F461982

General Info

Members Datasets Scaffolds Average Seq Length
546 267 1092 89

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100967814|Ga0075435_1009678141
Length 98
Sequence MGWRVVVNMDWKILTTVFASVFIAELGDKTQLATLLFASDKEISKLTVFAGASLALILTSALGVLAGGVLSNYISEKHLHYLAGIGFIAIGVWSLVKA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
178 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
225 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
226 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
227 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
228 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
229 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
239 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
240 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
244 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
245 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
251 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
255 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.56
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 28.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100967814 3300007076 Bacteria 743
2 Ga0065714_10064435 3300005288 Bacteria 121919
3 Ga0065712_10280951 3300005290 Bacteria 896
4 Ga0065712_10685357 3300005290 Bacteria 553
5 Ga0065715_11121700 3300005293 Bacteria 515
6 Ga0065707_10000913 3300005295 Bacteria 17655
7 Ga0070690_100061192 3300005330 Bacteria 2425
8 Ga0070670_100200911 3300005331 Unclassified 1732
9 Ga0070670_101839002 3300005331 Bacteria 558
10 Ga0068869_100410011 3300005334 Bacteria 1116
11 Ga0070680_101505428 3300005336 Bacteria 583
12 Ga0070682_101838007 3300005337 Bacteria 529
13 Ga0070689_100333356 3300005340 Unclassified 1269
14 Ga0070689_101088953 3300005340 Bacteria 714
15 Ga0070689_101167691 3300005340 Unclassified 690
16 Ga0070687_100143425 3300005343 Bacteria 1394
17 Ga0070668_101441810 3300005347 Bacteria 628
18 Ga0070669_100062411 3300005353 Bacteria 2740
19 Ga0070669_100079204 3300005353 Unclassified 2443
20 Ga0070675_101297202 3300005354 Bacteria 671
21 Ga0070671_101643371 3300005355 Unclassified 570
22 Ga0070671_101980922 3300005355 Bacteria 518
23 Ga0070674_100090129 3300005356 Unclassified 2211
24 Ga0070674_100832187 3300005356 Bacteria 799
25 Ga0070673_100910727 3300005364 Bacteria 816
26 Ga0070673_101489376 3300005364 Bacteria 638
27 Ga0070673_101974012 3300005364 Bacteria 554
28 Ga0070688_100881541 3300005365 Bacteria 705
29 Ga0070688_101201061 3300005365 Bacteria 609
30 Ga0070703_10122819 3300005406 Unclassified 944
31 Ga0070709_11402356 3300005434 Bacteria 566
32 Ga0070705_100722260 3300005440 Bacteria 785
33 Ga0070705_101382204 3300005440 Bacteria 586
34 Ga0070705_101801285 3300005440 Unclassified 519
35 Ga0070694_100002102 3300005444 Bacteria 11808
36 Ga0070694_100408782 3300005444 Unclassified 1064
37 Ga0070694_100498478 3300005444 Unclassified 969
38 Ga0070694_100514116 3300005444 Bacteria 954
39 Ga0070694_100779291 3300005444 Bacteria 783
40 Ga0070708_100439261 3300005445 Bacteria 1231
41 Ga0070708_100693372 3300005445 Unclassified 959
42 Ga0070708_101130734 3300005445 Unclassified 733
