Ga0500577_0086338_428_814 | 126 |
| 523 | 3300053142 | Ga0500577_0182613 | Ga0500577_0182613_299_685 | 126 |
| 524 | 3300053146 | Ga0500588_0014667 | Ga0500588_0014667_1295_1681 | 126 |
| 525 | 3300053151 | Ga0500604_0021388 | Ga0500604_0021388_726_1112 | 126 |
| 526 | 3300053151 | Ga0500604_0270613 | Ga0500604_0270613_33_419 | 126 |
| 527 | 3300053153 | Ga0500616_0008973 | Ga0500616_0008973_4812_5198 | 126 |
| 528 | 3300053156 | Ga0500622_0173634 | Ga0500622_0173634_473_859 | 126 |
| 529 | 3300053156 | Ga0500622_0176829 | Ga0500622_0176829_379_765 | 126 |
| 530 | 3300053178 | Ga0500637_0002697 | Ga0500637_0002697_1496_1882 | 126 |
| 531 | 3300053727 | Ga0500611_056460 | Ga0500611_056460_272_658 | 126 |
| 532 | 3300053730 | Ga0500645_094566 | Ga0500645_094566_286_672 | 126 |
| 533 | 3300053731 | Ga0500609_000265 | Ga0500609_000265_1064_1450 | 126 |
| 534 | 3300053736 | Ga0500599_006324 | Ga0500599_006324_243_629 | 126 |
| 535 | 3300053739 | Ga0500587_059592 | Ga0500587_059592_10_396 | 126 |
| 536 | 3300054114 | Ga0501084_0066635 | Ga0501084_0066635_580_1041 | 126 |
| 537 | 3300054114 | Ga0501084_0317544 | Ga0501084_0317544_264_650 | 126 |
| 538 | 3300054114 | Ga0501084_0352256 | Ga0501084_0352256_447_833 | 126 |
| 539 | 3300054114 | Ga0501084_0482023 | Ga0501084_0482023_485_871 | 126 |
| 540 | 3300059421 | Ga0590071_012592 | Ga0590071_012592_1041_1427 | 126 |
| 541 | 3300059423 | Ga0590074_032126 | Ga0590074_032126_191_577 | 126 |
| 542 | 3300059424 | Ga0590075_101237 | Ga0590075_101237_86_472 | 126 |
| 543 | 3300060346 | Ga0587111_0023499 | Ga0587111_0023499_451_837 | 126 |
| 544 | 3300060353 | Ga0501082_0005902 | Ga0501082_0005902_7251_7637 | 126 |
| 545 | 3300060353 | Ga0501082_1701556 | Ga0501082_1701556_55_441 | 126 |
| 546 | 3300061734 | Ga0530510_1131741 | Ga0530510_1131741_190_579 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3to5-assembly1.cif.gz_A | high resolution structure of chey3 from vibrio cholerae | 0.9897 | 1 | 123 |
| 1e6l-assembly1.cif.gz_A | two-component signal transduction system d13a mutant of chey | 0.9879 | 2 | 125 |
| 3rvo-assembly1.cif.gz_A | structure of chey-mn2+ complex with substitutions at 59 and 89: n59d e89y | 0.9877 | 2 | 125 |
| 4hnq-assembly1.cif.gz_A | crystal structure of the mutant q97a of vibrio cholerae chey3 | 0.9875 | 1 | 123 |
| 4lx8-assembly1.cif.gz_A | crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae | 0.9875 | 1 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9825 | 1 | 123 | 3.40.50.2300 |
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.967 | 1 | 123 | 3.40.50.2300 |
| 3t6kB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9556 | 4 | 124 | 3.40.50.2300 |
| af_Q23917_160_371_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9548 | 5 | 125 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.953 | 3 | 125 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1L7AGH8-F1-model_v4 | Two-component system response regulator | 1.005 | 1 | 126 |
GO:0000160
|
| AF-A0A248JM56-F1-model_v4 | Response regulator | 1.004 | 5 | 123 |
GO:0000160
|
| AF-A0A7W9QPJ8-F1-model_v4 | Two-component system chemotaxis response regulator CheY | 1.003 | 6 | 122 |
GO:0000160
|
| AF-A0A2S6MZI0-F1-model_v4 | Response regulatory domain-containing protein | 1.002 | 5 | 123 |
GO:0000160
|
| AF-S9QRN9-F1-model_v4 | Chemotaxis regulator-transmits chemoreceptor signals to flagelllar motor component CheY | 1.002 | 5 | 123 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar