F462038

General Info

Members Datasets Scaffolds Average Seq Length
546 285 528 254

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0003110|Ga0496121_0003110_18338_19207
Length 289
Sequence MTQPTTDTSQENDGPLPSFLDPLGGPEAQRQVWGPSPPKRIDCVLVASGKYHDIDFARLELLKLLAEDERVRVRVFEDYSHLDAIRNADFLVTYTCDVIPSLEQQEALRAWVEAGGRWYALHGTNSILRMLASGLFDSPAWAPHLMETLGSQFIAHPPIAPYRVEVADPTHPLVQGIEPFDSTDELYLSDLHADLHVLLDTEFEGAATGFVRERWGHSRHPVMYLRPLGSGAVLYLTLGHCRGHYDLQPLMDYYPQVDRCAWDQPVFHELLRRGISWAKAPQQTDPTAS

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
10 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
11 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
12 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
18 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
240 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
241 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
242 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
243 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
244 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
247 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
259 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
260 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
261 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
262 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
263 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
264 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
265 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.52
Metatranscriptomes 0
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.68
Nodule 0.18
Rhizoplane 1.83
Rhizosphere 81.32
Stem 0
Stem Tuber 0
Unclassified 10.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000833 3300001976 Bacteria 4169
2 JGI24740J21852_10000098 3300001979 Bacteria 30614
3 JGI24739J22299_10000299 3300001989 Bacteria 16806
4 JGI24739J22299_10024695 3300001989 Bacteria 2117
5 JGI24737J22298_10000085 3300001990 Bacteria 27466
6 JGI24735J21928_10020039 3300002067 Bacteria 2051
7 JGI24750J21931_1001412 3300002070 Bacteria 3007
8 JGI24748J21848_1000042 3300002074 Bacteria 62376
9 JGI24738J21930_10006300 3300002075 Bacteria 2794
10 JGI24034J26672_10000035 3300002239 Bacteria 85548
11 JGI24751J29686_10000463 3300002459 Bacteria 12240
12 rootH1_10037912 3300003316 Bacteria 2995
13 rootH1_10037912 3300003323 Bacteria 2980
14 Ga0055536_1003464 3300003781 Bacteria 8457
15 Ga0055530_10000184 3300003791 Bacteria 55977
16 Ga0055531_10000439 3300003794 Bacteria 39122
17 Ga0070658_10007829 3300005327 Bacteria 8608
18 Ga0070658_10389220 3300005327 Bacteria 1197
19 Ga0070676_10000512 3300005328 Bacteria 18570
20 Ga0070676_10273217 3300005328 Unclassified 1136
21 Ga0070690_100000009 3300005330 Bacteria 112447
22 Ga0070670_100000046 3300005331 Bacteria 138621
23 Ga0070670_100040805 3300005331 Bacteria 3989
24 Ga0070670_100058012 3300005331 Bacteria 3323
25 Ga0070670_100058475 3300005331 Bacteria 3310
26 Ga0070670_100121545 3300005331 Bacteria 2253
27 Ga0070677_10015444 3300005333 Bacteria 2705
28 Ga0068869_100003432 3300005334 Bacteria 9689
29 Ga0070666_10000006 3300005335 Bacteria 319173
30 Ga0070666_10091605 3300005335 Bacteria 2089
31 Ga0070680_100031983 3300005336 Bacteria 4232
32 Ga0068868_100020401 3300005338 Bacteria 4979
33 Ga0070660_100000403 3300005339 Bacteria 28790
34 Ga0070660_100632980 3300005339 Bacteria 895
35 Ga0070689_100064646 3300005340 Bacteria 2848
36 Ga0070661_100000046 3300005344 Bacteria 92262
37 Ga0070661_100053893 3300005344 Bacteria 2945
38 Ga0070661_100070141 3300005344 Bacteria 2577
39 Ga0070661_100542005 3300005344 Bacteria 935
40 Ga0070668_100000066 3300005347 Bacteria 65221
41 Ga0070668_100002348 3300005347 Bacteria 13911
42 Ga0070668_100047030 3300005347 Bacteria 3316
43 Ga0070669_100000095 3300005353 Bacteria 86930
44 Ga0070669_100010351 3300005353 Bacteria 6622
45 Ga0070675_100389490 3300005354 Bacteria 1242
46 Ga0070671_100005583 3300005355 Bacteria 10018
47 Ga0070674_100667836 3300005356 Bacteria 885
48 Ga0070673_100006452 3300005364 Bacteria 7625
49 Ga0070673_100069546 3300005364 Bacteria 2822
50 Ga0070688_100008847 3300005365 Bacteria 5481
51 Ga0070659_100001027 3300005366 Bacteria 20434
52 Ga0070667_100000062 3300005367 Bacteria 143729
53 Ga0070667_100031521 3300005367 Bacteria 4420
54 Ga0070667_100066613 3300005367 Bacteria 3060
55 Ga0070667_100083073 3300005367 Unclassified 2743
56 Ga0070663_100240608 3300005455 Bacteria 1428
57 Ga0070678_100090138 3300005456 Bacteria 2349
58 Ga0070662_100003475 3300005457 Bacteria 9822
59 Ga0070662_100063920 3300005457 Bacteria 2693
60 Ga0068867_100004028 3300005459 Bacteria 10336
61 Ga0070685_10000155 3300005466 Bacteria 45505
62 Ga0070679_100001414 3300005530 Bacteria 21227
63 Ga0070684_100173716 3300005535 Bacteria 1958
64 Ga0068853_100001944 3300005539 Bacteria 15231
65 Ga0068853_100017909 3300005539 Bacteria 5853
66 Ga0068853_100039138 3300005539 Bacteria 4043
67 Ga0068853_100213336 3300005539 Bacteria 1760
68 Ga0068853_100509671 3300005539 Bacteria 1136
69 Ga0070672_100024584 3300005543 Bacteria 4455
70 Ga0070686_100000091 3300005544 Bacteria 63232
71 Ga0070686_100229989 3300005544 Bacteria 1345
72 Ga0070693_100272098 3300005547 Bacteria 1131
73 Ga0070665_100000019 3300005548 Bacteria 413972
74 Ga0070665_100020867 3300005548 Bacteria 6584
75 Ga0070665_100171307 3300005548 Unclassified 2172
76 Ga0068855_100000336 3300005563 Bacteria 58477
77 Ga0068855_100015208 3300005563 Bacteria 9266
78 Ga0068855_100434165 3300005563 Bacteria 1435
79 Ga0070664_100003102 3300005564 Bacteria 13440
80 Ga0068857_100087824 3300005577 Bacteria 2781
81 Ga0068857_100121824 3300005577 Bacteria 2349
82 Ga0068854_100000276 3300005578 Bacteria 34585
83 Ga0068854_100002104 3300005578 Bacteria 12200
84 Ga0068854_100044794 3300005578 Bacteria 3143
85 Ga0068854_100173709 3300005578 Bacteria 1678
86 Ga0068854_100826096 3300005578 Bacteria 809
87 Ga0068856_100017997 3300005614 Bacteria 6851
88 Ga0068856_100040644 3300005614 Bacteria 4569
89 Ga0068856_100737079 3300005614 Bacteria 1005
90 Ga0068852_100000071 3300005616 Bacteria 70039
91 Ga0068852_100003050 3300005616 Bacteria 11655
92 Ga0068859_100002404 3300005617 Bacteria 19061
93 Ga0068859_100044028 3300005617 Bacteria 4486
94 Ga0068859_100070167 3300005617 Bacteria 3539
95 Ga0068859_100419542 3300005617 Unclassified 1434
96 Ga0068864_100001627 3300005618 Bacteria 18513
97 Ga0068864_100023227 3300005618 Bacteria 5206
98 Ga0068864_100451628 3300005618 Bacteria 1229
99 Ga0068861_100043720 3300005719 Bacteria 3364
100 Ga0068861_100124593 3300005719 Bacteria 2083
101 Ga0068851_10132421 3300005834 Bacteria 1349
102 Ga0068863_100000038 3300005841 Bacteria 161477
103 Ga0068863_100000118 3300005841 Bacteria 82651
104 Ga0068863_100001162 3300005841 Bacteria 26293
105 Ga0068863_100006006 3300005841 Bacteria 11906
106 Ga0068863_100049388 3300005841 Bacteria 3990
107 Ga0068858_100002727 3300005842 Bacteria 17774
108 Ga0068858_100006281 3300005842 Bacteria 11575
109 Ga0068858_100016169 3300005842 Bacteria 7010
110 Ga0068858_100016253 3300005842 Bacteria 6990
111 Ga0068860_100000014 3300005843 Bacteria 319437
112 Ga0068860_100001558 3300005843 Bacteria 24699
113 Ga0068860_100001590 3300005843 Bacteria 24402
114 Ga0068860_100019743 3300005843 Bacteria 6534
115 Ga0068860_100068146 3300005843 Bacteria 3381
116 Ga0068860_100734836 3300005843 Bacteria 998
117 Ga0068862_100000503 3300005844 Bacteria 41613
118 Ga0068862_100000556 3300005844 Bacteria 38985
119 Ga0068862_100494471 3300005844 Bacteria 1160
120 Ga0081455_10087176 3300005937 Bacteria 2540
121 Ga0070712_100000077 3300006175 Bacteria 50870
122 Ga0075366_10023716 3300006195 Bacteria 3575