43 Ga0070708_101868274 3300005445 Bacteria 557
44 Ga0070662_100140774 3300005457 Bacteria 1869
45 Ga0070662_100954103 3300005457 Bacteria 733
46 Ga0070662_102003482 3300005457 Bacteria 500
47 Ga0070681_10028068 3300005458 Bacteria 5657
48 Ga0068867_100206862 3300005459 Bacteria 1574
49 Ga0068867_100499827 3300005459 Bacteria 1045
50 Ga0068867_100622031 3300005459 Bacteria 944
51 Ga0068867_100891030 3300005459 Bacteria 800
52 Ga0070685_10608193 3300005466 Bacteria 787
53 Ga0070706_100058929 3300005467 Bacteria 3544
54 Ga0070706_100254012 3300005467 Bacteria 1641
55 Ga0070706_100799460 3300005467 Bacteria 873
56 Ga0070706_101108218 3300005467 Unclassified 729
57 Ga0070707_100014544 3300005468 Bacteria 7378
58 Ga0070707_100080764 3300005468 Bacteria 3139
59 Ga0070707_100600970 3300005468 Unclassified 1062
60 Ga0070707_101274488 3300005468 Unclassified 701
61 Ga0070698_100068372 3300005471 Bacteria 3570
62 Ga0070698_100115416 3300005471 Bacteria 2650
63 Ga0070698_100337664 3300005471 Bacteria 1438
64 Ga0070698_100773583 3300005471 Unclassified 903
65 Ga0070698_102213393 3300005471 Unclassified 503
66 Ga0070699_100012074 3300005518 Bacteria 7453
67 Ga0070699_100229189 3300005518 Bacteria 1656
68 Ga0070699_101784959 3300005518 Bacteria 563
69 Ga0070679_100121557 3300005530 Bacteria 2596
70 Ga0070697_100000535 3300005536 Bacteria 28563
71 Ga0070697_100023206 3300005536 Unclassified 4934
72 Ga0070697_100273611 3300005536 Unclassified 1448
73 Ga0070697_100338681 3300005536 Unclassified 1298
74 Ga0070697_100383982 3300005536 Bacteria 1217
75 Ga0070697_100429311 3300005536 Bacteria 1149
76 Ga0070697_101061000 3300005536 Unclassified 721
77 Ga0068853_100390397 3300005539 Bacteria 1301
78 Ga0070686_100065548 3300005544 Bacteria 2360
79 Ga0070686_100204177 3300005544 Bacteria 1419
80 Ga0070686_101096678 3300005544 Bacteria 657
81 Ga0070695_100023054 3300005545 Bacteria 3821
82 Ga0070695_100116321 3300005545 Bacteria 1823
83 Ga0070695_100117905 3300005545 Unclassified 1812
84 Ga0070695_100374946 3300005545 Bacteria 1072
85 Ga0070695_100394165 3300005545 Bacteria 1048
86 Ga0070695_101165690 3300005545 Unclassified 633
87 Ga0070696_100073877 3300005546 Unclassified 2403
88 Ga0070696_100091343 3300005546 Bacteria 2168
89 Ga0070696_100618184 3300005546 Bacteria 875
90 Ga0070696_100860360 3300005546 Bacteria 750
91 Ga0070693_100373444 3300005547 Unclassified 982
92 Ga0070693_100739658 3300005547 Bacteria 724
93 Ga0070693_100965718 3300005547 Bacteria 642
94 Ga0070704_100014222 3300005549 Bacteria 4967
95 Ga0070704_100096100 3300005549 Bacteria 2220
96 Ga0070704_100398226 3300005549 Bacteria 1174
97 Ga0070704_100686626 3300005549 Bacteria 907
98 Ga0070704_102090932 3300005549 Bacteria 526
99 Ga0070664_101987133 3300005564 Unclassified 552
100 Ga0068857_101749323 3300005577 Bacteria 608
101 Ga0068857_102191866 3300005577 Bacteria 542
102 Ga0068854_100568192 3300005578 Unclassified 964
103 Ga0068854_101133082 3300005578 Bacteria 698
104 Ga0068859_100010191 3300005617 Bacteria 9460
105 Ga0068859_100666540 3300005617 Bacteria 1132
106 Ga0068859_101387149 3300005617 Unclassified 775
107 Ga0068864_100079523 3300005618 Bacteria 2871
