F462042

General Info

Members Datasets Scaffolds Average Seq Length
546 313 540 129

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0159593|Ga0501031_0159593_415_876
Length 153
Sequence LYHRNDTERFANPPAIMQPKPKEVAMSVDMQMNILIVDDYKTMLRIIRNLLKQLGFNNVDEATDGSMALQKLRDKDYGLVISDWNMEPMTGIQLLREVRADAKLKALPFIMITAESKTENVIAAKEAGVNNYIVKPFNAATLKTKLASVIGNF

Samples

Sample ID Description Type Environment
1 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
4 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
5 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
279 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
287 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
290 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
294 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
302 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
303 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
304 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
305 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0.18
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 0
Rhizoplane 0.73
Rhizosphere 82.6
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10024513 3300003203 Bacteria 2362
2 JGI25407J50210_10047793 3300003373 Bacteria 1087
3 Ga0055529_1008570 3300003763 Bacteria 1359
4 Ga0055536_1007565 3300003781 Bacteria 4833
5 Ga0055530_10042925 3300003791 Bacteria 1094
6 Ga0055531_10021121 3300003794 Bacteria 2542
7 Ga0065707_10137685 3300005295 Bacteria 1817
8 Ga0070676_11272470 3300005328 Bacteria 561
9 Ga0070666_10004175 3300005335 Bacteria 8769
10 Ga0070680_100090643 3300005336 Bacteria 2531
11 Ga0070680_100952534 3300005336 Bacteria 741
12 Ga0070669_100029162 3300005353 Bacteria 3976
13 Ga0070674_100055959 3300005356 Bacteria 2734
14 Ga0070667_100058865 3300005367 Bacteria 3249
15 Ga0070709_10041505 3300005434 Bacteria 2835
16 Ga0070714_100000273 3300005435 Bacteria 39446
17 Ga0070714_100014245 3300005435 Bacteria 6385
18 Ga0070714_100147171 3300005435 Bacteria 2120
19 Ga0070714_100320191 3300005435 Bacteria 1450
20 Ga0070713_100067707 3300005436 Bacteria 3007
21 Ga0070713_100213278 3300005436 Bacteria 1749
22 Ga0070713_100332529 3300005436 Bacteria 1406
23 Ga0070710_10021501 3300005437 Bacteria 3364
24 Ga0070711_100007003 3300005439 Bacteria 6842
25 Ga0070700_100179241 3300005441 Bacteria 1473
26 Ga0070708_100288745 3300005445 Bacteria 1544
27 Ga0070678_100006363 3300005456 Bacteria 6929
28 Ga0070678_101017862 3300005456 Bacteria 762
29 Ga0070681_10570758 3300005458 Bacteria 1045
30 Ga0070681_11055268 3300005458 Bacteria 733
31 Ga0068867_100197453 3300005459 Bacteria 1609
32 Ga0070697_101992203 3300005536 Bacteria 520
33 Ga0068853_101190243 3300005539 Bacteria 736
34 Ga0070696_100187037 3300005546 Bacteria 1539
35 Ga0070696_100352809 3300005546 Bacteria 1140
36 Ga0070693_100133796 3300005547 Bacteria 1553
37 Ga0070693_101531129 3300005547 Bacteria 522
38 Ga0070665_100125601 3300005548 Bacteria 2568
39 Ga0070665_100822750 3300005548 Bacteria 942
40 Ga0068855_100165312 3300005563 Bacteria 2509
41 Ga0068855_100262706 3300005563 Bacteria 1922
42 Ga0068855_101027073 3300005563 Bacteria 865
43 Ga0068857_100408709 3300005577 Bacteria 1264
44 Ga0068856_100092353 3300005614 Bacteria 3012
45 Ga0068856_100140421 3300005614 Bacteria 2423
46 Ga0068852_100697526 3300005616 Bacteria 1025
47 Ga0068859_100450535 3300005617 Bacteria 1383
48 Ga0068866_10199070 3300005718 Bacteria 1196
49 Ga0068861_100005476 3300005719 Bacteria 8603
50 Ga0068863_101378333 3300005841 Bacteria 713
51 Ga0068860_100954187 3300005843 Bacteria 875
52 Ga0068862_100070984 3300005844 Bacteria 3007
53 Ga0068862_100254758 3300005844 Bacteria 1600
54 Ga0081455_10076545 3300005937 Bacteria 2756
55 Ga0081538_10004235 3300005981 Bacteria 13310
56 Ga0081540_1108832 3300005983 Bacteria 1177
57 Ga0081539_10000054 3300005985 Bacteria 259053
58 Ga0081539_10055738 3300005985 Bacteria 2197
59 Ga0070717_10066227 3300006028 Bacteria 3004
60 Ga0070717_10323580 3300006028 Bacteria 1374
61 Ga0070717_10361951 3300006028 Bacteria 1298
62 Ga0070717_10780386 3300006028 Bacteria 869
63 Ga0070717_10790860 3300006028 Bacteria 863
64 Ga0070717_10851299 3300006028 Bacteria 830
65 Ga0070712_100113849 3300006175 Bacteria 2024
66 Ga0070712_100954712 3300006175 Bacteria 741
67 Ga0075369_10144415 3300006186 Bacteria 1086
68 Ga0075366_10298920 3300006195 Bacteria 985
69 Ga0075366_10412273 3300006195 Bacteria 832
70 Ga0075428_100738641 3300006844 Bacteria 1047
71 Ga0075430_100474761 3300006846 Bacteria 1032
72 Ga0075431_100374468 3300006847 Bacteria 1429
73 Ga0068865_100150331 3300006881 Bacteria 1766
74 Ga0075436_100362718 3300006914 Bacteria 1045
75 Ga0097620_100450545 3300006931 Bacteria 1383
76 Ga0075435_101510859 3300007076 Bacteria 589
77 Ga0111539_10000279 3300009094 Bacteria 61126
78 Ga0111539_10737055 3300009094 Bacteria 1147
79 Ga0105247_10458838 3300009101 Bacteria 920
80 Ga0105247_10520004 3300009101 Bacteria 870
81 Ga0105247_11462460 3300009101 Bacteria 556
82 Ga0114129_10453808 3300009147 Bacteria 1681
83 Ga0105248_10189060 3300009177 Bacteria 2320
84 Ga0105248_10526595 3300009177 Bacteria 1333
85 Ga0105237_10206726 3300009545 Bacteria 1963
86 Ga0105238_10740690 3300009551 Bacteria 996
87 Ga0105249_10268144 3300009553 Bacteria 1700
88 Ga0105249_11956418 3300009553 Bacteria 659
89 Ga0105148_109079 3300009978 Bacteria 748
90 Ga0105239_10892503 3300010375 Bacteria 1020
91 Ga0157370_11443112 3300013104 Bacteria 619
92 Ga0157374_10142353 3300013296 Bacteria 2328
93 Ga0157374_10942529 3300013296 Bacteria 882
94 Ga0157374_11542254 3300013296 Bacteria 688
95 Ga0157378_10322811 3300013297 Bacteria 1500
96 Ga0163162_10817891 3300013306 Bacteria 1048
97 Ga0163162_11324218 3300013306 Bacteria 818
98 Ga0157372_10995984 3300013307 Bacteria 971
99 Ga0157372_11186931 3300013307 Bacteria 882
100 Ga0157372_11360163 3300013307 Bacteria 819
101 Ga0157375_10907302 3300013308 Bacteria 1025
102 Ga0163163_10057382 3300014325 Bacteria 3850
103 Ga0163163_12294769 3300014325 Bacteria 598
104 Ga0157380_10090696 3300014326 Bacteria 2522
105 Ga0157380_10119267 3300014326 Bacteria 2232
106 Ga0182008_10131389 3300014497 Bacteria 1248
107 Ga0182008_10400643 3300014497 Bacteria 737
108 Ga0157379_10559043 3300014968 Bacteria 1065
109 Ga0157376_10644302 3300014969 Bacteria 1059
110 Ga0157376_10676543 3300014969 Bacteria 1035
111 Ga0213872_10000084 3300021361 Bacteria 86548
112 Ga0213872_10000779 3300021361 Bacteria 23308
113 Ga0213872_10001414 3300021361 Bacteria 15752
114 Ga0213872_10041193 3300021361 Bacteria 2107
115 Ga0213872_10063401 3300021361 Bacteria 1670
116 Ga0213872_10071241 3300021361 Bacteria 1567
117 Ga0213872_10138800 3300021361 Bacteria 1068
118 Ga0213872_10183941 3300021361 Bacteria 901
119 Ga0213872_10215765 3300021361 Bacteria 818
120 Ga0213872_10276102 3300021361 Bacteria 702
121 Ga0213874_10071195 3300021377 Bacteria 1109
122 Ga0213876_10092976 3300021384 Bacteria 1597
123 Ga0213875_10047259 3300021388 Bacteria 2019
124 Ga0213871_10094538 3300021441 Bacteria 869
125 Ga0213871_10253986 3300021441 Bacteria 559
126 Ga0209148_1000425 3300025254 Bacteria 46888
127 Ga0209455_1000468 3300025272 Bacteria 30358
128 Ga0209675_1009860 3300025291 Bacteria 3324
129 Ga0209676_1000019 3300025292 Bacteria 620012
130 Ga0209676_1006495 3300025292 Bacteria 5754
131 Ga0209758_1000119 3300025297 Bacteria 195545
132 Ga0209758_1027820 3300025297 Bacteria 2407
133 Ga0209050_1003841 3300025298 Bacteria 10706
134 Ga0209050_1113990 3300025298 Bacteria 514
135 Ga0209257_1000301 3300025304 Bacteria 108454
136 Ga0207692_10069543 3300025898 Bacteria 1850
137 Ga0207710_10487501 3300025900 Bacteria 639
138 Ga0207680_10543216 3300025903 Bacteria 829
139 Ga0207671_10381940 3300025914 Bacteria 1119
140 Ga0207693_10312076 3300025915 Bacteria 1231
141 Ga0207660_10237893 3300025917 Bacteria 1434
142 Ga0207660_10837879 3300025917 Bacteria 750
143 Ga0207652_10043894 3300025921 Bacteria 3807
144 Ga0207681_10013805 3300025923 Bacteria 5005
145 Ga0207694_10797721 3300025924 Bacteria 798
146 Ga0207694_10844579 3300025924 Bacteria 774
147 Ga0207687_10640805 3300025927 Bacteria 898
148 Ga0207700_10020209 3300025928 Bacteria 4517
149 Ga0207700_10148191 3300025928 Bacteria 1937
150 Ga0207700_10535078 3300025928 Bacteria 1039
151 Ga0207664_10007141 3300025929 Bacteria 7744
152 Ga0207664_10031965 3300025929 Bacteria 4031
153 Ga0207664_10576859 3300025929 Bacteria 1010
154 Ga0207664_10766716 3300025929 Bacteria 868
155 Ga0207664_11857443 3300025929 Bacteria 525
156 Ga0207644_10777917 3300025931 Bacteria 800
157 Ga0207669_10034423 3300025937 Bacteria 2870
158 Ga0207669_10399038 3300025937 Bacteria 1077
159 Ga0207669_11933794 3300025937 Bacteria 504
160 Ga0207704_10176364 3300025938 Bacteria 1539
161 Ga0207711_10122678 3300025941 Bacteria 2321
162 Ga0207689_10569792 3300025942 Bacteria 952
163 Ga0207667_10121342 3300025949 Bacteria 2693
164 Ga0207667_10361708 3300025949 Bacteria 1480
165 Ga0207658_10044564 3300025986 Bacteria 3230
166 Ga0207703_11817666 3300026035 Bacteria 585
167 Ga0207639_10626387 3300026041 Bacteria 994
168 Ga0207708_10125834 3300026075 Bacteria 2000
169 Ga0207702_10171200 3300026078 Bacteria 1991
170 Ga0207702_10653106 3300026078 Bacteria 1034
171 Ga0207641_10652177 3300026088 Bacteria 1034
172 Ga0207674_10357675 3300026116 Bacteria 1411
173 Ga0207675_100029377 3300026118 Bacteria 5123
174 Ga0207683_10040979 3300026121 Bacteria 4043
175 Ga0207698_10625222 3300026142 Bacteria 1064
176 Ga0207428_10000153 3300027907 Bacteria 94107
177 Ga0268266_10398378 3300028379 Bacteria 1301
178 Ga0268266_10709814 3300028379 Bacteria 969
179 Ga0268265_10001529 3300028380 Bacteria 19280
180 Ga0268265_10604423 3300028380 Bacteria 1048
181 Ga0268265_10622452 3300028380 Bacteria 1034
182 Ga0268264_10825967 3300028381 Bacteria 927
183 Ga0268264_11467860 3300028381 Bacteria 693
184 Ga0265318_10198661 3300028577 Bacteria 733
185 Ga0307517_10067056 3300028786 Bacteria 3292
186 Ga0307517_10172098 3300028786 Bacteria 1421
187 Ga0307515_10174233 3300028794 Bacteria 2129
188 Ga0265338_10118871 3300028800 Bacteria 2111
189 Ga0265338_10212416 3300028800 Bacteria 1451
190 Ga0265328_10004011 3300031239 Bacteria 6452
191 Ga0265328_10073609 3300031239 Bacteria 1256
192 Ga0265320_10001466 3300031240 Bacteria 17239
193 Ga0265320_10051078 3300031240 Bacteria 2008
194 Ga0265325_10014559 3300031241 Bacteria 4441
195 Ga0265325_10264640 3300031241 Bacteria 775
196 Ga0265331_10000156 3300031250 Bacteria 87128
197 Ga0265331_10000667 3300031250 Bacteria 29636
198 Ga0265327_10000100 3300031251 Bacteria 189591
199 Ga0265327_10333473 3300031251 Bacteria 664
200 Ga0307513_10021763 3300031456 Bacteria 7563
201 Ga0307513_10212930 3300031456 Bacteria 1761
202 Ga0307408_100266460 3300031548 Unclassified 1420
203 Ga0265313_10000140 3300031595 Bacteria 74628
204 Ga0265313_10000296 3300031595 Bacteria 54068
205 Ga0265313_10022264 3300031595 Bacteria 3443
206 Ga0265314_10009618 3300031711 Bacteria 8142
207 Ga0307516_10157422 3300031730 Bacteria 2025
208 Ga0307405_10400864 3300031731 Bacteria 1074
209 Ga0307413_10141298 3300031824 Bacteria 1664
210 Ga0307413_11146189 3300031824 Bacteria 674
211 Ga0307410_10023847 3300031852 Bacteria 3813
212 Ga0307409_100044270 3300031995 Bacteria 3351
213 Ga0307409_101431557 3300031995 Bacteria 718
214 Ga0307416_101224879 3300032002 Bacteria 856
215 Ga0307411_10033846 3300032005 Bacteria 3173
216 Ga0307411_12087606 3300032005 Bacteria 530
217 Ga0307415_100432034 3300032126 Bacteria 1133
218 Ga0307415_100733840 3300032126 Bacteria 895
219 Ga0307507_10141250 3300033179 Bacteria 1845
220 Ga0307510_10453875 3300033180 Bacteria 723
221 Ga0373934_0103592 3300035086 Bacteria 1151
222 Ga0373923_0043699 3300035111 Bacteria 1855
223 Ga0373936_0032841 3300035113 Bacteria 2055
224 Ga0373936_0601946 3300035113 Bacteria 516
225 Ga0373945_0033298 3300035116 Bacteria 1831
226 Ga0373945_0313322 3300035116 Bacteria 674
227 Ga0373953_0047795 3300035117 Bacteria 1722
228 Ga0373954_0177256 3300035118 Bacteria 1045
229 Ga0373943_0762545 3300035170 Bacteria 575
230 Ga0373946_0062935 3300035171 Bacteria 1583
231 Ga0373955_0066028 3300035172 Bacteria 2010
232 Ga0373955_0403721 3300035172 Bacteria 830
233 Ga0316574_0348215 3300035398 Bacteria 938
234 Ga0373924_0046705 3300035410 Bacteria 1785
235 Ga0373924_0050166 3300035410 Bacteria 1728
236 Ga0373935_0046595 3300035692 Bacteria 2739
237 Ga0373935_0262734 3300035692 Bacteria 1211
238 Ga0373935_0851843 3300035692 Bacteria 674
239 Ga0373935_0983764 3300035692 Bacteria 626
240 Ga0373927_0049307 3300035695 Bacteria 2723
241 Ga0373927_0172811 3300035695 Bacteria 1417
242 Ga0373927_0689265 3300035695 Bacteria 675
243 Ga0373933_0002124 3300035724 Bacteria 11384
244 Ga0373933_0031148 3300035724 Bacteria 3093
245 Ga0373933_0087325 3300035724 Bacteria 1921
246 Ga0373947_0138464 3300035725 Bacteria 1559
247 Ga0373947_0226508 3300035725 Bacteria 1230
248 Ga0373947_1144402 3300035725 Bacteria 530
249 Ga0373937_0003385 3300036401 Bacteria 13385
250 Ga0373937_0052401 3300036401 Bacteria 3741
251 Ga0373937_0097936 3300036401 Bacteria 2720
252 Ga0373937_0197834 3300036401 Bacteria 1889
253 Ga0373937_0283675 3300036401 Bacteria 1564
254 Ga0373937_0685927 3300036401 Bacteria 971
255 Ga0373937_0981666 3300036401 Bacteria 793
256 Ga0373925_0079815 3300037068 Bacteria 2487
257 Ga0373925_0237291 3300037068 Bacteria 1459
258 Ga0373925_0668120 3300037068 Bacteria 856
259 Ga0395900_0010650 3300037418 Bacteria 9404
260 Ga0395900_0165626 3300037418 Bacteria 2253
261 Ga0395898_0165440 3300037466 Bacteria 2115
262 Ga0395898_0769015 3300037466 Bacteria 904
263 Ga0395898_1364826 3300037466 Bacteria 637
264 Ga0395898_1679864 3300037466 Bacteria 558
265 Ga0395905_0556985 3300037471 Bacteria 1048
266 Ga0436364_0050215 3300037853 Bacteria 1762
267 Ga0436364_0092884 3300037853 Bacteria 9580
268 Ga0436364_0135611 3300037853 Bacteria 694
269 Ga0436364_1040380 3300037853 Bacteria 1327
270 Ga0436364_1322587 3300037853 Bacteria 4031
271 Ga0395901_0079440 3300038443 Bacteria 3425
272 Ga0395901_0419790 3300038443 Bacteria 1372
273 Ga0436365_0405382 3300039437 Bacteria 706
274 Ga0436365_0470668 3300039437 Bacteria 615
275 Ga0436365_1490329 3300039437 Bacteria 544
276 Ga0436365_1682656 3300039437 Bacteria 2846
277 Ga0436360_0104644 3300039438 Bacteria 1376
278 Ga0436360_0110871 3300039438 Bacteria 573
279 Ga0436360_0122328 3300039438 Bacteria 584
280 Ga0436360_0498074 3300039438 Bacteria 957
281 Ga0436360_0529644 3300039438 Bacteria 788
282 Ga0436360_0877606 3300039438 Unclassified 1739
283 Ga0436360_1134589 3300039438 Bacteria 1458
284 Ga0436360_1189690 3300039438 Bacteria 1003
285 Ga0436360_1299497 3300039438 Bacteria 1439
286 Ga0436361_0063582 3300039447 Bacteria 14694
287 Ga0436361_0103120 3300039447 Bacteria 123137
288 Ga0436361_0125172 3300039447 Bacteria 55027
289 Ga0436361_0126507 3300039447 Bacteria 5965
290 Ga0436361_0171142 3300039447 Bacteria 1223
291 Ga0436361_0243625 3300039447 Bacteria 43518
292 Ga0436361_0280120 3300039447 Bacteria 2696
293 Ga0436361_0404717 3300039447 Bacteria 879
294 Ga0436361_0637202 3300039447 Bacteria 1243
295 Ga0436361_0704599 3300039447 Bacteria 4718
296 Ga0436361_0969683 3300039447 Bacteria 3742
297 Ga0436361_0988569 3300039447 Bacteria 2093
298 Ga0436361_1141666 3300039447 Bacteria 2880
299 Ga0436363_0454500 3300039450 Bacteria 517
300 Ga0436363_1422843 3300039450 Bacteria 2308
301 Ga0436362_0157900 3300039453 Bacteria 4091
302 Ga0436362_0376578 3300039453 Bacteria 1576
303 Ga0439439_0230212 3300041406 Bacteria 545
304 Ga0451793_0940572 3300041452 Bacteria 543
305 Ga0451804_0711345 3300041463 Bacteria 1238
306 Ga0451847_0670262 3300041503 Bacteria 1086
307 Ga0451853_3090298 3300041512 Bacteria 1003
308 Ga0439452_073299 3300042010 Bacteria 752
309 Ga0439459_0053033 3300042438 Bacteria 896
310 Ga0451577_0033417 3300042876 Bacteria 4637
311 Ga0466972_0156413 3300044658 Bacteria 1071
312 Ga0466972_0227067 3300044658 Bacteria 874
313 Ga0453683_0138123 3300044673 Bacteria 1537
314 Ga0453683_0254494 3300044673 Bacteria 1120
315 Ga0466966_0186280 3300044684 Bacteria 1258
316 Ga0466966_0871737 3300044684 Bacteria 543
317 Ga0466966_0936093 3300044684 Bacteria 523
318 Ga0466963_0517691 3300044694 Bacteria 842
319 Ga0453684_0000006 3300044712 Bacteria 1364191
320 Ga0453684_0000048 3300044712 Bacteria 559743
321 Ga0453684_0026787 3300044712 Bacteria 8307
322 Ga0453684_0089208 3300044712 Bacteria 3815
323 Ga0466957_0151177 3300044842 Bacteria 1501
324 Ga0466957_1031613 3300044842 Bacteria 591
325 Ga0466960_0371019 3300044901 Bacteria 820
326 Ga0466959_0067251 3300045049 Bacteria 2598
327 Ga0451576_0000185 3300045051 Bacteria 156955
328 Ga0451576_0001363 3300045051 Bacteria 41988
329 Ga0451576_0016087 3300045051 Bacteria 8263
330 Ga0451576_0019092 3300045051 Bacteria 7492
331 Ga0451576_0809807 3300045051 Bacteria 983
332 Ga0451576_1908864 3300045051 Bacteria 613
333 Ga0466958_0007891 3300045836 Bacteria 5883
334 Ga0466958_0556017 3300045836 Bacteria 746
335 Ga0466967_1477216 3300045976 Bacteria 677
336 Ga0495592_0017138 3300046454 Bacteria 5501
337 Ga0495592_0018365 3300046454 Bacteria 5318
338 Ga0495629_0451070 3300046459 Bacteria 871
339 Ga0495638_0095864 3300046460 Bacteria 1781
340 Ga0495651_0046685 3300046462 Bacteria 3352
341 Ga0495651_0079218 3300046462 Bacteria 2483
342 Ga0495651_0385038 3300046462 Bacteria 919
343 Ga0495653_0083291 3300046463 Bacteria 2359
344 Ga0495664_0028108 3300046477 Bacteria 3283
345 Ga0495664_0126708 3300046477 Bacteria 1545
346 Ga0495664_0166140 3300046477 Bacteria 1339
347 Ga0495664_0318965 3300046477 Bacteria 937
348 Ga0495583_0266459 3300046506 Bacteria 685
349 Ga0495606_0365854 3300046507 Bacteria 761
350 Ga0495608_0012931 3300046511 Bacteria 5794
351 Ga0495608_0013949 3300046511 Bacteria 5577
352 Ga0495608_0459032 3300046511 Bacteria 774
353 Ga0495618_0229637 3300046514 Bacteria 1169
354 Ga0495628_0027672 3300046516 Bacteria 4610
355 Ga0495628_0076511 3300046516 Bacteria 2604
356 Ga0495628_0159504 3300046516 Bacteria 1715
357 Ga0495630_0152403 3300046517 Bacteria 1759
358 Ga0495652_0041617 3300046529 Bacteria 3965
359 Ga0495652_0270856 3300046529 Bacteria 1248
360 Ga0495665_0133064 3300046531 Bacteria 1302
361 Ga0495640_0047722 3300046533 Bacteria 2963
362 Ga0495640_0142706 3300046533 Bacteria 1543
363 Ga0495640_0207943 3300046533 Bacteria 1238
364 Ga0495640_0345295 3300046533 Bacteria 919
365 Ga0495640_0595814 3300046533 Bacteria 668
366 Ga0495587_0037805 3300046536 Bacteria 2896
367 Ga0495587_0224283 3300046536 Bacteria 1059
368 Ga0495645_0014712 3300046543 Bacteria 5556
369 Ga0495667_0037036 3300046559 Bacteria 3253
370 Ga0495667_0041463 3300046559 Bacteria 3053
371 Ga0495667_0071038 3300046559 Bacteria 2271
372 Ga0495634_0311186 3300046642 Bacteria 950
373 Ga0495634_0730639 3300046642 Bacteria 568
374 Ga0495625_0436515 3300046660 Bacteria 811
375 Ga0495635_0149438 3300046663 Bacteria 1590
376 Ga0495635_0421618 3300046663 Bacteria 885
377 Ga0495657_0179467 3300046675 Bacteria 1300
378 Ga0495657_0305742 3300046675 Bacteria 947
379 Ga0495657_0494031 3300046675 Bacteria 714
380 Ga0495599_0041561 3300046678 Bacteria 2886
381 Ga0495599_0379912 3300046678 Bacteria 843
382 Ga0495623_0019153 3300046679 Bacteria 4423
383 Ga0495646_0020102 3300046680 Bacteria 4222
384 Ga0495647_0192541 3300046681 Bacteria 892
385 Ga0495658_0952340 3300046683 Bacteria 548
386 Ga0495649_0331556 3300046694 Bacteria 771
387 Ga0495600_0124576 3300046809 Bacteria 1676
388 Ga0495600_0167277 3300046809 Bacteria 1420
389 Ga0495581_0655983 3300047315 Bacteria 606
390 Ga0495674_0008309 3300047319 Bacteria 9896
391 Ga0495674_0020151 3300047319 Bacteria 6179
392 Ga0495674_0323501 3300047319 Bacteria 1256
393 Ga0495672_0224305 3300047320 Bacteria 926
394 Ga0495680_0075525 3300047322 Bacteria 2557
395 Ga0495680_0555979 3300047322 Bacteria 772
396 Ga0495680_0820007 3300047322 Bacteria 606
397 Ga0495675_0009246 3300047444 Bacteria 6130
398 Ga0495675_0334128 3300047444 Bacteria 894
399 Ga0495681_0348131 3300047470 Bacteria 564
400 Ga0495684_0111124 3300047471 Bacteria 2068
401 Ga0495684_0171552 3300047471 Bacteria 1613
402 Ga0495684_0243495 3300047471 Bacteria 1311
403 Ga0495684_0337820 3300047471 Bacteria 1073
404 Ga0495684_0597427 3300047471 Bacteria 745
405 Ga0495686_0000007 3300047472 Bacteria 732622
406 Ga0495686_0069119 3300047472 Bacteria 2178
407 Ga0495686_0190639 3300047472 Bacteria 1182
408 Ga0495686_0279035 3300047472 Bacteria 929
409 Ga0495593_0551476 3300047673 Bacteria 578
410 Ga0495602_0002111 3300048088 Bacteria 20026
411 Ga0496104_1292811 3300048907 Bacteria 633
412 Ga0496109_0905756 3300048912 Bacteria 820
413 Ga0496117_0392853 3300048920 Bacteria 702
414 Ga0496123_0016522 3300048926 Bacteria 5987
415 Ga0496126_0288350 3300048929 Bacteria 1358
416 Ga0496126_0747680 3300048929 Bacteria 755
417 Ga0501296_086645 3300049519 Bacteria 502
418 Ga0501031_0159593 3300049568 Bacteria 1474
419 Ga0501032_0050576 3300049569 Bacteria 2803
420 Ga0501033_0013716 3300049570 Bacteria 6165
421 Ga0501034_0311533 3300049571 Bacteria 1508
422 Ga0501037_0037844 3300049573 Bacteria 3557
423 Ga0501037_0235266 3300049573 Bacteria 1285
424 Ga0501037_0313471 3300049573 Bacteria 1087
425 Ga0501037_0622594 3300049573 Bacteria 723
426 Ga0501038_0030594 3300049574 Bacteria 4761
427 Ga0501038_0246407 3300049574 Bacteria 1417
428 Ga0501042_1278684 3300049578 Bacteria 535
429 Ga0501043_0003040 3300049579 Bacteria 13945
430 Ga0501043_0264399 3300049579 Bacteria 1322
431 Ga0501046_0124168 3300049580 Bacteria 1962
432 Ga0501047_0268782 3300049581 Bacteria 1551
433 Ga0501048_0121325 3300049582 Bacteria 1847
434 Ga0501068_0263596 3300049584 Bacteria 1099
435 Ga0501068_0469092 3300049584 Bacteria 815
436 Ga0501069_0051530 3300049585 Bacteria 2290
437 Ga0501070_0044270 3300049586 Bacteria 3704
438 Ga0501070_0073755 3300049586 Bacteria 2824
439 Ga0501070_0094368 3300049586 Bacteria 2476
440 Ga0501070_0158295 3300049586 Bacteria 1868
441 Ga0501070_0184027 3300049586 Bacteria 1719
442 Ga0501072_0197698 3300049588 Bacteria 1603
443 Ga0501072_0711727 3300049588 Bacteria 789
444 Ga0501073_0018267 3300049589 Bacteria 5066
445 Ga0501073_0077000 3300049589 Bacteria 2321
446 Ga0501073_0122337 3300049589 Bacteria 1803
447 Ga0501073_0351580 3300049589 Bacteria 1017
448 Ga0501075_0614638 3300049591 Bacteria 829
449 Ga0501075_1173848 3300049591 Bacteria 583
450 Ga0501076_0357062 3300049592 Bacteria 1200
451 Ga0501077_0055600 3300049593 Bacteria 2513
452 Ga0501257_150544 3300049686 Bacteria 641
453 Ga0501079_0202436 3300049741 Bacteria 1551
454 Ga0501079_0596461 3300049741 Bacteria 869
455 Ga0501080_0009386 3300049742 Bacteria 8924
456 Ga0501080_0009530 3300049742 Bacteria 8863
457 Ga0501080_0071481 3300049742 Bacteria 3227
458 Ga0501080_0218977 3300049742 Bacteria 1742
459 Ga0501081_0205453 3300049743 Bacteria 1429
460 Ga0501081_0826266 3300049743 Bacteria 698
461 Ga0501083_0023657 3300049744 Bacteria 4259
462 Ga0501083_0033783 3300049744 Bacteria 3500
463 Ga0501083_0042912 3300049744 Bacteria 3065
464 Ga0501083_0441018 3300049744 Bacteria 847
465 Ga0501035_0039572 3300049822 Bacteria 4266
466 Ga0501035_0119259 3300049822 Bacteria 2308
467 Ga0501035_0230248 3300049822 Bacteria 1579
468 Ga0501035_0391020 3300049822 Bacteria 1158
469 Ga0501035_0459922 3300049822 Bacteria 1052
470 Ga0501035_0553244 3300049822 Bacteria 942
471 Ga0501044_0029283 3300049823 Bacteria 5807
472 Ga0501044_0034594 3300049823 Bacteria 5297
473 Ga0501044_0047808 3300049823 Bacteria 4424
474 Ga0501044_0223212 3300049823 Bacteria 1834
475 Ga0501044_0243435 3300049823 Bacteria 1742
476 Ga0501045_0690819 3300049824 Bacteria 753
477 nmdc:mga03n38_746660_c1 3300050490 Bacteria 567
478 nmdc:mga05p37_2157732_c1 3300050507 Bacteria 519
479 nmdc:mga0qj67_217146_c1 3300050509 Bacteria 1552
480 nmdc:mga08y16_34_c1 3300050511 Bacteria 164092
481 nmdc:mga0rr50_457247_c1 3300050513 Bacteria 1082
482 nmdc:mga08x19_222241_c1 3300050514 Bacteria 1298
483 nmdc:mga0a205_191804_c1 3300050515 Bacteria 1935
484 nmdc:mga0sz30_236205_c1 3300050516 Bacteria 813
485 Ga0495601_0000760 3300053077 Bacteria 17417
486 Ga0495612_0003226 3300053078 Bacteria 6761
487 Ga0495612_0372228 3300053078 Bacteria 647
488 Ga0500635_0003620 3300053080 Bacteria 3903
489 Ga0495619_0039515 3300053085 Bacteria 3081
490 Ga0495619_0324739 3300053085 Bacteria 1065
491 Ga0500578_0272890 3300053086 Bacteria 1011
492 Ga0500643_025043 3300053087 Bacteria 1886
493 Ga0500643_038352 3300053087 Bacteria 1421
494 Ga0500646_0018671 3300053090 Bacteria 1828
495 Ga0500583_0096604 3300053092 Bacteria 1443
496 Ga0500583_0163923 3300053092 Bacteria 1107
497 Ga0500651_0023089 3300053093 Bacteria 3893
498 Ga0500651_0293147 3300053093 Bacteria 935
499 Ga0500641_0022645 3300053096 Bacteria 2408
500 Ga0500650_0372607 3300053098 Bacteria 621
501 Ga0500555_039931 3300053103 Bacteria 1309
502 Ga0500556_0356275 3300053104 Bacteria 566
503 Ga0500562_000043 3300053108 Bacteria 65591
504 Ga0500562_046172 3300053108 Bacteria 1161
505 Ga0500572_016596 3300053111 Bacteria 1879
506 Ga0500594_0018923 3300053118 Bacteria 1702
507 Ga0500595_003746 3300053119 Bacteria 7003
508 Ga0500621_070620 3300053126 Bacteria 1408
509 Ga0500628_043770 3300053129 Bacteria 1034
510 Ga0500642_0001983 3300053130 Bacteria 5942
511 Ga0500642_0365119 3300053130 Bacteria 637
512 Ga0500652_000092 3300053131 Bacteria 37694
513 Ga0500652_198782 3300053131 Bacteria 814
514 Ga0500561_0206876 3300053137 Bacteria 621
515 Ga0500577_0086338 3300053142 Bacteria 1260
516 Ga0500577_0182613 3300053142 Bacteria 900
517 Ga0500588_0014667 3300053146 Bacteria 1991
518 Ga0500604_0021388 3300053151 Bacteria 1828
519 Ga0500604_0270613 3300053151 Bacteria 588
520 Ga0500616_0008973 3300053153 Bacteria 6126
521 Ga0500622_0173634 3300053156 Bacteria 1001
522 Ga0500622_0176829 3300053156 Bacteria 989
523 Ga0500637_0002697 3300053178 Bacteria 7963
524 Ga0500611_056460 3300053727 Bacteria 916
525 Ga0500645_094566 3300053730 Bacteria 846
526 Ga0500609_000265 3300053731 Bacteria 7603
527 Ga0500656_013911 3300053732 Bacteria 926
528 Ga0500599_006324 3300053736 Bacteria 1509
529 Ga0500587_059592 3300053739 Bacteria 582
530 Ga0501084_0066635 3300054114 Bacteria 3013
531 Ga0501084_0317544 3300054114 Bacteria 1316
532 Ga0501084_0352256 3300054114 Bacteria 1244
533 Ga0501084_0482023 3300054114 Bacteria 1048
534 Ga0590071_012592 3300059421 Bacteria 1982
535 Ga0590074_032126 3300059423 Bacteria 929
536 Ga0590075_101237 3300059424 Bacteria 750
537 Ga0587111_0023499 3300060346 Bacteria 1206
538 Ga0501082_0005902 3300060353 Bacteria 10621
539 Ga0501082_1701556 3300060353 Bacteria 550
540 Ga0530510_1131741 3300061734 Bacteria 600

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10400864 Ga0307405_104008642 123
2 iso_pu_bacteria 2842694124 2842698019 123
3 3300041503 Ga0451847_0670262 Ga0451847_0670262_73_447 124
4 3300053732 Ga0500656_013911 Ga0500656_013911_390_764 124
5 iso_pu_bacteria 2739367756 2739792321 124
6 iso_pu_bacteria 2883291878 2883295455 124
7 iso_pu_bacteria 2883354860 2883358317 124
8 iso_pu_bacteria 2929199973 2929203893 124
9 iso_pu_bacteria 8055909800 8055912911 124
10 3300014968 Ga0157379_10559043 Ga0157379_105590432 125
11 3300048920 Ga0496117_0392853 Ga0496117_0392853_53_436 125
12 3300048926 Ga0496123_0016522 Ga0496123_0016522_2665_3048 125
13 3300003203 JGI25406J46586_10024513 JGI25406J46586_100245133 126
14 3300003373 JGI25407J50210_10047793 JGI25407J50210_100477932 126
15 3300003763 Ga0055529_1008570 Ga0055529_10085702 126
16 3300003781 Ga0055536_1007565 Ga0055536_10075653 126
17 3300003791 Ga0055530_10042925 Ga0055530_100429251 126
18 3300003794 Ga0055531_10021121 Ga0055531_100211213 126
19 3300005295 Ga0065707_10137685 Ga0065707_101376852 126
20 3300005328 Ga0070676_11272470 Ga0070676_112724701 126
21 3300005335 Ga0070666_10004175 Ga0070666_100041755 126
22 3300005336 Ga0070680_100090643 Ga0070680_1000906433 126
23 3300005336 Ga0070680_100952534 Ga0070680_1009525341 126
24 3300005353 Ga0070669_100029162 Ga0070669_1000291625 126
25 3300005356 Ga0070674_100055959 Ga0070674_1000559593 126
26 3300005367 Ga0070667_100058865 Ga0070667_1000588653 126
27 3300005434 Ga0070709_10041505 Ga0070709_100415051 126
28 3300005435 Ga0070714_100000273 Ga0070714_10000027327 126
29 3300005435 Ga0070714_100014245 Ga0070714_1000142452 126
30 3300005435 Ga0070714_100147171 Ga0070714_1001471712 126
31 3300005435 Ga0070714_100320191 Ga0070714_1003201912 126
32 3300005436 Ga0070713_100067707 Ga0070713_1000677072 126
33 3300005436 Ga0070713_100213278 Ga0070713_1002132782 126
34 3300005436 Ga0070713_100332529 Ga0070713_1003325292 126
35 3300005437 Ga0070710_10021501 Ga0070710_100215015 126
36 3300005439 Ga0070711_100007003 Ga0070711_1000070035 126
37 3300005441 Ga0070700_100179241 Ga0070700_1001792411 126
38 3300005445 Ga0070708_100288745 Ga0070708_1002887451 126
39 3300005456 Ga0070678_100006363 Ga0070678_1000063632 126
40 3300005456 Ga0070678_101017862 Ga0070678_1010178621 126
41 3300005458 Ga0070681_10570758 Ga0070681_105707582 126
42 3300005458 Ga0070681_11055268 Ga0070681_110552681 126
43 3300005459 Ga0068867_100197453 Ga0068867_1001974532 126
44 3300005536 Ga0070697_101992203 Ga0070697_1019922031 126
45 3300005539 Ga0068853_101190243 Ga0068853_1011902431 126
46 3300005546 Ga0070696_100187037 Ga0070696_1001870372 126
47 3300005546 Ga0070696_100352809 Ga0070696_1003528092 126
48 3300005547 Ga0070693_100133796 Ga0070693_1001337962 126
49 3300005547 Ga0070693_101531129 Ga0070693_1015311291 126
50 3300005548 Ga0070665_100125601 Ga0070665_1001256013 126
51 3300005548 Ga0070665_100822750 Ga0070665_1008227502 126
52 3300005563 Ga0068855_100165312 Ga0068855_1001653122 126
53 3300005563 Ga0068855_100262706 Ga0068855_1002627062 126
54 3300005563 Ga0068855_101027073 Ga0068855_1010270732 126
55 3300005577 Ga0068857_100408709 Ga0068857_1004087092 126
56 3300005614 Ga0068856_100092353 Ga0068856_1000923532 126
57 3300005614 Ga0068856_100140421 Ga0068856_1001404213 126
58 3300005616 Ga0068852_100697526 Ga0068852_1006975262 126
59 3300005617 Ga0068859_100450535 Ga0068859_1004505352 126
60 3300005718 Ga0068866_10199070 Ga0068866_101990702 126
61 3300005719 Ga0068861_100005476 Ga0068861_1000054762 126
62 3300005841 Ga0068863_101378333 Ga0068863_1013783331 126
63 3300005843 Ga0068860_100954187 Ga0068860_1009541872 126
64 3300005844 Ga0068862_100070984 Ga0068862_1000709843 126
65 3300005844 Ga0068862_100254758 Ga0068862_1002547582 126
66 3300005937 Ga0081455_10076545 Ga0081455_100765452 126
67 3300005981 Ga0081538_10004235 Ga0081538_1000423511 126
68 3300005983 Ga0081540_1108832 Ga0081540_11088322 126
69 3300005985 Ga0081539_10000054 Ga0081539_1000005430 126
70 3300005985 Ga0081539_10055738 Ga0081539_100557382 126
71 3300006028 Ga0070717_10066227 Ga0070717_100662273 126
72 3300006028 Ga0070717_10323580 Ga0070717_103235802 126
73 3300006028 Ga0070717_10361951 Ga0070717_103619512 126