123 Ga0075366_10128988 3300006195 Bacteria 1526
124 Ga0075370_10007046 3300006353 Bacteria 5703
125 Ga0075370_10074679 3300006353 Bacteria 1943
126 Ga0075428_100001229 3300006844 Bacteria 27391
127 Ga0097620_100002404 3300006931 Bacteria 19061
128 Ga0097620_100003462 3300006931 Bacteria 16048
129 Ga0097620_100044031 3300006931 Bacteria 4486
130 Ga0097620_100070168 3300006931 Bacteria 3539
131 Ga0097620_100419523 3300006931 Unclassified 1434
132 Ga0079104_1021238 3300006946 Bacteria 1772
133 Ga0099795_10066451 3300007788 Bacteria 1351
134 Ga0105250_10020936 3300009092 Bacteria 2641
135 Ga0105240_10001073 3300009093 Bacteria 48286
136 Ga0105240_10003822 3300009093 Bacteria 23283
137 Ga0105240_10021136 3300009093 Bacteria 8664
138 Ga0105240_10023160 3300009093 Bacteria 8223
139 Ga0105240_10088888 3300009093 Bacteria 3779
140 Ga0105240_10205227 3300009093 Bacteria 2307
141 Ga0105240_10231145 3300009093 Bacteria 2149
142 Ga0105240_10389258 3300009093 Bacteria 1573
143 Ga0105245_10025979 3300009098 Bacteria 5152
144 Ga0105247_10001110 3300009101 Bacteria 20041
145 Ga0105247_10002222 3300009101 Bacteria 13367
146 Ga0105247_10016764 3300009101 Bacteria 4393
147 Ga0105247_10043177 3300009101 Bacteria 2762
148 Ga0114129_10347923 3300009147 Bacteria 1964
149 Ga0105243_10595764 3300009148 Bacteria 1063
150 Ga0105241_10001892 3300009174 Bacteria 15865
151 Ga0105242_10177898 3300009176 Bacteria 1875
152 Ga0105248_10021753 3300009177 Bacteria 7105
153 Ga0105248_10027959 3300009177 Bacteria 6280
154 Ga0105248_10426586 3300009177 Bacteria 1493
155 Ga0105237_10023512 3300009545 Bacteria 6313
156 Ga0105237_10037965 3300009545 Bacteria 4865
157 Ga0105237_10143496 3300009545 Bacteria 2382
158 Ga0105237_10162206 3300009545 Bacteria 2234
159 Ga0105237_10231276 3300009545 Bacteria 1850
160 Ga0105237_10259201 3300009545 Bacteria 1741
161 Ga0105238_10000659 3300009551 Bacteria 36189
162 Ga0105238_10006129 3300009551 Bacteria 11936
163 Ga0105238_10007472 3300009551 Bacteria 10949
164 Ga0105238_10029557 3300009551 Bacteria 5582
165 Ga0105238_10107148 3300009551 Bacteria 2776
166 Ga0105238_10172599 3300009551 Bacteria 2138
167 Ga0105238_10210480 3300009551 Bacteria 1920
168 Ga0105238_10404560 3300009551 Bacteria 1358
169 Ga0105249_10000035 3300009553 Bacteria 201325
170 Ga0105249_10000398 3300009553 Bacteria 41958
171 Ga0105249_10049445 3300009553 Bacteria 3835
172 Ga0105249_10437342 3300009553 Bacteria 1345
173 Ga0105249_10496974 3300009553 Bacteria 1264
174 Ga0099796_10013227 3300010159 Bacteria 2352
175 Ga0105239_10000031 3300010375 Bacteria 226947
176 Ga0105239_10173430 3300010375 Bacteria 2412
177 Ga0105239_10263921 3300010375 Bacteria 1936
178 Ga0105239_10297315 3300010375 Bacteria 1818
179 Ga0105239_10408550 3300010375 Bacteria 1537
180 Ga0157326_1000132 3300012513 Bacteria 8018
181 Ga0157373_10007676 3300013100 Bacteria 8017
182 Ga0157371_10000043 3300013102 Bacteria 197887
183 Ga0157370_10019760 3300013104 Bacteria 6744
184 Ga0157370_10041221 3300013104 Bacteria 4457
185 Ga0157369_10062226 3300013105 Bacteria 4022
186 Ga0157374_10051185 3300013296 Bacteria 3842
187 Ga0163162_10083511 3300013306 Bacteria 3268
188 Ga0157372_10037043 3300013307 Bacteria 5378
189 Ga0157375_10038826 3300013308 Bacteria 4575
190 Ga0157375_10445427 3300013308 Bacteria 1460
191 Ga0163163_10003887 3300014325 Bacteria 12731
192 Ga0163163_10096476 3300014325 Bacteria 2977
193 Ga0163163_10182403 3300014325 Bacteria 2146
194 Ga0157380_10001255 3300014326 Bacteria 16483
195 Ga0157380_10316027 3300014326 Bacteria 1446
196 Ga0157377_10204816 3300014745 Bacteria 1255
197 Ga0157379_10016226 3300014968 Bacteria 6553
198 Ga0157379_10062616 3300014968 Bacteria 3327
199 Ga0157379_10095074 3300014968 Bacteria 2674
200 Ga0157376_10300765 3300014969 Unclassified 1519
201 Ga0163161_10000102 3300017792 Bacteria 81540
202 Ga0163161_10421300 3300017792 Bacteria 1074
203 Ga0209026_1001616 3300025250 Bacteria 9627
204 Ga0209675_1000258 3300025291 Bacteria 52281
205 Ga0209676_1000683 3300025292 Bacteria 47975
206 Ga0209676_1000720 3300025292 Bacteria 45528
207 Ga0209676_1015127 3300025292 Bacteria 2859
208 Ga0209025_1021732 3300025294 Bacteria 3439
209 Ga0209050_1000310 3300025298 Bacteria 99292
210 Ga0209050_1000915 3300025298 Bacteria 38980
211 Ga0209257_1000379 3300025304 Bacteria 88845
212 Ga0209257_1006820 3300025304 Bacteria 7177
213 Ga0207656_10001491 3300025321 Bacteria 7749
214 Ga0207656_10011930 3300025321 Bacteria 3294
215 Ga0207682_10023519 3300025893 Bacteria 2435
216 Ga0207710_10001038 3300025900 Bacteria 14368
217 Ga0207710_10001442 3300025900 Bacteria 11854
218 Ga0207710_10028603 3300025900 Bacteria 2420
219 Ga0207680_10000011 3300025903 Bacteria 391225
220 Ga0207647_10010209 3300025904 Bacteria 6635
221 Ga0207647_10012353 3300025904 Bacteria 5945
222 Ga0207647_10216364 3300025904 Bacteria 1105
223 Ga0207645_10004396 3300025907 Bacteria 10443
224 Ga0207705_10000296 3300025909 Bacteria 46440
225 Ga0207654_10001169 3300025911 Bacteria 14078
226 Ga0207654_10001340 3300025911 Bacteria 13066
227 Ga0207695_10000003 3300025913 Bacteria 1368691
228 Ga0207695_10006338 3300025913 Bacteria 15393
229 Ga0207695_10026407 3300025913 Bacteria 6480
230 Ga0207695_10041108 3300025913 Bacteria 4950
231 Ga0207695_10072612 3300025913 Bacteria 3510
232 Ga0207695_10086641 3300025913 Bacteria 3158
233 Ga0207671_10002654 3300025914 Bacteria 18789
234 Ga0207671_10034271 3300025914 Bacteria 3773
235 Ga0207671_10049900 3300025914 Bacteria 3099
236 Ga0207671_10054036 3300025914 Bacteria 2976
237 Ga0207671_10093052 3300025914 Bacteria 2273
238 Ga0207671_10095930 3300025914 Bacteria 2240
239 Ga0207671_10162765 3300025914 Bacteria 1728
240 Ga0207693_10007321 3300025915 Bacteria 9078
241 Ga0207660_10006861 3300025917 Bacteria 7373
242 Ga0207657_10000583 3300025919 Bacteria 38816
243 Ga0207657_10062202 3300025919 Bacteria 3197
244 Ga0207649_10000072 3300025920 Bacteria 87103
245 Ga0207649_10004310 3300025920 Bacteria 7735
246 Ga0207652_10005146 3300025921 Bacteria 10609
247 Ga0207646_10325260 3300025922 Bacteria 1389
248 Ga0207681_10000112 3300025923 Bacteria 68723
249 Ga0207681_10002190 3300025923 Bacteria 12453
250 Ga0207694_10000016 3300025924 Bacteria 349087
251 Ga0207694_10010450 3300025924 Bacteria 7000
252 Ga0207694_10020714 3300025924 Bacteria 4979
253 Ga0207694_10024486 3300025924 Bacteria 4585
254 Ga0207694_10041297 3300025924 Bacteria 3554
255 Ga0207694_10062407 3300025924 Bacteria 2902
256 Ga0207694_10165371 3300025924 Bacteria 1789
257 Ga0207694_10576758 3300025924 Bacteria 945
258 Ga0207650_10000008 3300025925 Bacteria 498534
259 Ga0207650_10045473 3300025925 Bacteria 3230
260 Ga0207650_10069052 3300025925 Bacteria 2654
261 Ga0207650_10145722 3300025925 Bacteria 1865
262 Ga0207650_10206672 3300025925 Bacteria 1575
263 Ga0207650_10279421 3300025925 Bacteria 1359
264 Ga0207659_10027595 3300025926 Bacteria 3847
265 Ga0207687_10018431 3300025927 Bacteria 4608
266 Ga0207644_10003195 3300025931 Bacteria 10551
267 Ga0207690_10000296 3300025932 Bacteria 35141
268 Ga0207706_10002108 3300025933 Bacteria 19463
269 Ga0207706_10098086 3300025933 Bacteria 2578
270 Ga0207706_10445391 3300025933 Bacteria 1121
271 Ga0207686_10107890 3300025934 Bacteria 1872
272 Ga0207691_10003410 3300025940 Bacteria 15449
273 Ga0207691_10123674 3300025940 Bacteria 2290
274 Ga0207711_10026509 3300025941 Bacteria 4864
275 Ga0207711_10105833 3300025941 Bacteria 2495
276 Ga0207711_10351656 3300025941 Bacteria 1364
277 Ga0207689_10012842 3300025942 Bacteria 7151
278 Ga0207689_10441737 3300025942 Bacteria 1087
279 Ga0207679_10531931 3300025945 Bacteria 1052
280 Ga0207667_10000021 3300025949 Bacteria 370524