108 Ga0068864_100237518 3300005618 Bacteria 1688
109 Ga0068866_10060247 3300005718 Unclassified 1967
110 Ga0068861_100001436 3300005719 Bacteria 15053
111 Ga0068861_100411671 3300005719 Bacteria 1202
112 Ga0068870_10601864 3300005840 Bacteria 747
113 Ga0068863_100037661 3300005841 Bacteria 4603
114 Ga0068858_102437786 3300005842 Bacteria 517
115 Ga0068860_100025879 3300005843 Bacteria 5660
116 Ga0068860_100347784 3300005843 Unclassified 1458
117 Ga0068860_101239640 3300005843 Bacteria 766
118 Ga0081455_10015575 3300005937 Bacteria 7380
119 Ga0081455_10521614 3300005937 Bacteria 793
120 Ga0081455_10564913 3300005937 Unclassified 749
121 Ga0081538_10043121 3300005981 Bacteria 2838
122 Ga0070717_10345202 3300006028 Bacteria 1330
123 Ga0070715_10194297 3300006163 Bacteria 1027
124 Ga0070716_101493702 3300006173 Bacteria 552
125 Ga0097621_101055091 3300006237 Unclassified 762
126 Ga0068871_100036469 3300006358 Bacteria 3915
127 Ga0068871_101759565 3300006358 Bacteria 588
128 Ga0068871_102312687 3300006358 Bacteria 512
129 Ga0075428_100004121 3300006844 Bacteria 16002
130 Ga0075428_100346969 3300006844 Bacteria 1593
131 Ga0075428_100930470 3300006844 Bacteria 921
132 Ga0075428_101009223 3300006844 Unclassified 881
133 Ga0075428_102169274 3300006844 Unclassified 573
134 Ga0075430_100502026 3300006846 Bacteria 1001
135 Ga0075430_100511525 3300006846 Unclassified 991
136 Ga0075430_100640420 3300006846 Unclassified 877
137 Ga0075430_100909978 3300006846 Bacteria 725
138 Ga0075431_100000038 3300006847 Bacteria 68191
139 Ga0075431_100034184 3300006847 Bacteria 5239
140 Ga0075431_100049980 3300006847 Bacteria 4311
141 Ga0075431_100148256 3300006847 Bacteria 2416
142 Ga0075431_100424526 3300006847 Unclassified 1328
143 Ga0075433_10085919 3300006852 Bacteria 2778
144 Ga0075433_10461419 3300006852 Unclassified 1119
145 Ga0075433_10494329 3300006852 Bacteria 1077
146 Ga0075434_100192772 3300006871 Unclassified 2058
147 Ga0075434_101204457 3300006871 Unclassified 769
148 Ga0075434_102103746 3300006871 Bacteria 569
149 Ga0075434_102190422 3300006871 Bacteria 557
150 Ga0075429_100005554 3300006880 Bacteria 10862
151 Ga0075429_100077823 3300006880 Bacteria 2890
152 Ga0075429_100587899 3300006880 Unclassified 975
153 Ga0075429_100901133 3300006880 Bacteria 774
154 Ga0075429_100958076 3300006880 Unclassified 748
155 Ga0075429_101421462 3300006880 Bacteria 604
156 Ga0068865_100111230 3300006881 Unclassified 2021
157 Ga0097620_100010191 3300006931 Bacteria 9460
158 Ga0097620_100666631 3300006931 Bacteria 1132
159 Ga0097620_101387554 3300006931 Unclassified 775
160 Ga0075435_100392694 3300007076 Unclassified 1192
161 Ga0075435_100728184 3300007076 Unclassified 862
162 Ga0105240_10719836 3300009093 Bacteria 1088
163 Ga0105240_11365485 3300009093 Unclassified 746
164 Ga0105240_11434646 3300009093 Bacteria 725
165 Ga0111539_10140794 3300009094 Bacteria 2824
166 Ga0111539_10174955 3300009094 Bacteria 2507
167 Ga0111539_10653745 3300009094 Bacteria 1224
168 Ga0111539_11288019 3300009094 Bacteria 848
169 Ga0111539_12158209 3300009094 Unclassified 646
170 Ga0111539_12629423 3300009094 Bacteria 583
171 Ga0105245_10459315 3300009098 Bacteria 1283
172 Ga0105245_11780398 3300009098 Unclassified 669