74 3300006028 Ga0070717_10780386 Ga0070717_107803862 126
75 3300006028 Ga0070717_10790860 Ga0070717_107908602 126
76 3300006028 Ga0070717_10851299 Ga0070717_108512992 126
77 3300006175 Ga0070712_100113849 Ga0070712_1001138492 126
78 3300006175 Ga0070712_100954712 Ga0070712_1009547121 126
79 3300006186 Ga0075369_10144415 Ga0075369_101444152 126
80 3300006195 Ga0075366_10298920 Ga0075366_102989202 126
81 3300006195 Ga0075366_10412273 Ga0075366_104122732 126
82 3300006844 Ga0075428_100738641 Ga0075428_1007386412 126
83 3300006846 Ga0075430_100474761 Ga0075430_1004747612 126
84 3300006847 Ga0075431_100374468 Ga0075431_1003744682 126
85 3300006881 Ga0068865_100150331 Ga0068865_1001503312 126
86 3300006914 Ga0075436_100362718 Ga0075436_1003627182 126
87 3300006931 Ga0097620_100450545 Ga0097620_1004505452 126
88 3300007076 Ga0075435_101510859 Ga0075435_1015108591 126
89 3300009094 Ga0111539_10000279 Ga0111539_1000027955 126
90 3300009094 Ga0111539_10737055 Ga0111539_107370552 126
91 3300009101 Ga0105247_10458838 Ga0105247_104588382 126
92 3300009101 Ga0105247_10520004 Ga0105247_105200041 126
93 3300009101 Ga0105247_11462460 Ga0105247_114624601 126
94 3300009147 Ga0114129_10453808 Ga0114129_104538082 126
95 3300009177 Ga0105248_10189060 Ga0105248_101890602 126
96 3300009177 Ga0105248_10526595 Ga0105248_105265951 126
97 3300009545 Ga0105237_10206726 Ga0105237_102067262 126
98 3300009551 Ga0105238_10740690 Ga0105238_107406902 126
99 3300009553 Ga0105249_10268144 Ga0105249_102681442 126
100 3300009553 Ga0105249_11956418 Ga0105249_119564182 126
101 3300009978 Ga0105148_109079 Ga0105148_1090792 126
102 3300010375 Ga0105239_10892503 Ga0105239_108925032 126
103 3300013104 Ga0157370_11443112 Ga0157370_114431121 126
104 3300013296 Ga0157374_10142353 Ga0157374_101423532 126
105 3300013296 Ga0157374_10942529 Ga0157374_109425292 126
106 3300013296 Ga0157374_11542254 Ga0157374_115422541 126
107 3300013297 Ga0157378_10322811 Ga0157378_103228112 126
108 3300013306 Ga0163162_10817891 Ga0163162_108178912 126
109 3300013306 Ga0163162_11324218 Ga0163162_113242182 126
110 3300013307 Ga0157372_10995984 Ga0157372_109959842 126
111 3300013307 Ga0157372_11186931 Ga0157372_111869312 126
112 3300013307 Ga0157372_11360163 Ga0157372_113601631 126
113 3300013308 Ga0157375_10907302 Ga0157375_109073022 126
114 3300014325 Ga0163163_10057382 Ga0163163_100573823 126
115 3300014325 Ga0163163_12294769 Ga0163163_122947691 126
116 3300014326 Ga0157380_10090696 Ga0157380_100906964 126
117 3300014326 Ga0157380_10119267 Ga0157380_101192672 126
118 3300014497 Ga0182008_10131389 Ga0182008_101313892 126
119 3300014497 Ga0182008_10400643 Ga0182008_104006432 126
120 3300014969 Ga0157376_10644302 Ga0157376_106443022 126
121 3300014969 Ga0157376_10676543 Ga0157376_106765432 126
122 3300021361 Ga0213872_10000084 Ga0213872_1000008443 126
123 3300021361 Ga0213872_10000779 Ga0213872_1000077911 126
124 3300021361 Ga0213872_10001414 Ga0213872_1000141413 126
125 3300021361 Ga0213872_10041193 Ga0213872_100411932 126
126 3300021361 Ga0213872_10063401 Ga0213872_100634012 126
127 3300021361 Ga0213872_10071241 Ga0213872_100712412 126
128 3300021361 Ga0213872_10138800 Ga0213872_101388002 126
129 3300021361 Ga0213872_10183941 Ga0213872_101839411 126
130 3300021361 Ga0213872_10215765 Ga0213872_102157652 126
131 3300021361 Ga0213872_10276102 Ga0213872_102761021 126
132 3300021377 Ga0213874_10071195 Ga0213874_100711952 126
133 3300021384 Ga0213876_10092976 Ga0213876_100929763 126
134 3300021388 Ga0213875_10047259 Ga0213875_100472593 126
135 3300021441 Ga0213871_10094538 Ga0213871_100945382 126
136 3300021441 Ga0213871_10253986 Ga0213871_102539861 126
137 3300025254 Ga0209148_1000425 Ga0209148_100042533 126
138 3300025272 Ga0209455_1000468 Ga0209455_10004685 126
139 3300025291 Ga0209675_1009860 Ga0209675_10098602 126
140 3300025292 Ga0209676_1000019 Ga0209676_1000019338 126
141 3300025292 Ga0209676_1006495 Ga0209676_10064956 126
142 3300025297 Ga0209758_1000119 Ga0209758_100011930 126
143 3300025297 Ga0209758_1027820 Ga0209758_10278203 126
144 3300025298 Ga0209050_1003841 Ga0209050_100384111 126
145 3300025298 Ga0209050_1113990 Ga0209050_11139901 126
146 3300025304 Ga0209257_1000301 Ga0209257_100030110 126
147 3300025898 Ga0207692_10069543 Ga0207692_100695432 126
148 3300025900 Ga0207710_10487501 Ga0207710_104875011 126
149 3300025903 Ga0207680_10543216 Ga0207680_105432161 126
150 3300025914 Ga0207671_10381940 Ga0207671_103819401 126
151 3300025915 Ga0207693_10312076 Ga0207693_103120761 126
152 3300025917 Ga0207660_10237893 Ga0207660_102378932 126
153 3300025917 Ga0207660_10837879 Ga0207660_108378792 126
154 3300025921 Ga0207652_10043894 Ga0207652_100438942 126
155 3300025923 Ga0207681_10013805 Ga0207681_100138052 126
156 3300025924 Ga0207694_10797721 Ga0207694_107977212 126
157 3300025924 Ga0207694_10844579 Ga0207694_108445792 126
158 3300025927 Ga0207687_10640805 Ga0207687_106408052 126
159 3300025928 Ga0207700_10020209 Ga0207700_100202092 126
160 3300025928 Ga0207700_10148191 Ga0207700_101481912 126
161 3300025928 Ga0207700_10535078 Ga0207700_105350782 126
162 3300025929 Ga0207664_10007141 Ga0207664_100071412 126
163 3300025929 Ga0207664_10031965 Ga0207664_100319654 126
164 3300025929 Ga0207664_10576859 Ga0207664_105768592 126
165 3300025929 Ga0207664_10766716 Ga0207664_107667162 126
166 3300025929 Ga0207664_11857443 Ga0207664_118574431 126
167 3300025931 Ga0207644_10777917 Ga0207644_107779172 126
168 3300025937 Ga0207669_10034423 Ga0207669_100344232 126
169 3300025937 Ga0207669_10399038 Ga0207669_103990382 126
170 3300025937 Ga0207669_11933794 Ga0207669_119337941 126
171 3300025938 Ga0207704_10176364 Ga0207704_101763643 126
172 3300025941 Ga0207711_10122678 Ga0207711_101226782 126
173 3300025942 Ga0207689_10569792 Ga0207689_105697922 126
174 3300025949 Ga0207667_10121342 Ga0207667_101213422 126
175 3300025949 Ga0207667_10361708 Ga0207667_103617082 126
176 3300025986 Ga0207658_10044564 Ga0207658_100445643 126
177 3300026035 Ga0207703_11817666 Ga0207703_118176662 126
178 3300026041 Ga0207639_10626387 Ga0207639_106263871 126
179 3300026075 Ga0207708_10125834 Ga0207708_101258343 126
180 3300026078 Ga0207702_10171200 Ga0207702_101712004 126
181 3300026078 Ga0207702_10653106 Ga0207702_106531062 126
182 3300026088 Ga0207641_10652177 Ga0207641_106521773 126
183 3300026116 Ga0207674_10357675 Ga0207674_103576752 126
184 3300026118 Ga0207675_100029377 Ga0207675_1000293772 126
185 3300026121 Ga0207683_10040979 Ga0207683_100409792 126
186 3300026142 Ga0207698_10625222 Ga0207698_106252222 126
187 3300027907 Ga0207428_10000153 Ga0207428_1000015325 126
188 3300028379 Ga0268266_10398378 Ga0268266_103983781 126
189 3300028379 Ga0268266_10709814 Ga0268266_107098142 126
190 3300028380 Ga0268265_10001529 Ga0268265_100015295 126
191 3300028380 Ga0268265_10604423 Ga0268265_106044232 126
192 3300028380 Ga0268265_10622452 Ga0268265_106224522 126
193 3300028381 Ga0268264_10825967 Ga0268264_108259671 126
194 3300028381 Ga0268264_11467860 Ga0268264_114678601 126
195 3300028577 Ga0265318_10198661 Ga0265318_101986611 126
196 3300028786 Ga0307517_10067056 Ga0307517_100670564 126
197 3300028786 Ga0307517_10172098 Ga0307517_101720981 126
198 3300028794 Ga0307515_10174233 Ga0307515_101742332 126
199 3300028800 Ga0265338_10118871 Ga0265338_101188712 126
200 3300028800 Ga0265338_10212416 Ga0265338_102124162 126
201 3300031239 Ga0265328_10004011 Ga0265328_100040115 126
202 3300031239 Ga0265328_10073609 Ga0265328_100736092 126
203 3300031240 Ga0265320_10001466 Ga0265320_1000146615 126
204 3300031240 Ga0265320_10051078 Ga0265320_100510783 126
205 3300031241 Ga0265325_10014559 Ga0265325_100145593 126
206 3300031241 Ga0265325_10264640 Ga0265325_102646401 126