281 Ga0207667_10000069 3300025949 Bacteria 180683
282 Ga0207667_10013615 3300025949 Bacteria 9298
283 Ga0207667_10029845 3300025949 Bacteria 5907
284 Ga0207667_10071526 3300025949 Bacteria 3606
285 Ga0207667_10563751 3300025949 Bacteria 1151
286 Ga0207651_10014384 3300025960 Bacteria 4566
287 Ga0207651_10121759 3300025960 Bacteria 1980
288 Ga0207712_10000012 3300025961 Bacteria 392363
289 Ga0207712_10000013 3300025961 Bacteria 391208
290 Ga0207712_10115396 3300025961 Bacteria 2022
291 Ga0207712_10392216 3300025961 Bacteria 1165
292 Ga0207668_10000055 3300025972 Bacteria 94786
293 Ga0207668_10001146 3300025972 Bacteria 15770
294 Ga0207640_10001910 3300025981 Bacteria 11190
295 Ga0207640_10004138 3300025981 Bacteria 7836
296 Ga0207640_10030863 3300025981 Bacteria 3306
297 Ga0207640_10157039 3300025981 Bacteria 1678
298 Ga0207640_10381350 3300025981 Bacteria 1142
299 Ga0207658_10000039 3300025986 Bacteria 143707
300 Ga0207658_10006451 3300025986 Bacteria 8006
301 Ga0207658_10013719 3300025986 Bacteria 5541
302 Ga0207658_10071723 3300025986 Unclassified 2623
303 Ga0207658_10207684 3300025986 Unclassified 1639
304 Ga0207658_10629139 3300025986 Bacteria 966
305 Ga0207703_10000281 3300026035 Bacteria 56555
306 Ga0207703_10000648 3300026035 Bacteria 34910
307 Ga0207703_10002616 3300026035 Bacteria 15532
308 Ga0207703_10011259 3300026035 Bacteria 6959
309 Ga0207703_10017243 3300026035 Bacteria 5635
310 Ga0207639_10005076 3300026041 Bacteria 8867
311 Ga0207639_10045308 3300026041 Bacteria 3312
312 Ga0207639_10303236 3300026041 Bacteria 1413
313 Ga0207639_10495447 3300026041 Bacteria 1115
314 Ga0207678_10000240 3300026067 Bacteria 49355
315 Ga0207678_10065385 3300026067 Bacteria 3123
316 Ga0207678_10257251 3300026067 Bacteria 1496
317 Ga0207702_10000868 3300026078 Bacteria 31467
318 Ga0207702_10006810 3300026078 Bacteria 9802
319 Ga0207702_10227492 3300026078 Bacteria 1741
320 Ga0207702_10565314 3300026078 Bacteria 1113
321 Ga0207641_10000060 3300026088 Bacteria 161514
322 Ga0207641_10000101 3300026088 Bacteria 122493
323 Ga0207641_10000399 3300026088 Bacteria 51066
324 Ga0207641_10004603 3300026088 Bacteria 11906
325 Ga0207641_10008095 3300026088 Bacteria 8708
326 Ga0207648_10007593 3300026089 Bacteria 10635
327 Ga0207676_10000397 3300026095 Bacteria 36762
328 Ga0207676_10001444 3300026095 Bacteria 17692
329 Ga0207676_10097650 3300026095 Bacteria 2427
330 Ga0207676_10143397 3300026095 Bacteria 2048
331 Ga0207674_10001563 3300026116 Bacteria 29480
332 Ga0207674_10046373 3300026116 Bacteria 4462
333 Ga0207674_10061013 3300026116 Bacteria 3811
334 Ga0207674_10172706 3300026116 Bacteria 2114
335 Ga0207675_100125650 3300026118 Bacteria 2430
336 Ga0207683_10236955 3300026121 Bacteria 1664
337 Ga0207698_10000062 3300026142 Bacteria 72806
338 Ga0207698_10000461 3300026142 Bacteria 23591
339 Ga0207698_10000594 3300026142 Bacteria 21138
340 Ga0209983_1052778 3300027665 Bacteria 891
341 Ga0209974_10004368 3300027876 Bacteria 5024
342 Ga0268266_10000025 3300028379 Bacteria 477143
343 Ga0268266_10068625 3300028379 Unclassified 3070
344 Ga0268266_10083916 3300028379 Unclassified 2781
345 Ga0268266_10225555 3300028379 Bacteria 1724
346 Ga0268265_10000316 3300028380 Bacteria 53175
347 Ga0268265_10000529 3300028380 Bacteria 38992
348 Ga0268264_10000037 3300028381 Bacteria 391116
349 Ga0268264_10000044 3300028381 Bacteria 368079
350 Ga0268264_10002344 3300028381 Bacteria 16744
351 Ga0268264_10002651 3300028381 Bacteria 15641
352 Ga0268264_10006013 3300028381 Bacteria 10271
353 Ga0268264_10016172 3300028381 Bacteria 6111
354 Ga0268264_10074023 3300028381 Bacteria 2892
355 Ga0268264_10492924 3300028381 Bacteria 1194
356 Ga0265325_10000704 3300031241 Bacteria 24221
357 Ga0265339_10010270 3300031249 Bacteria 5825
358 Ga0265331_10000011 3300031250 Bacteria 308171
359 Ga0307513_10004619 3300031456 Bacteria 18343
360 Ga0307513_10024788 3300031456 Bacteria 6972
361 Ga0307509_10000004 3300031507 Bacteria 535507
362 Ga0307408_100299064 3300031548 Bacteria 1347
363 Ga0265313_10012588 3300031595 Bacteria 5149
364 Ga0307508_10000398 3300031616 Bacteria 52452
365 Ga0265314_10007030 3300031711 Bacteria 9830
366 Ga0316576_10078314 3300031727 Bacteria 2450
367 Ga0307516_10000056 3300031730 Bacteria 122840
368 Ga0307516_10038664 3300031730 Bacteria 4759
369 Ga0307405_10021316 3300031731 Bacteria 3640
370 Ga0307405_10042629 3300031731 Bacteria 2764
371 Ga0307405_10148191 3300031731 Bacteria 1646
372 Ga0307405_10171726 3300031731 Bacteria 1547
373 Ga0307406_10037732 3300031901 Unclassified 2986
374 Ga0307406_10047013 3300031901 Bacteria 2718
375 Ga0307406_10114049 3300031901 Bacteria 1866
376 Ga0307412_10007974 3300031911 Bacteria 6036
377 Ga0307412_10025254 3300031911 Bacteria 3678
378 Ga0307412_10097198 3300031911 Bacteria 2074
379 Ga0307412_10192145 3300031911 Bacteria 1544
380 Ga0307416_100033155 3300032002 Bacteria 3912
381 Ga0307416_100089757 3300032002 Bacteria 2633
382 Ga0307416_100303619 3300032002 Bacteria 1588
383 Ga0307414_10001195 3300032004 Bacteria 13350
384 Ga0307414_10003519 3300032004 Bacteria 8375
385 Ga0307414_10029963 3300032004 Bacteria 3549
386 Ga0307414_10123469 3300032004 Bacteria 1995
387 Ga0307414_10283158 3300032004 Bacteria 1394
388 Ga0307411_10124910 3300032005 Bacteria 1869
389 Ga0307411_10132471 3300032005 Bacteria 1824
390 Ga0307510_10058718 3300033180 Bacteria 3980
391 Ga0373941_0085184 3300035115 Bacteria 1074
392 Ga0395905_0185318 3300037471 Bacteria 1954
393 Ga0395905_0230494 3300037471 Bacteria 1732
394 Ga0395901_0191144 3300038443 Bacteria 2147
395 Ga0451847_1002457 3300041503 Bacteria 1268
396 Ga0451853_3988941 3300041512 Bacteria 1198
397 Ga0439435_0053776 3300042436 Bacteria 1158
398 Ga0466972_0106974 3300044658 Bacteria 1322
399 Ga0466965_0012178 3300044683 Bacteria 4042
400 Ga0466965_0112332 3300044683 Unclassified 1401
401 Ga0466965_0178653 3300044683 Bacteria 1119
402 Ga0466966_0022908 3300044684 Bacteria 4092
403 Ga0466963_0648238 3300044694 Unclassified 745
404 Ga0466964_0074352 3300044706 Bacteria 1444
405 Ga0466971_0039989 3300044719 Bacteria 2106
406 Ga0466968_0036666 3300044735 Bacteria 2055
407 Ga0495585_0163665 3300046492 Bacteria 1153
408 Ga0495596_0000881 3300046500 Bacteria 18103
409 Ga0495596_0001988 3300046500 Bacteria 11255
410 Ga0495607_0022910 3300046501 Bacteria 3916
411 Ga0495583_0023723 3300046506 Bacteria 3097
412 Ga0495610_0001533 3300046512 Bacteria 20365
413 Ga0495610_0004653 3300046512 Bacteria 10037
414 Ga0495616_0000040 3300046513 Bacteria 122596
415 Ga0495632_0000001 3300046519 Bacteria 873295
416 Ga0495643_0000007 3300046522 Bacteria 383435
417 Ga0495643_0003970 3300046522 Bacteria 10576
418 Ga0495643_0041909 3300046522 Bacteria 2495
419 Ga0495663_0000001 3300046525 Bacteria 595264
420 Ga0495609_0005653 3300046538 Bacteria 6517
421 Ga0495633_0000122 3300046558 Bacteria 104795
422 Ga0495668_0209260 3300046616 Bacteria 1068
423 Ga0495625_0007145 3300046660 Bacteria 9806
424 Ga0495671_0040974 3300046692 Bacteria 2334
425 Ga0495687_043968 3300047443 Bacteria 1944
426 Ga0495686_0000060 3300047472 Bacteria 237402
427 Ga0495686_0020356 3300047472 Bacteria 4425
428 Ga0495686_0168119 3300047472 Bacteria 1277
429 Ga0495615_0000003 3300048090 Bacteria 127902
430 Ga0495626_0001183 3300048091 Bacteria 21694
431 Ga0496101_0213676 3300048904 Bacteria 1495
432 Ga0496101_0517173 3300048904 Bacteria 943
433 Ga0496102_0000260 3300048905 Bacteria 67869
434 Ga0496102_0007197 3300048905 Bacteria 9502
435 Ga0496102_0134176 3300048905 Bacteria 2319
436 Ga0496102_0648240 3300048905 Bacteria 979
437 Ga0496103_0000171 3300048906 Bacteria 67895
438 Ga0496103_0001942 3300048906 Bacteria 13364
439 Ga0496104_0287322 3300048907 Bacteria 1557