173 Ga0105247_10077095 3300009101 Unclassified 2094
174 Ga0114129_10009756 3300009147 Bacteria 13694
175 Ga0114129_10029406 3300009147 Bacteria 7783
176 Ga0114129_10058475 3300009147 Bacteria 5392
177 Ga0114129_10125175 3300009147 Bacteria 3535
178 Ga0114129_10138414 3300009147 Bacteria 3339
179 Ga0114129_10363915 3300009147 Bacteria 1913
180 Ga0114129_10899268 3300009147 Bacteria 1122
181 Ga0114129_11185927 3300009147 Unclassified 952
182 Ga0105243_10198983 3300009148 Bacteria 1756
183 Ga0105243_10607131 3300009148 Bacteria 1054
184 Ga0105243_12818565 3300009148 Unclassified 527
185 Ga0105241_10035486 3300009174 Bacteria 3751
186 Ga0105241_11217350 3300009174 Unclassified 714
187 Ga0105242_10235115 3300009176 Unclassified 1644
188 Ga0105248_10324143 3300009177 Unclassified 1735
189 Ga0105248_11657392 3300009177 Unclassified 725
190 Ga0105237_10155789 3300009545 Bacteria 2281
191 Ga0105249_10332558 3300009553 Unclassified 1533
192 Ga0105249_12141887 3300009553 Bacteria 632
193 Ga0157374_10645169 3300013296 Unclassified 1070
194 Ga0157374_10727110 3300013296 Bacteria 1007
195 Ga0157378_10009379 3300013297 Bacteria 8527
196 Ga0157378_10079456 3300013297 Bacteria 2961
197 Ga0157378_10089275 3300013297 Bacteria 2799
198 Ga0157378_10179919 3300013297 Bacteria 1988
199 Ga0157378_11897770 3300013297 Bacteria 645
200 Ga0157378_12204419 3300013297 Unclassified 602
201 Ga0157378_12946364 3300013297 Bacteria 528
202 Ga0163162_10007168 3300013306 Bacteria 10824
203 Ga0163162_12286546 3300013306 Bacteria 621
204 Ga0163162_12829976 3300013306 Unclassified 558
205 Ga0157375_10267756 3300013308 Bacteria 1870
206 Ga0157375_10645822 3300013308 Bacteria 1215
207 Ga0157375_11034432 3300013308 Bacteria 960
208 Ga0157375_11076535 3300013308 Bacteria 940
209 Ga0157375_12410876 3300013308 Bacteria 628
210 Ga0157375_12661811 3300013308 Bacteria 598
211 Ga0163163_10002192 3300014325 Bacteria 16438
212 Ga0163163_10842573 3300014325 Unclassified 980
213 Ga0157380_10036865 3300014326 Bacteria 3786
214 Ga0157380_10105529 3300014326 Bacteria 2355
215 Ga0157380_10343617 3300014326 Bacteria 1393
216 Ga0157380_10471277 3300014326 Bacteria 1212
217 Ga0157380_12850193 3300014326 Unclassified 550
218 Ga0157379_10453403 3300014968 Bacteria 1184
219 Ga0157376_10233574 3300014969 Unclassified 1709
220 Ga0163161_10040270 3300017792 Bacteria 3356
221 Ga0207653_10092867 3300025885 Unclassified 1059
222 Ga0207653_10448111 3300025885 Bacteria 507
223 Ga0207710_10155539 3300025900 Bacteria 1111
224 Ga0207688_10968864 3300025901 Bacteria 538
225 Ga0207647_10562387 3300025904 Unclassified 632
226 Ga0207685_10049349 3300025905 Bacteria 1616
227 Ga0207685_10074444 3300025905 Bacteria 1386
228 Ga0207685_10204199 3300025905 Bacteria 930
229 Ga0207645_11232349 3300025907 Unclassified 502
230 Ga0207643_10296355 3300025908 Bacteria 1006
231 Ga0207684_10543639 3300025910 Bacteria 994
232 Ga0207684_10545291 3300025910 Bacteria 992
233 Ga0207684_10805370 3300025910 Bacteria 794
234 Ga0207684_11366834 3300025910 Unclassified 581
235 Ga0207707_10318043 3300025912 Bacteria 1344
236 Ga0207707_11055334 3300025912 Bacteria 664
237 Ga0207695_10658065 3300025913 Bacteria 928