207 3300031250 Ga0265331_10000156 Ga0265331_1000015664 126
208 3300031250 Ga0265331_10000667 Ga0265331_1000066737 126
209 3300031251 Ga0265327_10000100 Ga0265327_10000100136 126
210 3300031251 Ga0265327_10333473 Ga0265327_103334731 126
211 3300031456 Ga0307513_10021763 Ga0307513_100217635 126
212 3300031456 Ga0307513_10212930 Ga0307513_102129303 126
213 3300031548 Ga0307408_100266460 Ga0307408_1002664602 126
214 3300031595 Ga0265313_10000140 Ga0265313_100001404 126
215 3300031595 Ga0265313_10000296 Ga0265313_100002962 126
216 3300031595 Ga0265313_10022264 Ga0265313_100222643 126
217 3300031711 Ga0265314_10009618 Ga0265314_100096182 126
218 3300031730 Ga0307516_10157422 Ga0307516_101574222 126
219 3300031824 Ga0307413_10141298 Ga0307413_101412982 126
220 3300031824 Ga0307413_11146189 Ga0307413_111461892 126
221 3300031852 Ga0307410_10023847 Ga0307410_100238473 126
222 3300031995 Ga0307409_100044270 Ga0307409_1000442704 126
223 3300031995 Ga0307409_101431557 Ga0307409_1014315572 126
224 3300032002 Ga0307416_101224879 Ga0307416_1012248792 126
225 3300032005 Ga0307411_10033846 Ga0307411_100338463 126
226 3300032005 Ga0307411_12087606 Ga0307411_120876062 126
227 3300032126 Ga0307415_100432034 Ga0307415_1004320342 126
228 3300032126 Ga0307415_100733840 Ga0307415_1007338402 126
229 3300033179 Ga0307507_10141250 Ga0307507_101412501 126
230 3300033180 Ga0307510_10453875 Ga0307510_104538751 126
231 3300035086 Ga0373934_0103592 Ga0373934_0103592_378_764 126
232 3300035111 Ga0373923_0043699 Ga0373923_0043699_407_793 126
233 3300035113 Ga0373936_0032841 Ga0373936_0032841_525_911 126
234 3300035113 Ga0373936_0601946 Ga0373936_0601946_118_504 126
235 3300035116 Ga0373945_0033298 Ga0373945_0033298_906_1292 126
236 3300035116 Ga0373945_0313322 Ga0373945_0313322_223_609 126
237 3300035117 Ga0373953_0047795 Ga0373953_0047795_501_887 126
238 3300035118 Ga0373954_0177256 Ga0373954_0177256_42_428 126
239 3300035170 Ga0373943_0762545 Ga0373943_0762545_178_564 126
240 3300035171 Ga0373946_0062935 Ga0373946_0062935_767_1153 126
241 3300035172 Ga0373955_0066028 Ga0373955_0066028_290_676 126
242 3300035172 Ga0373955_0403721 Ga0373955_0403721_194_580 126
243 3300035398 Ga0316574_0348215 Ga0316574_0348215_508_894 126
244 3300035410 Ga0373924_0046705 Ga0373924_0046705_388_774 126
245 3300035410 Ga0373924_0050166 Ga0373924_0050166_1195_1581 126
246 3300035692 Ga0373935_0046595 Ga0373935_0046595_837_1223 126
247 3300035692 Ga0373935_0262734 Ga0373935_0262734_764_1150 126
248 3300035692 Ga0373935_0851843 Ga0373935_0851843_254_640 126
249 3300035692 Ga0373935_0983764 Ga0373935_0983764_195_581 126
250 3300035695 Ga0373927_0049307 Ga0373927_0049307_1555_1941 126
251 3300035695 Ga0373927_0172811 Ga0373927_0172811_812_1198 126
252 3300035695 Ga0373927_0689265 Ga0373927_0689265_111_497 126
253 3300035724 Ga0373933_0002124 Ga0373933_0002124_3649_4035 126
254 3300035724 Ga0373933_0031148 Ga0373933_0031148_1637_2023 126
255 3300035724 Ga0373933_0087325 Ga0373933_0087325_262_648 126
256 3300035725 Ga0373947_0138464 Ga0373947_0138464_1124_1510 126
257 3300035725 Ga0373947_0226508 Ga0373947_0226508_571_957 126
258 3300035725 Ga0373947_1144402 Ga0373947_1144402_119_505 126
259 3300036401 Ga0373937_0003385 Ga0373937_0003385_8755_9141 126
260 3300036401 Ga0373937_0052401 Ga0373937_0052401_3218_3604 126
261 3300036401 Ga0373937_0097936 Ga0373937_0097936_194_580 126
262 3300036401 Ga0373937_0197834 Ga0373937_0197834_372_758 126
263 3300036401 Ga0373937_0283675 Ga0373937_0283675_1047_1433 126
264 3300036401 Ga0373937_0685927 Ga0373937_0685927_416_802 126
265 3300036401 Ga0373937_0981666 Ga0373937_0981666_256_642 126
266 3300037068 Ga0373925_0079815 Ga0373925_0079815_698_1084 126
267 3300037068 Ga0373925_0237291 Ga0373925_0237291_1018_1404 126
268 3300037068 Ga0373925_0668120 Ga0373925_0668120_198_584 126
269 3300037418 Ga0395900_0010650 Ga0395900_0010650_5708_6097 126
270 3300037418 Ga0395900_0165626 Ga0395900_0165626_1053_1442 126
271 3300037466 Ga0395898_0165440 Ga0395898_0165440_644_1033 126
272 3300037466 Ga0395898_0769015 Ga0395898_0769015_265_651 126
273 3300037466 Ga0395898_1364826 Ga0395898_1364826_19_405 126
274 3300037466 Ga0395898_1679864 Ga0395898_1679864_97_486 126
275 3300037471 Ga0395905_0556985 Ga0395905_0556985_68_454 126
276 3300037853 Ga0436364_0050215 Ga0436364_0050215_956_1342 126
277 3300037853 Ga0436364_0092884 Ga0436364_0092884_8866_9252 126
278 3300037853 Ga0436364_0135611 Ga0436364_0135611_38_424 126
279 3300037853 Ga0436364_1040380 Ga0436364_1040380_895_1275 126
280 3300037853 Ga0436364_1322587 Ga0436364_1322587_2177_2560 126
281 3300038443 Ga0395901_0079440 Ga0395901_0079440_1040_1429 126
282 3300038443 Ga0395901_0419790 Ga0395901_0419790_877_1263 126
283 3300039437 Ga0436365_0405382 Ga0436365_0405382_64_453 126
284 3300039437 Ga0436365_0470668 Ga0436365_0470668_12_398 126
285 3300039437 Ga0436365_1490329 Ga0436365_1490329_35_421 126
286 3300039437 Ga0436365_1682656 Ga0436365_1682656_958_1344 126
287 3300039438 Ga0436360_0104644 Ga0436360_0104644_126_569 126
288 3300039438 Ga0436360_0110871 Ga0436360_0110871_10_396 126
289 3300039438 Ga0436360_0122328 Ga0436360_0122328_127_507 126
290 3300039438 Ga0436360_0498074 Ga0436360_0498074_80_460 126
291 3300039438 Ga0436360_0529644 Ga0436360_0529644_263_649 126
292 3300039438 Ga0436360_0877606 Ga0436360_0877606_1121_1507 126
293 3300039438 Ga0436360_1134589 Ga0436360_1134589_505_885 126
294 3300039438 Ga0436360_1189690 Ga0436360_1189690_238_624 126
295 3300039438 Ga0436360_1299497 Ga0436360_1299497_557_943 126
296 3300039447 Ga0436361_0063582 Ga0436361_0063582_180_566 126
297 3300039447 Ga0436361_0103120 Ga0436361_0103120_38893_39279 126
298 3300039447 Ga0436361_0125172 Ga0436361_0125172_6379_6765 126
299 3300039447 Ga0436361_0126507 Ga0436361_0126507_2200_2598 126
300 3300039447 Ga0436361_0171142 Ga0436361_0171142_619_1005 126
301 3300039447 Ga0436361_0243625 Ga0436361_0243625_2570_2956 126
302 3300039447 Ga0436361_0280120 Ga0436361_0280120_1672_2058 126
303 3300039447 Ga0436361_0404717 Ga0436361_0404717_418_816 126
304 3300039447 Ga0436361_0637202 Ga0436361_0637202_678_1064 126
305 3300039447 Ga0436361_0704599 Ga0436361_0704599_1051_1437 126
306 3300039447 Ga0436361_0969683 Ga0436361_0969683_2231_2617 126
307 3300039447 Ga0436361_0988569 Ga0436361_0988569_1427_1813 126
308 3300039447 Ga0436361_1141666 Ga0436361_1141666_1918_2304 126
309 3300039450 Ga0436363_0454500 Ga0436363_0454500_50_436 126
310 3300039450 Ga0436363_1422843 Ga0436363_1422843_500_886 126
311 3300039453 Ga0436362_0157900 Ga0436362_0157900_30_416 126
312 3300039453 Ga0436362_0376578 Ga0436362_0376578_895_1281 126
313 3300041406 Ga0439439_0230212 Ga0439439_0230212_137_523 126
314 3300041452 Ga0451793_0940572 Ga0451793_0940572_105_500 126
315 3300041463 Ga0451804_0711345 Ga0451804_0711345_403_789 126
316 3300041512 Ga0451853_3090298 Ga0451853_3090298_293_679 126
317 3300042010 Ga0439452_073299 Ga0439452_073299_136_522 126
318 3300042438 Ga0439459_0053033 Ga0439459_0053033_224_610 126
319 3300042876 Ga0451577_0033417 Ga0451577_0033417_961_1347 126
320 3300044658 Ga0466972_0156413 Ga0466972_0156413_30_416 126
321 3300044658 Ga0466972_0227067 Ga0466972_0227067_75_461 126
322 3300044673 Ga0453683_0138123 Ga0453683_0138123_524_913 126
323 3300044673 Ga0453683_0254494 Ga0453683_0254494_80_469 126
324 3300044684 Ga0466966_0186280 Ga0466966_0186280_416_802 126
325 3300044684 Ga0466966_0871737 Ga0466966_0871737_95_475 126
326 3300044684 Ga0466966_0936093 Ga0466966_0936093_85_465 126
327 3300044694 Ga0466963_0517691 Ga0466963_0517691_391_777 126
328 3300044712 Ga0453684_0000006 Ga0453684_0000006_1287382_1287768 126
329 3300044712 Ga0453684_0000048 Ga0453684_0000048_254129_254515 126