440 Ga0496105_0380469 3300048908 Bacteria 1123
441 Ga0496116_0000361 3300048919 Bacteria 70406
442 Ga0496116_0001021 3300048919 Bacteria 34153
443 Ga0496116_0079469 3300048919 Bacteria 2041
444 Ga0496117_0000121 3300048920 Bacteria 171532
445 Ga0496117_0015136 3300048920 Bacteria 6601
446 Ga0496118_0000095 3300048921 Bacteria 164850
447 Ga0496118_0017124 3300048921 Bacteria 6613
448 Ga0496118_0122155 3300048921 Bacteria 1694
449 Ga0496119_0022130 3300048922 Bacteria 4565
450 Ga0496119_0032192 3300048922 Bacteria 3499
451 Ga0496120_0038568 3300048923 Bacteria 2825
452 Ga0496121_0000069 3300048924 Bacteria 253087
453 Ga0496121_0000332 3300048924 Bacteria 98654
454 Ga0496121_0000970 3300048924 Bacteria 51488
455 Ga0496121_0001955 3300048924 Bacteria 32815
456 Ga0496121_0003110 3300048924 Bacteria 23986
457 Ga0496121_0042688 3300048924 Bacteria 3940
458 Ga0496122_0004877 3300048925 Bacteria 16295
459 Ga0496122_0009543 3300048925 Bacteria 10196
460 Ga0496123_0001636 3300048926 Bacteria 30134
461 Ga0496123_0002464 3300048926 Bacteria 22914
462 Ga0496124_0000119 3300048927 Bacteria 163996
463 Ga0496124_0001840 3300048927 Bacteria 29288
464 Ga0496124_0006144 3300048927 Bacteria 13174
465 Ga0496124_0039106 3300048927 Bacteria 4114
466 Ga0496124_0066304 3300048927 Bacteria 3007
467 Ga0496125_0000312 3300048928 Bacteria 95519
468 Ga0496125_0033556 3300048928 Bacteria 4540
469 Ga0496125_0053144 3300048928 Bacteria 3324
470 Ga0496126_0000136 3300048929 Bacteria 167497
471 Ga0496126_0002035 3300048929 Bacteria 28481
472 Ga0496126_0008156 3300048929 Bacteria 11337
473 Ga0496126_0048547 3300048929 Bacteria 3878
474 Ga0496126_0105726 3300048929 Bacteria 2457
475 Ga0495682_0001549 3300049460 Bacteria 12070
476 Ga0501290_000087 3300049513 Bacteria 13265
477 Ga0501292_000004 3300049515 Bacteria 159565
478 Ga0501294_000030 3300049517 Bacteria 14108
479 Ga0501300_000066 3300049523 Bacteria 15100
480 Ga0501301_003837 3300049524 Unclassified 1046
481 Ga0501034_0018326 3300049571 Bacteria 7181
482 Ga0501206_002176 3300049653 Bacteria 2476
483 Ga0501207_007050 3300049654 Bacteria 1594
484 Ga0501223_000055 3300049663 Bacteria 38140
485 Ga0501223_009815 3300049663 Unclassified 1932
486 Ga0501224_000002 3300049664 Bacteria 229331
487 Ga0501224_005297 3300049664 Bacteria 1843
488 Ga0501227_000665 3300049665 Bacteria 7506
489 Ga0501227_061184 3300049665 Bacteria 965
490 Ga0501233_000719 3300049668 Bacteria 5484
491 Ga0501236_009529 3300049670 Bacteria 1255
492 Ga0501257_000013 3300049686 Bacteria 50789
493 Ga0501257_005674 3300049686 Bacteria 2757
494 Ga0501259_009231 3300049688 Unclassified 1599
495 Ga0501261_000010 3300049690 Bacteria 49364
496 Ga0501221_001518 3300049704 Bacteria 3841
497 Ga0501225_0000654 3300049705 Bacteria 10769
498 Ga0501229_005186 3300049706 Bacteria 1596
499 Ga0501234_000162 3300049707 Bacteria 9024
500 Ga0501245_000244 3300049708 Bacteria 6228
501 Ga0501279_000005 3300049775 Bacteria 153858
502 Ga0501280_000476 3300049776 Bacteria 9525
503 Ga0501281_00299 3300049777 Bacteria 5068
504 Ga0501282_000114 3300049778 Bacteria 9397
505 Ga0501283_000046 3300049779 Bacteria 15115
506 Ga0501035_0151628 3300049822 Bacteria 2011
507 Ga0501044_0000705 3300049823 Bacteria 40355
508 Ga0501044_0145971 3300049823 Bacteria 2351
509 Ga0501226_000046 3300049853 Bacteria 54629
510 nmdc:mga0k408_22284_c1 3300050493 Bacteria 3181
511 nmdc:mga07m45_53774_c1 3300050496 Bacteria 2275
512 nmdc:mga05p37_321460_c1 3300050507 Bacteria 1831
513 nmdc:mga0qj67_125825_c1 3300050509 Bacteria 2074
514 nmdc:mga08y16_195693_c1 3300050511 Bacteria 2095
515 Ga0500643_028862 3300053087 Bacteria 1712
516 Ga0500643_054392 3300053087 Bacteria 1136
517 Ga0500583_0002793 3300053092 Bacteria 5341
518 Ga0500583_0052427 3300053092 Bacteria 1898
519 Ga0500583_0072592 3300053092 Bacteria 1648
520 Ga0500651_0249412 3300053093 Bacteria 1033
521 Ga0500594_0003025 3300053118 Bacteria 3680
522 Ga0500617_019214 3300053124 Bacteria 2984
523 Ga0500658_0023342 3300053134 Bacteria 2361
524 Ga0500588_0006712 3300053146 Bacteria 2623
525 Ga0500604_0002033 3300053151 Bacteria 5592
526 Ga0500622_0007069 3300053156 Bacteria 6416
527 Ga0500627_0000305 3300053158 Bacteria 13629
528 Ga0466962_0033276 3300061719 Bacteria 2466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041503 Ga0451847_1002457 Ga0451847_1002457_605_1258 212
2 3300044694 Ga0466963_0648238 Ga0466963_0648238_13_708 228
3 3300046506 Ga0495583_0023723 Ga0495583_0023723_2342_3046 229
4 3300046616 Ga0495668_0209260 Ga0495668_0209260_313_1017 229
5 3300049513 Ga0501290_000087 Ga0501290_000087_8536_9291 230
6 3300049515 Ga0501292_000004 Ga0501292_000004_129099_129854 230
7 3300049517 Ga0501294_000030 Ga0501294_000030_7778_8533 230
8 3300049524 Ga0501301_003837 Ga0501301_003837_34_789 230
9 3300049654 Ga0501207_007050 Ga0501207_007050_488_1243 230
10 3300049663 Ga0501223_009815 Ga0501223_009815_266_1021 230
11 3300049664 Ga0501224_005297 Ga0501224_005297_13_768 230
12 3300049665 Ga0501227_000665 Ga0501227_000665_4121_4876 230
13 3300049668 Ga0501233_000719 Ga0501233_000719_1907_2662 230
14 3300049670 Ga0501236_009529 Ga0501236_009529_238_993 230
15 3300049686 Ga0501257_005674 Ga0501257_005674_1610_2365 230
16 3300049688 Ga0501259_009231 Ga0501259_009231_261_1016 230
17 3300049690 Ga0501261_000010 Ga0501261_000010_18755_19510 230
18 3300049704 Ga0501221_001518 Ga0501221_001518_1486_2241 230
19 3300049708 Ga0501245_000244 Ga0501245_000244_2419_3174 230
20 3300049775 Ga0501279_000005 Ga0501279_000005_48762_49517 230
21 3300049776 Ga0501280_000476 Ga0501280_000476_3041_3796 230
22 3300049777 Ga0501281_00299 Ga0501281_00299_3818_4573 230
23 3300049778 Ga0501282_000114 Ga0501282_000114_2493_3248 230
24 3300049779 Ga0501283_000046 Ga0501283_000046_6449_7204 230
25 3300042436 Ga0439435_0053776 Ga0439435_0053776_344_1090 237
26 3300046692 Ga0495671_0040974 Ga0495671_0040974_1312_2034 237
27 3300048924 Ga0496121_0042688 Ga0496121_0042688_791_1519 237
28 3300048928 Ga0496125_0000312 Ga0496125_0000312_36774_37502 237
29 3300048929 Ga0496126_0048547 Ga0496126_0048547_1664_2392 237
30 3300048905 Ga0496102_0648240 Ga0496102_0648240_221_955 238
31 3300025942 Ga0207689_10441737 Ga0207689_104417372 241
32 3300032004 Ga0307414_10283158 Ga0307414_102831582 241
33 3300046519 Ga0495632_0000001 Ga0495632_0000001_851728_852501 242
34 3300046525 Ga0495663_0000001 Ga0495663_0000001_20795_21568 242
35 3300046558 Ga0495633_0000122 Ga0495633_0000122_83228_84001 242
36 3300047472 Ga0495686_0020356 Ga0495686_0020356_3391_4164 242
37 3300006844 Ga0075428_100001229 Ga0075428_10000122916 243
38 3300031727 Ga0316576_10078314 Ga0316576_100783142 243
39 3300050509 nmdc:mga0qj67_125825_c1 nmdc:mga0qj67_125825_c1_422_1168 243
40 3300003316 rootH1_10037912 rootH1_100379122 244
41 3300006175 Ga0070712_100000077 Ga0070712_10000007744 244
42 3300025915 Ga0207693_10007321 Ga0207693_100073214 244
43 3300049571 Ga0501034_0018326 Ga0501034_0018326_2298_3092 244
44 3300049822 Ga0501035_0151628 Ga0501035_0151628_219_1013 244
45 3300049823 Ga0501044_0145971 Ga0501044_0145971_1527_2288 244
46 3300005344 Ga0070661_100542005 Ga0070661_1005420051 245
47 3300005539 Ga0068853_100039138 Ga0068853_1000391382 245
48 3300005614 Ga0068856_100040644 Ga0068856_1000406443 245
49 3300005618 Ga0068864_100451628 Ga0068864_1004516282 245
50 3300005841 Ga0068863_100001162 Ga0068863_10000116228 245
51 3300005843 Ga0068860_100001590 Ga0068860_1000015904 245
52 3300009093 Ga0105240_10231145 Ga0105240_102311452 245
53 3300009545 Ga0105237_10162206 Ga0105237_101622062 245
54 3300009551 Ga0105238_10172599 Ga0105238_101725992 245
55 3300014325 Ga0163163_10182403 Ga0163163_101824032 245