238 Ga0207695_11756810 3300025913 Bacteria 501
239 Ga0207671_10107978 3300025914 Bacteria 2115
240 Ga0207660_10476199 3300025917 Bacteria 1011
241 Ga0207660_11471195 3300025917 Bacteria 551
242 Ga0207662_10174528 3300025918 Unclassified 1380
243 Ga0207662_10219353 3300025918 Bacteria 1238
244 Ga0207662_10251974 3300025918 Bacteria 1159
245 Ga0207662_10289158 3300025918 Bacteria 1087
246 Ga0207652_10041851 3300025921 Bacteria 3897
247 Ga0207646_10016400 3300025922 Bacteria 6950
248 Ga0207646_10069780 3300025922 Bacteria 3139
249 Ga0207646_10102997 3300025922 Unclassified 2559
250 Ga0207681_10120460 3300025923 Bacteria 1924
251 Ga0207681_10157670 3300025923 Bacteria 1707
252 Ga0207650_10380387 3300025925 Bacteria 1166
253 Ga0207659_10503159 3300025926 Bacteria 1026
254 Ga0207659_10588992 3300025926 Bacteria 947
255 Ga0207659_11451444 3300025926 Unclassified 587
256 Ga0207690_11804016 3300025932 Unclassified 511
257 Ga0207706_11443438 3300025933 Bacteria 563
258 Ga0207686_11245760 3300025934 Unclassified 610
259 Ga0207670_10615190 3300025936 Bacteria 893
260 Ga0207670_10971420 3300025936 Unclassified 714
261 Ga0207669_10107736 3300025937 Unclassified 1859
262 Ga0207704_10103316 3300025938 Unclassified 1906
263 Ga0207711_10045926 3300025941 Bacteria 3732
264 Ga0207651_10400974 3300025960 Unclassified 1167
265 Ga0207651_10762831 3300025960 Bacteria 856
266 Ga0207651_11186568 3300025960 Bacteria 685
267 Ga0207712_10415112 3300025961 Bacteria 1134
268 Ga0207708_10541572 3300026075 Unclassified 981
269 Ga0207641_10150534 3300026088 Unclassified 2107
270 Ga0207648_10181763 3300026089 Unclassified 1862
271 Ga0207648_10207261 3300026089 Bacteria 1740
272 Ga0207648_10443100 3300026089 Bacteria 1182
273 Ga0207648_10949774 3300026089 Bacteria 804
274 Ga0207676_12115343 3300026095 Unclassified 561
275 Ga0207674_11532600 3300026116 Bacteria 635
276 Ga0207675_100003627 3300026118 Bacteria 15059
277 Ga0207675_100064683 3300026118 Unclassified 3419
278 Ga0207675_100823712 3300026118 Bacteria 942
279 Ga0209984_1023123 3300027424 Bacteria 858
280 Ga0209970_1005854 3300027614 Bacteria 2020
281 Ga0209971_1006339 3300027682 Unclassified 2801
282 Ga0209813_10252124 3300027866 Bacteria 671
283 Ga0209974_10031803 3300027876 Bacteria 1748
284 Ga0209974_10125484 3300027876 Unclassified 912
285 Ga0207428_10000009 3300027907 Bacteria 410565
286 Ga0207428_10055883 3300027907 Bacteria 3137
287 Ga0207428_10728395 3300027907 Bacteria 708
288 Ga0268266_12105552 3300028379 Unclassified 537
289 Ga0268265_10272700 3300028380 Bacteria 1510
290 Ga0268264_10408047 3300028381 Unclassified 1307
291 Ga0268264_11300139 3300028381 Bacteria 737
292 Ga0268264_11598806 3300028381 Bacteria 662
293 Ga0265326_10027874 3300028558 Bacteria 1610
294 Ga0265319_1005301 3300028563 Bacteria 6198
295 Ga0265334_10016945 3300028573 Bacteria 3013
296 Ga0265318_10000061 3300028577 Bacteria 108688
297 Ga0265338_10354282 3300028800 Bacteria 1054
298 Ga0265324_10269027 3300029957 Bacteria 579
299 Ga0265330_10005459 3300031235 Bacteria 6343
300 Ga0265332_10001592 3300031238 Bacteria 12437
301 Ga0265328_10001320 3300031239 Bacteria 11449
302 Ga0265320_10006346 3300031240 Bacteria 7455