330 3300044712 Ga0453684_0026787 Ga0453684_0026787_6092_6478 126
331 3300044712 Ga0453684_0089208 Ga0453684_0089208_980_1366 126
332 3300044842 Ga0466957_0151177 Ga0466957_0151177_482_868 126
333 3300044842 Ga0466957_1031613 Ga0466957_1031613_44_430 126
334 3300044901 Ga0466960_0371019 Ga0466960_0371019_36_416 126
335 3300045049 Ga0466959_0067251 Ga0466959_0067251_1562_1948 126
336 3300045051 Ga0451576_0000185 Ga0451576_0000185_45126_45512 126
337 3300045051 Ga0451576_0001363 Ga0451576_0001363_40599_40979 126
338 3300045051 Ga0451576_0016087 Ga0451576_0016087_652_1041 126
339 3300045051 Ga0451576_0019092 Ga0451576_0019092_7024_7413 126
340 3300045051 Ga0451576_0809807 Ga0451576_0809807_577_966 126
341 3300045051 Ga0451576_1908864 Ga0451576_1908864_203_589 126
342 3300045836 Ga0466958_0007891 Ga0466958_0007891_4861_5247 126
343 3300045836 Ga0466958_0556017 Ga0466958_0556017_235_615 126
344 3300045976 Ga0466967_1477216 Ga0466967_1477216_242_628 126
345 3300046454 Ga0495592_0017138 Ga0495592_0017138_2644_3030 126
346 3300046454 Ga0495592_0018365 Ga0495592_0018365_4164_4550 126
347 3300046459 Ga0495629_0451070 Ga0495629_0451070_303_689 126
348 3300046460 Ga0495638_0095864 Ga0495638_0095864_376_762 126
349 3300046462 Ga0495651_0046685 Ga0495651_0046685_118_504 126
350 3300046462 Ga0495651_0079218 Ga0495651_0079218_534_920 126
351 3300046462 Ga0495651_0385038 Ga0495651_0385038_181_567 126
352 3300046463 Ga0495653_0083291 Ga0495653_0083291_1002_1388 126
353 3300046477 Ga0495664_0028108 Ga0495664_0028108_1071_1457 126
354 3300046477 Ga0495664_0126708 Ga0495664_0126708_374_760 126
355 3300046477 Ga0495664_0166140 Ga0495664_0166140_350_733 126
356 3300046477 Ga0495664_0318965 Ga0495664_0318965_443_829 126
357 3300046506 Ga0495583_0266459 Ga0495583_0266459_71_457 126
358 3300046507 Ga0495606_0365854 Ga0495606_0365854_57_443 126
359 3300046511 Ga0495608_0012931 Ga0495608_0012931_4125_4511 126
360 3300046511 Ga0495608_0013949 Ga0495608_0013949_2845_3231 126
361 3300046511 Ga0495608_0459032 Ga0495608_0459032_208_594 126
362 3300046514 Ga0495618_0229637 Ga0495618_0229637_462_869 126
363 3300046516 Ga0495628_0027672 Ga0495628_0027672_2206_2592 126
364 3300046516 Ga0495628_0076511 Ga0495628_0076511_822_1208 126
365 3300046516 Ga0495628_0159504 Ga0495628_0159504_755_1141 126
366 3300046517 Ga0495630_0152403 Ga0495630_0152403_174_560 126
367 3300046529 Ga0495652_0041617 Ga0495652_0041617_1937_2323 126
368 3300046529 Ga0495652_0270856 Ga0495652_0270856_657_1043 126
369 3300046531 Ga0495665_0133064 Ga0495665_0133064_617_1003 126
370 3300046533 Ga0495640_0047722 Ga0495640_0047722_1703_2089 126
371 3300046533 Ga0495640_0142706 Ga0495640_0142706_841_1227 126
372 3300046533 Ga0495640_0207943 Ga0495640_0207943_526_909 126
373 3300046533 Ga0495640_0345295 Ga0495640_0345295_294_680 126
374 3300046533 Ga0495640_0595814 Ga0495640_0595814_265_651 126
375 3300046536 Ga0495587_0037805 Ga0495587_0037805_465_851 126
376 3300046536 Ga0495587_0224283 Ga0495587_0224283_439_825 126
377 3300046543 Ga0495645_0014712 Ga0495645_0014712_2780_3166 126
378 3300046559 Ga0495667_0037036 Ga0495667_0037036_2339_2725 126
379 3300046559 Ga0495667_0041463 Ga0495667_0041463_737_1123 126
380 3300046559 Ga0495667_0071038 Ga0495667_0071038_99_482 126
381 3300046642 Ga0495634_0311186 Ga0495634_0311186_355_741 126
382 3300046642 Ga0495634_0730639 Ga0495634_0730639_83_469 126
383 3300046660 Ga0495625_0436515 Ga0495625_0436515_244_630 126
384 3300046663 Ga0495635_0149438 Ga0495635_0149438_471_857 126
385 3300046663 Ga0495635_0421618 Ga0495635_0421618_92_475 126
386 3300046675 Ga0495657_0179467 Ga0495657_0179467_215_601 126
387 3300046675 Ga0495657_0305742 Ga0495657_0305742_37_423 126
388 3300046675 Ga0495657_0494031 Ga0495657_0494031_210_593 126
389 3300046678 Ga0495599_0041561 Ga0495599_0041561_995_1381 126
390 3300046678 Ga0495599_0379912 Ga0495599_0379912_379_765 126
391 3300046679 Ga0495623_0019153 Ga0495623_0019153_1421_1807 126
392 3300046680 Ga0495646_0020102 Ga0495646_0020102_717_1103 126
393 3300046681 Ga0495647_0192541 Ga0495647_0192541_102_488 126
394 3300046683 Ga0495658_0952340 Ga0495658_0952340_151_537 126
395 3300046694 Ga0495649_0331556 Ga0495649_0331556_370_756 126
396 3300046809 Ga0495600_0124576 Ga0495600_0124576_1209_1595 126
397 3300046809 Ga0495600_0167277 Ga0495600_0167277_910_1296 126
398 3300047315 Ga0495581_0655983 Ga0495581_0655983_60_446 126
399 3300047319 Ga0495674_0008309 Ga0495674_0008309_3995_4381 126
400 3300047319 Ga0495674_0020151 Ga0495674_0020151_3002_3388 126
401 3300047319 Ga0495674_0323501 Ga0495674_0323501_838_1224 126
402 3300047320 Ga0495672_0224305 Ga0495672_0224305_13_399 126
403 3300047322 Ga0495680_0075525 Ga0495680_0075525_626_1012 126
404 3300047322 Ga0495680_0555979 Ga0495680_0555979_266_652 126
405 3300047322 Ga0495680_0820007 Ga0495680_0820007_135_521 126
406 3300047444 Ga0495675_0009246 Ga0495675_0009246_2062_2448 126
407 3300047444 Ga0495675_0334128 Ga0495675_0334128_376_762 126
408 3300047470 Ga0495681_0348131 Ga0495681_0348131_52_438 126
409 3300047471 Ga0495684_0111124 Ga0495684_0111124_417_803 126
410 3300047471 Ga0495684_0171552 Ga0495684_0171552_428_811 126
411 3300047471 Ga0495684_0243495 Ga0495684_0243495_596_982 126
412 3300047471 Ga0495684_0337820 Ga0495684_0337820_168_554 126
413 3300047471 Ga0495684_0597427 Ga0495684_0597427_336_722 126
414 3300047472 Ga0495686_0000007 Ga0495686_0000007_619963_620355 126
415 3300047472 Ga0495686_0069119 Ga0495686_0069119_1432_1824 126
416 3300047472 Ga0495686_0190639 Ga0495686_0190639_690_1082 126
417 3300047472 Ga0495686_0279035 Ga0495686_0279035_470_856 126
418 3300047673 Ga0495593_0551476 Ga0495593_0551476_86_472 126
419 3300048088 Ga0495602_0002111 Ga0495602_0002111_3885_4271 126
420 3300048907 Ga0496104_1292811 Ga0496104_1292811_180_566 126
421 3300048912 Ga0496109_0905756 Ga0496109_0905756_314_700 126
422 3300048929 Ga0496126_0288350 Ga0496126_0288350_291_677 126
423 3300048929 Ga0496126_0747680 Ga0496126_0747680_278_709 126
424 3300049519 Ga0501296_086645 Ga0501296_086645_42_479 126
425 3300049568 Ga0501031_0159593 Ga0501031_0159593_415_876 126
426 3300049569 Ga0501032_0050576 Ga0501032_0050576_1589_1975 126
427 3300049570 Ga0501033_0013716 Ga0501033_0013716_4870_5331 126
428 3300049571 Ga0501034_0311533 Ga0501034_0311533_148_534 126
429 3300049573 Ga0501037_0037844 Ga0501037_0037844_1337_1798 126
430 3300049573 Ga0501037_0235266 Ga0501037_0235266_586_975 126
431 3300049573 Ga0501037_0313471 Ga0501037_0313471_512_898 126
432 3300049573 Ga0501037_0622594 Ga0501037_0622594_289_675 126
433 3300049574 Ga0501038_0030594 Ga0501038_0030594_776_1237 126
434 3300049574 Ga0501038_0246407 Ga0501038_0246407_814_1260 126
435 3300049578 Ga0501042_1278684 Ga0501042_1278684_21_407 126
436 3300049579 Ga0501043_0003040 Ga0501043_0003040_719_1180 126
437 3300049579 Ga0501043_0264399 Ga0501043_0264399_288_674 126
438 3300049580 Ga0501046_0124168 Ga0501046_0124168_818_1279 126
439 3300049581 Ga0501047_0268782 Ga0501047_0268782_320_781 126
440 3300049582 Ga0501048_0121325 Ga0501048_0121325_31_492 126
441 3300049584 Ga0501068_0263596 Ga0501068_0263596_122_583 126
442 3300049584 Ga0501068_0469092 Ga0501068_0469092_362_748 126
443 3300049585 Ga0501069_0051530 Ga0501069_0051530_880_1341 126
444 3300049586 Ga0501070_0044270 Ga0501070_0044270_548_1009 126
445 3300049586 Ga0501070_0073755 Ga0501070_0073755_1008_1394 126
446 3300049586 Ga0501070_0094368 Ga0501070_0094368_1747_2133 126
447 3300049586 Ga0501070_0158295 Ga0501070_0158295_1003_1392 126
448 3300049586 Ga0501070_0184027 Ga0501070_0184027_48_434 126
449 3300049588 Ga0501072_0197698 Ga0501072_0197698_243_629 126
450 3300049588 Ga0501072_0711727 Ga0501072_0711727_15_401 126
451 3300049589 Ga0501073_0018267 Ga0501073_0018267_4322_4783 126