56 3300025914 Ga0207671_10095930 Ga0207671_100959303 245
57 3300025949 Ga0207667_10563751 Ga0207667_105637512 245
58 3300025986 Ga0207658_10629139 Ga0207658_106291392 245
59 3300026041 Ga0207639_10045308 Ga0207639_100453083 245
60 3300026088 Ga0207641_10000399 Ga0207641_100003994 245
61 3300028381 Ga0268264_10000044 Ga0268264_10000044162 245
62 3300038443 Ga0395901_0191144 Ga0395901_0191144_266_1042 245
63 3300053158 Ga0500627_0000305 Ga0500627_0000305_5631_6413 245
64 iso_pu_bacteria 2919709256 2919711653 245
65 3300005331 Ga0070670_100058475 Ga0070670_1000584752 246
66 3300005335 Ga0070666_10091605 Ga0070666_100916052 246
67 3300005336 Ga0070680_100031983 Ga0070680_1000319835 246
68 3300005355 Ga0070671_100005583 Ga0070671_1000055839 246
69 3300005367 Ga0070667_100066613 Ga0070667_1000666132 246
70 3300005367 Ga0070667_100083073 Ga0070667_1000830733 246
71 3300005530 Ga0070679_100001414 Ga0070679_1000014145 246
72 3300005539 Ga0068853_100509671 Ga0068853_1005096712 246
73 3300005544 Ga0070686_100229989 Ga0070686_1002299892 246
74 3300005547 Ga0070693_100272098 Ga0070693_1002720982 246
75 3300005548 Ga0070665_100020867 Ga0070665_1000208673 246
76 3300005548 Ga0070665_100171307 Ga0070665_1001713072 246
77 3300005563 Ga0068855_100434165 Ga0068855_1004341653 246
78 3300005578 Ga0068854_100044794 Ga0068854_1000447944 246
79 3300005617 Ga0068859_100002404 Ga0068859_10000240410 246
80 3300005617 Ga0068859_100044028 Ga0068859_1000440285 246
81 3300005618 Ga0068864_100023227 Ga0068864_1000232275 246
82 3300005841 Ga0068863_100049388 Ga0068863_1000493882 246
83 3300005842 Ga0068858_100006281 Ga0068858_10000628110 246
84 3300005842 Ga0068858_100016253 Ga0068858_1000162537 246
85 3300005843 Ga0068860_100068146 Ga0068860_1000681462 246
86 3300006931 Ga0097620_100002404 Ga0097620_10000240410 246
87 3300006931 Ga0097620_100044031 Ga0097620_1000440312 246
88 3300009092 Ga0105250_10020936 Ga0105250_100209362 246
89 3300009093 Ga0105240_10021136 Ga0105240_100211369 246
90 3300009093 Ga0105240_10023160 Ga0105240_100231608 246
91 3300009093 Ga0105240_10088888 Ga0105240_100888884 246
92 3300009101 Ga0105247_10001110 Ga0105247_1000111018 246
93 3300009101 Ga0105247_10016764 Ga0105247_100167645 246
94 3300009177 Ga0105248_10027959 Ga0105248_100279595 246
95 3300009177 Ga0105248_10426586 Ga0105248_104265862 246
96 3300009545 Ga0105237_10037965 Ga0105237_100379653 246
97 3300009545 Ga0105237_10143496 Ga0105237_101434962 246
98 3300009545 Ga0105237_10231276 Ga0105237_102312762 246
99 3300009551 Ga0105238_10107148 Ga0105238_101071483 246
100 3300009551 Ga0105238_10210480 Ga0105238_102104801 246
101 3300009553 Ga0105249_10049445 Ga0105249_100494452 246
102 3300009553 Ga0105249_10496974 Ga0105249_104969742 246
103 3300010375 Ga0105239_10000031 Ga0105239_1000003153 246
104 3300013296 Ga0157374_10051185 Ga0157374_100511852 246
105 3300014325 Ga0163163_10003887 Ga0163163_1000388710 246
106 3300014968 Ga0157379_10062616 Ga0157379_100626162 246
107 3300014969 Ga0157376_10300765 Ga0157376_103007653 246
108 3300025900 Ga0207710_10001038 Ga0207710_1000103813 246
109 3300025900 Ga0207710_10028603 Ga0207710_100286033 246
110 3300025913 Ga0207695_10006338 Ga0207695_1000633811 246
111 3300025913 Ga0207695_10041108 Ga0207695_100411086 246
112 3300025914 Ga0207671_10034271 Ga0207671_100342714 246
113 3300025914 Ga0207671_10093052 Ga0207671_100930522 246
114 3300025917 Ga0207660_10006861 Ga0207660_100068615 246
115 3300025921 Ga0207652_10005146 Ga0207652_100051462 246
116 3300025924 Ga0207694_10062407 Ga0207694_100624072 246
117 3300025924 Ga0207694_10165371 Ga0207694_101653712 246
118 3300025925 Ga0207650_10045473 Ga0207650_100454732 246
119 3300025931 Ga0207644_10003195 Ga0207644_100031954 246
120 3300025941 Ga0207711_10351656 Ga0207711_103516562 246
121 3300025949 Ga0207667_10071526 Ga0207667_100715263 246
122 3300025961 Ga0207712_10115396 Ga0207712_101153963 246
123 3300025961 Ga0207712_10392216 Ga0207712_103922162 246
124 3300025981 Ga0207640_10030863 Ga0207640_100308632 246
125 3300025986 Ga0207658_10071723 Ga0207658_100717232 246
126 3300025986 Ga0207658_10207684 Ga0207658_102076843 246
127 3300026035 Ga0207703_10000281 Ga0207703_1000028111 246
128 3300026035 Ga0207703_10011259 Ga0207703_100112593 246
129 3300026041 Ga0207639_10495447 Ga0207639_104954472 246
130 3300026088 Ga0207641_10008095 Ga0207641_100080957 246
131 3300026095 Ga0207676_10097650 Ga0207676_100976504 246
132 3300026095 Ga0207676_10143397 Ga0207676_101433972 246
133 3300028379 Ga0268266_10068625 Ga0268266_100686253 246
134 3300028379 Ga0268266_10083916 Ga0268266_100839163 246
135 3300028379 Ga0268266_10225555 Ga0268266_102255552 246
136 3300028381 Ga0268264_10074023 Ga0268264_100740232 246
137 3300031507 Ga0307509_10000004 Ga0307509_10000004215 246
138 3300031730 Ga0307516_10000056 Ga0307516_10000056106 246
139 3300031731 Ga0307405_10021316 Ga0307405_100213162 246
140 3300031911 Ga0307412_10025254 Ga0307412_100252544 246
141 3300032002 Ga0307416_100033155 Ga0307416_1000331554 246
142 3300035115 Ga0373941_0085184 Ga0373941_0085184_224_973 246
143 3300046513 Ga0495616_0000040 Ga0495616_0000040_23475_24275 246
144 3300047443 Ga0495687_043968 Ga0495687_043968_373_1137 246
145 3300048905 Ga0496102_0134176 Ga0496102_0134176_474_1238 246
146 3300048907 Ga0496104_0287322 Ga0496104_0287322_156_920 246
147 3300048921 Ga0496118_0122155 Ga0496118_0122155_161_967 246
148 3300048924 Ga0496121_0000069 Ga0496121_0000069_16201_16989 246
149 3300048924 Ga0496121_0000970 Ga0496121_0000970_12701_13465 246
150 3300048928 Ga0496125_0033556 Ga0496125_0033556_2923_3687 246
151 3300048929 Ga0496126_0008156 Ga0496126_0008156_2309_3097 246
152 3300049823 Ga0501044_0000705 Ga0501044_0000705_22080_22829 246
153 3300053151 Ga0500604_0002033 Ga0500604_0002033_2229_3035 246
154 3300005328 Ga0070676_10273217 Ga0070676_102732171 247
155 3300005331 Ga0070670_100121545 Ga0070670_1001215452 247
156 3300005344 Ga0070661_100000046 Ga0070661_10000004658 247
157 3300005354 Ga0070675_100389490 Ga0070675_1003894901 247
158 3300005356 Ga0070674_100667836 Ga0070674_1006678361 247
159 3300005364 Ga0070673_100069546 Ga0070673_1000695463 247
160 3300005455 Ga0070663_100240608 Ga0070663_1002406081 247
161 3300005563 Ga0068855_100000336 Ga0068855_10000033637 247
162 3300005616 Ga0068852_100003050 Ga0068852_10000305011 247
163 3300005617 Ga0068859_100070167 Ga0068859_1000701672 247
164 3300005841 Ga0068863_100006006 Ga0068863_1000060065 247
165 3300005843 Ga0068860_100001558 Ga0068860_10000155811 247
166 3300005843 Ga0068860_100734836 Ga0068860_1007348362 247
167 3300005844 Ga0068862_100000556 Ga0068862_10000055635 247
168 3300005844 Ga0068862_100494471 Ga0068862_1004944712 247
169 3300005937 Ga0081455_10087176 Ga0081455_100871762 247
170 3300006931 Ga0097620_100070168 Ga0097620_1000701682 247
171 3300009093 Ga0105240_10001073 Ga0105240_1000107333 247
172 3300009101 Ga0105247_10002222 Ga0105247_1000222211 247
173 3300009551 Ga0105238_10000659 Ga0105238_1000065925 247
174 3300009553 Ga0105249_10000398 Ga0105249_1000039842 247
175 3300010375 Ga0105239_10173430 Ga0105239_101734302 247
176 3300010375 Ga0105239_10263921 Ga0105239_102639212 247
177 3300014326 Ga0157380_10316027 Ga0157380_103160272 247
178 3300014745 Ga0157377_10204816 Ga0157377_102048162 247
179 3300017792 Ga0163161_10421300 Ga0163161_104213001 247
180 3300025250 Ga0209026_1001616 Ga0209026_10016169 247
181 3300025900 Ga0207710_10001442 Ga0207710_1000144210 247
182 3300025913 Ga0207695_10000003 Ga0207695_10000003337 247
183 3300025920 Ga0207649_10000072 Ga0207649_1000007230 247
184 3300025924 Ga0207694_10000016 Ga0207694_10000016307 247
185 3300025925 Ga0207650_10145722 Ga0207650_101457222 247