452 3300049589 Ga0501073_0077000 Ga0501073_0077000_514_900 126
453 3300049589 Ga0501073_0122337 Ga0501073_0122337_876_1262 126
454 3300049589 Ga0501073_0351580 Ga0501073_0351580_498_884 126
455 3300049591 Ga0501075_0614638 Ga0501075_0614638_25_411 126
456 3300049591 Ga0501075_1173848 Ga0501075_1173848_69_500 126
457 3300049592 Ga0501076_0357062 Ga0501076_0357062_461_922 126
458 3300049593 Ga0501077_0055600 Ga0501077_0055600_978_1364 126
459 3300049686 Ga0501257_150544 Ga0501257_150544_116_502 126
460 3300049741 Ga0501079_0202436 Ga0501079_0202436_1039_1425 126
461 3300049741 Ga0501079_0596461 Ga0501079_0596461_106_492 126
462 3300049742 Ga0501080_0009386 Ga0501080_0009386_6909_7295 126
463 3300049742 Ga0501080_0009530 Ga0501080_0009530_6776_7162 126
464 3300049742 Ga0501080_0071481 Ga0501080_0071481_928_1389 126
465 3300049742 Ga0501080_0218977 Ga0501080_0218977_516_902 126
466 3300049743 Ga0501081_0205453 Ga0501081_0205453_875_1261 126
467 3300049743 Ga0501081_0826266 Ga0501081_0826266_220_651 126
468 3300049744 Ga0501083_0023657 Ga0501083_0023657_2780_3241 126
469 3300049744 Ga0501083_0033783 Ga0501083_0033783_668_1054 126
470 3300049744 Ga0501083_0042912 Ga0501083_0042912_539_925 126
471 3300049744 Ga0501083_0441018 Ga0501083_0441018_181_567 126
472 3300049822 Ga0501035_0039572 Ga0501035_0039572_3028_3417 126
473 3300049822 Ga0501035_0119259 Ga0501035_0119259_1399_1785 126
474 3300049822 Ga0501035_0230248 Ga0501035_0230248_791_1252 126
475 3300049822 Ga0501035_0391020 Ga0501035_0391020_270_656 126
476 3300049822 Ga0501035_0459922 Ga0501035_0459922_135_521 126
477 3300049822 Ga0501035_0553244 Ga0501035_0553244_33_419 126
478 3300049823 Ga0501044_0029283 Ga0501044_0029283_5182_5568 126
479 3300049823 Ga0501044_0034594 Ga0501044_0034594_3560_4021 126
480 3300049823 Ga0501044_0047808 Ga0501044_0047808_3123_3509 126
481 3300049823 Ga0501044_0223212 Ga0501044_0223212_409_855 126
482 3300049823 Ga0501044_0243435 Ga0501044_0243435_578_964 126
483 3300049824 Ga0501045_0690819 Ga0501045_0690819_55_441 126
484 3300050490 nmdc:mga03n38_746660_c1 nmdc:mga03n38_746660_c1_155_541 126
485 3300050507 nmdc:mga05p37_2157732_c1 nmdc:mga05p37_2157732_c1_76_462 126
486 3300050509 nmdc:mga0qj67_217146_c1 nmdc:mga0qj67_217146_c1_244_630 126
487 3300050511 nmdc:mga08y16_34_c1 nmdc:mga08y16_34_c1_104742_105128 126
488 3300050513 nmdc:mga0rr50_457247_c1 nmdc:mga0rr50_457247_c1_75_461 126
489 3300050514 nmdc:mga08x19_222241_c1 nmdc:mga08x19_222241_c1_893_1279 126
490 3300050515 nmdc:mga0a205_191804_c1 nmdc:mga0a205_191804_c1_472_858 126
491 3300050516 nmdc:mga0sz30_236205_c1 nmdc:mga0sz30_236205_c1_12_398 126
492 3300053077 Ga0495601_0000760 Ga0495601_0000760_6623_7009 126
493 3300053078 Ga0495612_0003226 Ga0495612_0003226_2290_2676 126
494 3300053078 Ga0495612_0372228 Ga0495612_0372228_149_535 126
495 3300053080 Ga0500635_0003620 Ga0500635_0003620_1814_2254 126
496 3300053085 Ga0495619_0039515 Ga0495619_0039515_45_431 126
497 3300053085 Ga0495619_0324739 Ga0495619_0324739_400_786 126
498 3300053086 Ga0500578_0272890 Ga0500578_0272890_316_702 126
499 3300053087 Ga0500643_025043 Ga0500643_025043_834_1220 126
500 3300053087 Ga0500643_038352 Ga0500643_038352_873_1259 126
501 3300053090 Ga0500646_0018671 Ga0500646_0018671_1035_1421 126
502 3300053092 Ga0500583_0096604 Ga0500583_0096604_990_1376 126
503 3300053092 Ga0500583_0163923 Ga0500583_0163923_245_631 126
504 3300053093 Ga0500651_0023089 Ga0500651_0023089_2858_3244 126
505 3300053093 Ga0500651_0293147 Ga0500651_0293147_472_858 126
506 3300053096 Ga0500641_0022645 Ga0500641_0022645_1259_1645 126
507 3300053098 Ga0500650_0372607 Ga0500650_0372607_27_413 126
508 3300053103 Ga0500555_039931 Ga0500555_039931_236_622 126
509 3300053104 Ga0500556_0356275 Ga0500556_0356275_152_538 126
510 3300053108 Ga0500562_000043 Ga0500562_000043_54525_54911 126
511 3300053108 Ga0500562_046172 Ga0500562_046172_417_803 126
512 3300053111 Ga0500572_016596 Ga0500572_016596_964_1350 126
513 3300053118 Ga0500594_0018923 Ga0500594_0018923_1299_1685 126
514 3300053119 Ga0500595_003746 Ga0500595_003746_709_1095 126
515 3300053126 Ga0500621_070620 Ga0500621_070620_635_1021 126
516 3300053129 Ga0500628_043770 Ga0500628_043770_268_654 126
517 3300053130 Ga0500642_0001983 Ga0500642_0001983_554_940 126
518 3300053130 Ga0500642_0365119 Ga0500642_0365119_135_521 126
519 3300053131 Ga0500652_000092 Ga0500652_000092_1301_1693 126
520 3300053131 Ga0500652_198782 Ga0500652_198782_20_406 126
521 3300053137 Ga0500561_0206876 Ga0500561_0206876_142_528 126
522 3300053142 Ga0500577_0086338 Ga0500577_0086338_428_814 126
523 3300053142 Ga0500577_0182613 Ga0500577_0182613_299_685 126
524 3300053146 Ga0500588_0014667 Ga0500588_0014667_1295_1681 126
525 3300053151 Ga0500604_0021388 Ga0500604_0021388_726_1112 126
526 3300053151 Ga0500604_0270613 Ga0500604_0270613_33_419 126
527 3300053153 Ga0500616_0008973 Ga0500616_0008973_4812_5198 126
528 3300053156 Ga0500622_0173634 Ga0500622_0173634_473_859 126
529 3300053156 Ga0500622_0176829 Ga0500622_0176829_379_765 126
530 3300053178 Ga0500637_0002697 Ga0500637_0002697_1496_1882 126
531 3300053727 Ga0500611_056460 Ga0500611_056460_272_658 126
532 3300053730 Ga0500645_094566 Ga0500645_094566_286_672 126
533 3300053731 Ga0500609_000265 Ga0500609_000265_1064_1450 126
534 3300053736 Ga0500599_006324 Ga0500599_006324_243_629 126
535 3300053739 Ga0500587_059592 Ga0500587_059592_10_396 126
536 3300054114 Ga0501084_0066635 Ga0501084_0066635_580_1041 126
537 3300054114 Ga0501084_0317544 Ga0501084_0317544_264_650 126
538 3300054114 Ga0501084_0352256 Ga0501084_0352256_447_833 126
539 3300054114 Ga0501084_0482023 Ga0501084_0482023_485_871 126
540 3300059421 Ga0590071_012592 Ga0590071_012592_1041_1427 126
541 3300059423 Ga0590074_032126 Ga0590074_032126_191_577 126
542 3300059424 Ga0590075_101237 Ga0590075_101237_86_472 126
543 3300060346 Ga0587111_0023499 Ga0587111_0023499_451_837 126
544 3300060353 Ga0501082_0005902 Ga0501082_0005902_7251_7637 126
545 3300060353 Ga0501082_1701556 Ga0501082_1701556_55_441 126
546 3300061734 Ga0530510_1131741 Ga0530510_1131741_190_579 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

34

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3to5-assembly1.cif.gz_A high resolution structure of chey3 from vibrio cholerae 0.9897 1 123
1e6l-assembly1.cif.gz_A two-component signal transduction system d13a mutant of chey 0.9879 2 125
3rvo-assembly1.cif.gz_A structure of chey-mn2+ complex with substitutions at 59 and 89: n59d e89y 0.9877 2 125
4hnq-assembly1.cif.gz_A crystal structure of the mutant q97a of vibrio cholerae chey3 0.9875 1 123
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9875 1 123
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9825 1 123 3.40.50.2300
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.967 1 123 3.40.50.2300
3t6kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9556 4 124 3.40.50.2300
af_Q23917_160_371_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9548 5 125 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.953 3 125 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1L7AGH8-F1-model_v4 Two-component system response regulator 1.005 1 126 GO:0000160
AF-A0A248JM56-F1-model_v4 Response regulator 1.004 5 123 GO:0000160
AF-A0A7W9QPJ8-F1-model_v4 Two-component system chemotaxis response regulator CheY 1.003 6 122 GO:0000160
AF-A0A2S6MZI0-F1-model_v4 Response regulatory domain-containing protein 1.002 5 123 GO:0000160
AF-S9QRN9-F1-model_v4 Chemotaxis regulator-transmits chemoreceptor signals to flagelllar motor component CheY 1.002 5 123 GO:0000160

Feature Viewer

pLDDT pTM Quality
93.69 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map