186 3300025933 Ga0207706_10445391 Ga0207706_104453912 247
187 3300025940 Ga0207691_10123674 Ga0207691_101236741 247
188 3300025949 Ga0207667_10000021 Ga0207667_1000002140 247
189 3300025960 Ga0207651_10121759 Ga0207651_101217592 247
190 3300025961 Ga0207712_10000012 Ga0207712_1000001242 247
191 3300026067 Ga0207678_10257251 Ga0207678_102572512 247
192 3300026078 Ga0207702_10565314 Ga0207702_105653141 247
193 3300026088 Ga0207641_10004603 Ga0207641_100046035 247
194 3300026118 Ga0207675_100125650 Ga0207675_1001256502 247
195 3300026142 Ga0207698_10000594 Ga0207698_1000059411 247
196 3300028380 Ga0268265_10000529 Ga0268265_1000052911 247
197 3300028381 Ga0268264_10002344 Ga0268264_1000234414 247
198 3300028381 Ga0268264_10492924 Ga0268264_104929242 247
199 3300031241 Ga0265325_10000704 Ga0265325_1000070412 247
200 3300031249 Ga0265339_10010270 Ga0265339_100102705 247
201 3300031250 Ga0265331_10000011 Ga0265331_1000001133 247
202 3300031456 Ga0307513_10024788 Ga0307513_100247886 247
203 3300031595 Ga0265313_10012588 Ga0265313_100125884 247
204 3300031711 Ga0265314_10007030 Ga0265314_100070303 247
205 3300031730 Ga0307516_10038664 Ga0307516_100386646 247
206 3300048929 Ga0496126_0002035 Ga0496126_0002035_9824_10585 247
207 3300049460 Ga0495682_0001549 Ga0495682_0001549_747_1505 247
208 3300049665 Ga0501227_061184 Ga0501227_061184_134_913 247
209 3300049686 Ga0501257_000013 Ga0501257_000013_20990_21769 247
210 3300050511 nmdc:mga08y16_195693_c1 nmdc:mga08y16_195693_c1_202_978 247
211 3300053092 Ga0500583_0002793 Ga0500583_0002793_2215_3048 247
212 3300053092 Ga0500583_0052427 Ga0500583_0052427_386_1153 247
213 3300053093 Ga0500651_0249412 Ga0500651_0249412_102_869 247
214 3300053156 Ga0500622_0007069 Ga0500622_0007069_4449_5216 247
215 iso_pu_bacteria 2643221560 2643822828 247
216 iso_pu_bacteria 2643221563 2643834679 247
217 iso_pu_bacteria 2643221608 2644055606 247
218 3300005331 Ga0070670_100058012 Ga0070670_1000580122 248
219 3300005347 Ga0070668_100002348 Ga0070668_1000023486 248
220 3300005353 Ga0070669_100010351 Ga0070669_1000103513 248
221 3300005367 Ga0070667_100000062 Ga0070667_10000006214 248
222 3300005841 Ga0068863_100000038 Ga0068863_100000038159 248
223 3300005843 Ga0068860_100019743 Ga0068860_1000197432 248
224 3300006353 Ga0075370_10007046 Ga0075370_100070467 248
225 3300009545 Ga0105237_10023512 Ga0105237_100235128 248
226 3300012513 Ga0157326_1000132 Ga0157326_10001327 248
227 3300025914 Ga0207671_10054036 Ga0207671_100540363 248
228 3300025923 Ga0207681_10002190 Ga0207681_100021905 248
229 3300025925 Ga0207650_10069052 Ga0207650_100690522 248
230 3300025972 Ga0207668_10001146 Ga0207668_1000114611 248
231 3300025986 Ga0207658_10000039 Ga0207658_10000039117 248
232 3300026088 Ga0207641_10000060 Ga0207641_100000603 248
233 3300028381 Ga0268264_10016172 Ga0268264_100161723 248
234 3300046522 Ga0495643_0041909 Ga0495643_0041909_1540_2289 248
235 3300053092 Ga0500583_0072592 Ga0500583_0072592_596_1375 248
236 3300053124 Ga0500617_019214 Ga0500617_019214_275_1054 248
237 3300053134 Ga0500658_0023342 Ga0500658_0023342_503_1282 248
238 3300053146 Ga0500588_0006712 Ga0500588_0006712_1187_1966 248
239 iso_pu_bacteria 2818991438 2819553228 248
240 3300001979 JGI24740J21852_10000098 JGI24740J21852_1000009812 249
241 3300001990 JGI24737J22298_10000085 JGI24737J22298_100000859 249
242 3300005339 Ga0070660_100000403 Ga0070660_10000040316 249
243 3300005344 Ga0070661_100070141 Ga0070661_1000701413 249
244 3300005366 Ga0070659_100001027 Ga0070659_10000102716 249
245 3300005539 Ga0068853_100001944 Ga0068853_1000019446 249
246 3300005564 Ga0070664_100003102 Ga0070664_1000031022 249
247 3300005614 Ga0068856_100737079 Ga0068856_1007370791 249
248 3300006195 Ga0075366_10128988 Ga0075366_101289881 249
249 3300006353 Ga0075370_10074679 Ga0075370_100746792 249
250 3300006946 Ga0079104_1021238 Ga0079104_10212382 249
251 3300007788 Ga0099795_10066451 Ga0099795_100664512 249
252 3300009093 Ga0105240_10205227 Ga0105240_102052273 249
253 3300009148 Ga0105243_10595764 Ga0105243_105957641 249
254 3300009174 Ga0105241_10001892 Ga0105241_100018923 249
255 3300010159 Ga0099796_10013227 Ga0099796_100132272 249
256 3300010375 Ga0105239_10408550 Ga0105239_104085502 249
257 3300013100 Ga0157373_10007676 Ga0157373_100076765 249
258 3300013102 Ga0157371_10000043 Ga0157371_1000004347 249
259 3300013104 Ga0157370_10041221 Ga0157370_100412213 249
260 3300013307 Ga0157372_10037043 Ga0157372_100370435 249
261 3300025321 Ga0207656_10001491 Ga0207656_100014913 249
262 3300025904 Ga0207647_10010209 Ga0207647_100102095 249
263 3300025911 Ga0207654_10001169 Ga0207654_100011696 249
264 3300025913 Ga0207695_10026407 Ga0207695_100264077 249
265 3300025914 Ga0207671_10049900 Ga0207671_100499001 249
266 3300025919 Ga0207657_10000583 Ga0207657_1000058323 249
267 3300025920 Ga0207649_10004310 Ga0207649_100043106 249
268 3300025924 Ga0207694_10010450 Ga0207694_100104503 249
269 3300025932 Ga0207690_10000296 Ga0207690_1000029619 249
270 3300025945 Ga0207679_10531931 Ga0207679_105319311 249
271 3300025949 Ga0207667_10000069 Ga0207667_10000069119 249
272 3300025949 Ga0207667_10029845 Ga0207667_100298457 249
273 3300025981 Ga0207640_10004138 Ga0207640_100041382 249
274 3300026041 Ga0207639_10005076 Ga0207639_100050766 249
275 3300026067 Ga0207678_10000240 Ga0207678_1000024014 249
276 3300026078 Ga0207702_10000868 Ga0207702_1000086811 249
277 3300026116 Ga0207674_10001563 Ga0207674_100015638 249
278 3300026142 Ga0207698_10000461 Ga0207698_1000046119 249
279 3300031901 Ga0307406_10037732 Ga0307406_100377322 249
280 3300031911 Ga0307412_10007974 Ga0307412_100079746 249
281 3300032002 Ga0307416_100303619 Ga0307416_1003036193 249
282 3300032004 Ga0307414_10029963 Ga0307414_100299632 249
283 3300032004 Ga0307414_10123469 Ga0307414_101234692 249
284 3300032005 Ga0307411_10132471 Ga0307411_101324712 249
285 3300044658 Ga0466972_0106974 Ga0466972_0106974_377_1174 249
286 3300044683 Ga0466965_0012178 Ga0466965_0012178_806_1585 249
287 3300044683 Ga0466965_0112332 Ga0466965_0112332_294_1064 249
288 3300044683 Ga0466965_0178653 Ga0466965_0178653_151_948 249
289 3300044684 Ga0466966_0022908 Ga0466966_0022908_1966_2763 249
290 3300044706 Ga0466964_0074352 Ga0466964_0074352_388_1167 249
291 3300044719 Ga0466971_0039989 Ga0466971_0039989_1223_2020 249
292 3300044735 Ga0466968_0036666 Ga0466968_0036666_805_1584 249
293 3300047472 Ga0495686_0000060 Ga0495686_0000060_169692_170453 249
294 3300048922 Ga0496119_0032192 Ga0496119_0032192_1796_2572 249
295 3300048924 Ga0496121_0000332 Ga0496121_0000332_3325_4083 249
296 3300048929 Ga0496126_0105726 Ga0496126_0105726_631_1395 249
297 3300049523 Ga0501300_000066 Ga0501300_000066_3522_4277 249
298 3300049653 Ga0501206_002176 Ga0501206_002176_173_928 249
299 3300049663 Ga0501223_000055 Ga0501223_000055_7672_8427 249
300 3300049664 Ga0501224_000002 Ga0501224_000002_7786_8541 249
301 3300049705 Ga0501225_0000654 Ga0501225_0000654_7793_8548 249
302 3300049706 Ga0501229_005186 Ga0501229_005186_408_1163 249
303 3300049707 Ga0501234_000162 Ga0501234_000162_1771_2526 249
304 3300049853 Ga0501226_000046 Ga0501226_000046_46094_46849 249
305 3300050496 nmdc:mga07m45_53774_c1 nmdc:mga07m45_53774_c1_589_1347 249
306 3300061719 Ga0466962_0033276 Ga0466962_0033276_907_1704 249
307 iso_pu_bacteria 2510917021 2511130363 249
308 iso_pu_bacteria 2738541275 2738708940 249
309 iso_pu_bacteria 2738541301 2738847365 249
310 iso_pu_bacteria 2738541304 2738863094 249
311 iso_pu_bacteria 2738543022 2739295612 249
312 iso_pu_bacteria 2738543033 2739357290 249
313 iso_pu_bacteria 2919138771 2919140298 249
314 iso_pu_bacteria 2928100450 2928102302 249
315 iso_pu_bacteria 2928959182 2928961196 249
316 iso_pu_bacteria 8054302542 8054304559 249
317 3300005842 Ga0068858_100016169 Ga0068858_1000161694 250
318 3300006931 Ga0097620_100003462 Ga0097620_10000346216 250
319 3300009176 Ga0105242_10177898 Ga0105242_101778982 250
320 3300009551 Ga0105238_10007472 Ga0105238_100074726 250
321 3300010375 Ga0105239_10297315 Ga0105239_102973153 250
322 3300013308 Ga0157375_10445427 Ga0157375_104454271 250
323 3300014968 Ga0157379_10095074 Ga0157379_100950742 250
324 3300025298 Ga0209050_1000915 Ga0209050_100091513 250
325 3300025924 Ga0207694_10024486 Ga0207694_100244865 250
326 3300025934 Ga0207686_10107890 Ga0207686_101078901 250
327 3300026035 Ga0207703_10000648 Ga0207703_1000064830 250
328 3300031456 Ga0307513_10004619 Ga0307513_1000461916 250
329 3300031616 Ga0307508_10000398 Ga0307508_1000039822 250
330 3300037471 Ga0395905_0185318 Ga0395905_0185318_245_1027 250
331 3300046492 Ga0495585_0163665 Ga0495585_0163665_277_1050 250
332 3300046512 Ga0495610_0001533 Ga0495610_0001533_443_1216 250
333 3300046522 Ga0495643_0000007 Ga0495643_0000007_52580_53353 250
334 3300048904 Ga0496101_0213676 Ga0496101_0213676_417_1181 250
335 3300048919 Ga0496116_0000361 Ga0496116_0000361_27082_27846 250
336 3300048924 Ga0496121_0001955 Ga0496121_0001955_26607_27371 250
337 3300048925 Ga0496122_0004877 Ga0496122_0004877_3559_4323 250
338 3300048926 Ga0496123_0001636 Ga0496123_0001636_27085_27849 250
339 3300048927 Ga0496124_0001840 Ga0496124_0001840_26895_27659 250
340 3300048927 Ga0496124_0006144 Ga0496124_0006144_9530_10294 250
341 3300048928 Ga0496125_0053144 Ga0496125_0053144_917_1681 250
342 3300048929 Ga0496126_0000136 Ga0496126_0000136_139668_140432 250
343 iso_pu_bacteria 2643221541 2643728232 250
344 iso_pu_bacteria 2643221605 2644036561 250
345 iso_pu_bacteria 2643221606 2644042819 250
346 iso_pu_bacteria 2643221671 2644395750 250
347 3300001976 JGI24752J21851_1000833 JGI24752J21851_10008334 251
348 3300001989 JGI24739J22299_10000299 JGI24739J22299_1000029910 251
349 3300001989 JGI24739J22299_10024695 JGI24739J22299_100246951 251
350 3300002067 JGI24735J21928_10020039 JGI24735J21928_100200392 251
351 3300002070 JGI24750J21931_1001412 JGI24750J21931_10014122 251
352 3300002074 JGI24748J21848_1000042 JGI24748J21848_100004255 251
353 3300002075 JGI24738J21930_10006300 JGI24738J21930_100063001 251
354 3300002239 JGI24034J26672_10000035 JGI24034J26672_1000003554 251
355 3300002459 JGI24751J29686_10000463 JGI24751J29686_1000046312 251
356 3300003781 Ga0055536_1003464 Ga0055536_10034642 251
357 3300003791 Ga0055530_10000184 Ga0055530_1000018416 251
358 3300003794 Ga0055531_10000439 Ga0055531_1000043930 251
359 3300005327 Ga0070658_10007829 Ga0070658_100078297 251
360 3300005327 Ga0070658_10389220 Ga0070658_103892201 251
361 3300005328 Ga0070676_10000512 Ga0070676_1000051214 251
362 3300005330 Ga0070690_100000009 Ga0070690_10000000983 251
363 3300005331 Ga0070670_100000046 Ga0070670_1000000469 251
364 3300005331 Ga0070670_100040805 Ga0070670_1000408052 251
365 3300005333 Ga0070677_10015444 Ga0070677_100154443 251
366 3300005334 Ga0068869_100003432 Ga0068869_1000034325 251
367 3300005335 Ga0070666_10000006 Ga0070666_10000006148 251
368 3300005338 Ga0068868_100020401 Ga0068868_1000204013 251
369 3300005339 Ga0070660_100632980 Ga0070660_1006329802 251
370 3300005340 Ga0070689_100064646 Ga0070689_1000646463 251
371 3300005344 Ga0070661_100053893 Ga0070661_1000538932 251
372 3300005347 Ga0070668_100000066 Ga0070668_10000006636 251
373 3300005347 Ga0070668_100047030 Ga0070668_1000470302 251
374 3300005353 Ga0070669_100000095 Ga0070669_10000009555 251
375 3300005364 Ga0070673_100006452 Ga0070673_1000064527 251
376 3300005365 Ga0070688_100008847 Ga0070688_1000088473 251
377 3300005367 Ga0070667_100031521 Ga0070667_1000315214 251
378 3300005456 Ga0070678_100090138 Ga0070678_1000901383 251
379 3300005457 Ga0070662_100003475 Ga0070662_1000034755 251
380 3300005457 Ga0070662_100063920 Ga0070662_1000639203 251
381 3300005459 Ga0068867_100004028 Ga0068867_1000040286 251
382 3300005466 Ga0070685_10000155 Ga0070685_1000015533 251
383 3300005535 Ga0070684_100173716 Ga0070684_1001737161 251
384 3300005539 Ga0068853_100017909 Ga0068853_1000179092 251
385 3300005539 Ga0068853_100213336 Ga0068853_1002133362 251
386 3300005543 Ga0070672_100024584 Ga0070672_1000245842 251
387 3300005544 Ga0070686_100000091 Ga0070686_10000009157 251
388 3300005548 Ga0070665_100000019 Ga0070665_100000019235 251
389 3300005563 Ga0068855_100015208 Ga0068855_1000152089 251
390 3300005577 Ga0068857_100087824 Ga0068857_1000878242 251
391 3300005577 Ga0068857_100121824 Ga0068857_1001218242 251
392 3300005578 Ga0068854_100000276 Ga0068854_10000027628 251
393 3300005578 Ga0068854_100002104 Ga0068854_1000021044 251
394 3300005578 Ga0068854_100173709 Ga0068854_1001737092 251
395 3300005578 Ga0068854_100826096 Ga0068854_1008260961 251
396 3300005614 Ga0068856_100017997 Ga0068856_1000179977 251
397 3300005616 Ga0068852_100000071 Ga0068852_10000007119 251
398 3300005617 Ga0068859_100419542 Ga0068859_1004195423 251
399 3300005618 Ga0068864_100001627 Ga0068864_1000016272 251
400 3300005719 Ga0068861_100043720 Ga0068861_1000437202 251
401 3300005719 Ga0068861_100124593 Ga0068861_1001245933 251
402 3300005834 Ga0068851_10132421 Ga0068851_101324211 251
403 3300005841 Ga0068863_100000118 Ga0068863_10000011881 251
404 3300005842 Ga0068858_100002727 Ga0068858_10000272714 251
405 3300005843 Ga0068860_100000014 Ga0068860_100000014147 251
406 3300005844 Ga0068862_100000503 Ga0068862_1000005034 251
407 3300006195 Ga0075366_10023716 Ga0075366_100237163 251
408 3300006931 Ga0097620_100419523 Ga0097620_1004195231 251
409 3300009093 Ga0105240_10003822 Ga0105240_1000382222 251
410 3300009093 Ga0105240_10389258 Ga0105240_103892582 251
411 3300009098 Ga0105245_10025979 Ga0105245_100259795 251
412 3300009101 Ga0105247_10043177 Ga0105247_100431773 251
413 3300009147 Ga0114129_10347923 Ga0114129_103479232 251
414 3300009177 Ga0105248_10021753 Ga0105248_100217532 251
415 3300009545 Ga0105237_10259201 Ga0105237_102592012 251
416 3300009551 Ga0105238_10006129 Ga0105238_100061297 251
417 3300009551 Ga0105238_10029557 Ga0105238_100295572 251
418 3300009551 Ga0105238_10404560 Ga0105238_104045602 251
419 3300009553 Ga0105249_10000035 Ga0105249_10000035186 251
420 3300009553 Ga0105249_10437342 Ga0105249_104373421 251
421 3300013104 Ga0157370_10019760 Ga0157370_100197604 251
422 3300013105 Ga0157369_10062226 Ga0157369_100622263 251
423 3300013306 Ga0163162_10083511 Ga0163162_100835112 251
424 3300013308 Ga0157375_10038826 Ga0157375_100388265 251
425 3300014325 Ga0163163_10096476 Ga0163163_100964763 251
426 3300014326 Ga0157380_10001255 Ga0157380_100012553 251
427 3300014968 Ga0157379_10016226 Ga0157379_100162267 251
428 3300017792 Ga0163161_10000102 Ga0163161_1000010270 251
429 3300025291 Ga0209675_1000258 Ga0209675_100025842 251
430 3300025292 Ga0209676_1000683 Ga0209676_100068320 251
431 3300025292 Ga0209676_1000720 Ga0209676_100072019 251
432 3300025292 Ga0209676_1015127 Ga0209676_10151272 251
433 3300025294 Ga0209025_1021732 Ga0209025_10217322 251
434 3300025298 Ga0209050_1000310 Ga0209050_100031018 251
435 3300025304 Ga0209257_1000379 Ga0209257_10003797 251
436 3300025304 Ga0209257_1006820 Ga0209257_10068204 251
437 3300025321 Ga0207656_10011930 Ga0207656_100119302 251
438 3300025893 Ga0207682_10023519 Ga0207682_100235193 251
439 3300025903 Ga0207680_10000011 Ga0207680_10000011145 251
440 3300025904 Ga0207647_10012353 Ga0207647_100123535 251
441 3300025904 Ga0207647_10216364 Ga0207647_102163642 251
442 3300025907 Ga0207645_10004396 Ga0207645_100043967 251
443 3300025909 Ga0207705_10000296 Ga0207705_1000029629 251
444 3300025911 Ga0207654_10001340 Ga0207654_100013404 251
445 3300025913 Ga0207695_10072612 Ga0207695_100726122 251
446 3300025913 Ga0207695_10086641 Ga0207695_100866412 251
447 3300025914 Ga0207671_10002654 Ga0207671_100026543 251
448 3300025914 Ga0207671_10162765 Ga0207671_101627652 251
449 3300025919 Ga0207657_10062202 Ga0207657_100622021 251
450 3300025922 Ga0207646_10325260 Ga0207646_103252601 251
451 3300025923 Ga0207681_10000112 Ga0207681_1000011227 251
452 3300025924 Ga0207694_10020714 Ga0207694_100207144 251
453 3300025924 Ga0207694_10041297 Ga0207694_100412971 251
454 3300025924 Ga0207694_10576758 Ga0207694_105767581 251
455 3300025925 Ga0207650_10000008 Ga0207650_1000000843 251
456 3300025925 Ga0207650_10206672 Ga0207650_102066722 251
457 3300025925 Ga0207650_10279421 Ga0207650_102794212 251
458 3300025926 Ga0207659_10027595 Ga0207659_100275952 251
459 3300025927 Ga0207687_10018431 Ga0207687_100184315 251
460 3300025933 Ga0207706_10002108 Ga0207706_100021087 251
461 3300025933 Ga0207706_10098086 Ga0207706_100980862 251
462 3300025940 Ga0207691_10003410 Ga0207691_100034103 251
463 3300025941 Ga0207711_10026509 Ga0207711_100265092 251
464 3300025941 Ga0207711_10105833 Ga0207711_101058333 251
465 3300025942 Ga0207689_10012842 Ga0207689_100128426 251
466 3300025949 Ga0207667_10013615 Ga0207667_100136152 251
467 3300025960 Ga0207651_10014384 Ga0207651_100143844 251
468 3300025961 Ga0207712_10000013 Ga0207712_10000013145 251
469 3300025972 Ga0207668_10000055 Ga0207668_1000005556 251
470 3300025981 Ga0207640_10001910 Ga0207640_100019102 251
471 3300025981 Ga0207640_10157039 Ga0207640_101570391 251
472 3300025981 Ga0207640_10381350 Ga0207640_103813501 251
473 3300025986 Ga0207658_10006451 Ga0207658_100064512 251
474 3300025986 Ga0207658_10013719 Ga0207658_100137196 251
475 3300026035 Ga0207703_10002616 Ga0207703_100026168 251
476 3300026035 Ga0207703_10017243 Ga0207703_100172436 251
477 3300026041 Ga0207639_10303236 Ga0207639_103032362 251
478 3300026067 Ga0207678_10065385 Ga0207678_100653852 251
479 3300026078 Ga0207702_10006810 Ga0207702_100068102 251
480 3300026078 Ga0207702_10227492 Ga0207702_102274922 251
481 3300026088 Ga0207641_10000101 Ga0207641_1000010173 251
482 3300026089 Ga0207648_10007593 Ga0207648_100075933 251
483 3300026095 Ga0207676_10000397 Ga0207676_1000039730 251
484 3300026095 Ga0207676_10001444 Ga0207676_100014445 251
485 3300026116 Ga0207674_10046373 Ga0207674_100463735 251
486 3300026116 Ga0207674_10061013 Ga0207674_100610134 251
487 3300026116 Ga0207674_10172706 Ga0207674_101727062 251
488 3300026121 Ga0207683_10236955 Ga0207683_102369553 251
489 3300026142 Ga0207698_10000062 Ga0207698_1000006253 251
490 3300027665 Ga0209983_1052778 Ga0209983_10527781 251
491 3300027876 Ga0209974_10004368 Ga0209974_100043684 251
492 3300028379 Ga0268266_10000025 Ga0268266_10000025265 251
493 3300028380 Ga0268265_10000316 Ga0268265_1000031628 251
494 3300028381 Ga0268264_10000037 Ga0268264_10000037145 251
495 3300028381 Ga0268264_10002651 Ga0268264_100026519 251
496 3300028381 Ga0268264_10006013 Ga0268264_1000601311 251
497 3300031548 Ga0307408_100299064 Ga0307408_1002990642 251
498 3300031731 Ga0307405_10042629 Ga0307405_100426293 251
499 3300031731 Ga0307405_10148191 Ga0307405_101481912 251
500 3300031731 Ga0307405_10171726 Ga0307405_101717262 251
501 3300031901 Ga0307406_10047013 Ga0307406_100470133 251
502 3300031901 Ga0307406_10114049 Ga0307406_101140492 251
503 3300031911 Ga0307412_10097198 Ga0307412_100971982 251
504 3300031911 Ga0307412_10192145 Ga0307412_101921451 251
505 3300032002 Ga0307416_100089757 Ga0307416_1000897573 251
506 3300032004 Ga0307414_10001195 Ga0307414_100011957 251
507 3300032004 Ga0307414_10003519 Ga0307414_100035193 251
508 3300032005 Ga0307411_10124910 Ga0307411_101249102 251
509 3300033180 Ga0307510_10058718 Ga0307510_100587186 251
510 3300037471 Ga0395905_0230494 Ga0395905_0230494_339_1130 251
511 3300041512 Ga0451853_3988941 Ga0451853_3988941_32_805 251
512 3300046500 Ga0495596_0000881 Ga0495596_0000881_5418_6194 251
513 3300046500 Ga0495596_0001988 Ga0495596_0001988_3574_4356 251
514 3300046501 Ga0495607_0022910 Ga0495607_0022910_1050_1832 251
515 3300046512 Ga0495610_0004653 Ga0495610_0004653_1682_2458 251
516 3300046522 Ga0495643_0003970 Ga0495643_0003970_3984_4775 251
517 3300046538 Ga0495609_0005653 Ga0495609_0005653_941_1723 251
518 3300046660 Ga0495625_0007145 Ga0495625_0007145_8824_9612 251
519 3300047472 Ga0495686_0168119 Ga0495686_0168119_395_1177 251
520 3300048090 Ga0495615_0000003 Ga0495615_0000003_80755_81531 251
521 3300048091 Ga0495626_0001183 Ga0495626_0001183_10832_11608 251
522 3300048904 Ga0496101_0517173 Ga0496101_0517173_168_923 251
523 3300048905 Ga0496102_0000260 Ga0496102_0000260_25818_26579 251
524 3300048905 Ga0496102_0007197 Ga0496102_0007197_1230_1985 251
525 3300048906 Ga0496103_0000171 Ga0496103_0000171_25817_26578 251
526 3300048906 Ga0496103_0001942 Ga0496103_0001942_3826_4581 251
527 3300048908 Ga0496105_0380469 Ga0496105_0380469_342_1103 251
528 3300048919 Ga0496116_0001021 Ga0496116_0001021_25817_26578 251
529 3300048919 Ga0496116_0079469 Ga0496116_0079469_1264_2019 251
530 3300048920 Ga0496117_0000121 Ga0496117_0000121_144954_145715 251
531 3300048920 Ga0496117_0015136 Ga0496117_0015136_417_1172 251
532 3300048921 Ga0496118_0000095 Ga0496118_0000095_25818_26579 251
533 3300048921 Ga0496118_0017124 Ga0496118_0017124_5107_5862 251
534 3300048922 Ga0496119_0022130 Ga0496119_0022130_1725_2486 251
535 3300048923 Ga0496120_0038568 Ga0496120_0038568_388_1149 251
536 3300048924 Ga0496121_0003110 Ga0496121_0003110_18338_19207 251
537 3300048925 Ga0496122_0009543 Ga0496122_0009543_47_823 251
538 3300048926 Ga0496123_0002464 Ga0496123_0002464_15748_16524 251
539 3300048927 Ga0496124_0000119 Ga0496124_0000119_25818_26579 251
540 3300048927 Ga0496124_0039106 Ga0496124_0039106_74_850 251
541 3300048927 Ga0496124_0066304 Ga0496124_0066304_949_1704 251
542 3300050493 nmdc:mga0k408_22284_c1 nmdc:mga0k408_22284_c1_1194_1988 251
543 3300050507 nmdc:mga05p37_321460_c1 nmdc:mga05p37_321460_c1_175_948 251
544 3300053087 Ga0500643_028862 Ga0500643_028862_370_1146 251
545 3300053087 Ga0500643_054392 Ga0500643_054392_48_827 251
546 3300053118 Ga0500594_0003025 Ga0500594_0003025_15_794 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

43

253

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.7105 7 90
4yo7-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi-511484) with bound myo-inositol 0.7002 8 91
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.6787 9 249
1scj-assembly1.cif.gz_A crystal structure of subtilisin-propeptide complex 0.6726 51 94
5e9a-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6683 9 251
ID Description Score Start End Superfamily
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7053 7 249 3.40.50.880
af_A4ID28_560_673_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6906 8 90 3.40.50.2300
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6824 7 249 3.40.50.880
5e9aB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6811 9 251 3.40.50.880
af_Q2G1L6_30_350_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6787 1 251 3.40.50.880
ID Description Score Start End GO Terms
AF-B8KSQ4-F1-model_v4 ThuA-like domain-containing protein 0.9923 9 247
AF-A0A849HMN1-F1-model_v4 ThuA domain-containing protein 0.9864 7 249
AF-A0A6L8HXA6-F1-model_v4 ThuA domain-containing protein 0.9855 7 71
AF-A0A6L8A003-F1-model_v4 ThuA domain-containing protein 0.983 10 250
AF-A0A382Y2S2-F1-model_v4 ThuA-like domain-containing protein 0.9829 7 92

Feature Viewer

pLDDT pTM Quality
95.85 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map