303 Ga0265325_10310855 3300031241 Bacteria 702
304 Ga0265329_10000188 3300031242 Bacteria 31672
305 Ga0265339_10030606 3300031249 Bacteria 3047
306 Ga0265331_10001193 3300031250 Bacteria 19661
307 Ga0265316_10000710 3300031344 Bacteria 36726
308 Ga0265316_10083250 3300031344 Bacteria 2451
309 Ga0307408_100003612 3300031548 Bacteria 10539
310 Ga0265313_10332928 3300031595 Bacteria 604
311 Ga0316575_10315148 3300031665 Unclassified 663
312 Ga0316579_10140842 3300031691 Bacteria 1162
313 Ga0265314_10002305 3300031711 Bacteria 19718
314 Ga0265342_10000991 3300031712 Bacteria 27985
315 Ga0316576_10109954 3300031727 Bacteria 2066
316 Ga0316576_10529535 3300031727 Bacteria 865
317 Ga0316578_10164476 3300031728 Bacteria 1337
318 Ga0316578_10215096 3300031728 Unclassified 1156
319 Ga0307405_10256265 3300031731 Unclassified 1304
320 Ga0307405_10394531 3300031731 Bacteria 1081
321 Ga0307413_10111399 3300031824 Bacteria 1833
322 Ga0307413_11019857 3300031824 Bacteria 710
323 Ga0307413_11165978 3300031824 Unclassified 668
324 Ga0307410_10102113 3300031852 Unclassified 2057
325 Ga0307410_10182764 3300031852 Bacteria 1589
326 Ga0307410_10682327 3300031852 Bacteria 864
327 Ga0307410_11028183 3300031852 Bacteria 711
328 Ga0307406_10000578 3300031901 Bacteria 21116
329 Ga0307406_10254809 3300031901 Bacteria 1324
330 Ga0307407_10163782 3300031903 Unclassified 1458
331 Ga0307407_10833861 3300031903 Bacteria 703
332 Ga0307412_10003104 3300031911 Bacteria 9221
333 Ga0307412_10038799 3300031911 Unclassified 3070
334 Ga0307412_11523768 3300031911 Bacteria 608
335 Ga0307409_100029817 3300031995 Unclassified 3911
336 Ga0307409_100271774 3300031995 Bacteria 1561
337 Ga0307409_100993015 3300031995 Bacteria 857
338 Ga0307409_101175902 3300031995 Bacteria 790
339 Ga0307416_100002833 3300032002 Bacteria 10091
340 Ga0307416_100006320 3300032002 Bacteria 7408
341 Ga0307416_102254109 3300032002 Bacteria 645
342 Ga0307414_10003090 3300032004 Bacteria 8839
343 Ga0307414_11377860 3300032004 Bacteria 655
344 Ga0307411_10336824 3300032005 Unclassified 1224
345 Ga0307411_10738110 3300032005 Bacteria 861
346 Ga0307415_100001307 3300032126 Bacteria 11780
347 Ga0307415_100022905 3300032126 Unclassified 3866
348 Ga0373948_0137975 3300034817 Bacteria 601
349 Ga0373938_0017228 3300034957 Bacteria 1421
350 Ga0373940_0021444 3300035088 Bacteria 1651
351 Ga0373940_0030283 3300035088 Bacteria 1439
352 Ga0373949_0025180 3300035090 Bacteria 1387
353 Ga0373949_0071645 3300035090 Bacteria 909
354 Ga0373939_0010738 3300035114 Bacteria 2298
355 Ga0373939_0068792 3300035114 Bacteria 1147
356 Ga0373942_0050697 3300035207 Bacteria 1163
357 Ga0373961_0132501 3300035241 Bacteria 836
358 Ga0373962_0017697 3300035242 Bacteria 1849
359 Ga0316574_0039928 3300035398 Bacteria 2888
360 Ga0316574_0043243 3300035398 Bacteria 2783
361 Ga0316574_0095148 3300035398 Bacteria 1903
362 Ga0316574_0144982 3300035398 Bacteria 1530
363 Ga0373931_0003692 3300035691 Bacteria 6928
364 Ga0373933_1021207 3300035724 Unclassified 545
365 Ga0373937_1599783 3300036401 Unclassified 599
366 Ga0316582_0366642 3300036647 Bacteria 991
367 Ga0316584_0797371 3300036712 Unclassified 642
368 Ga0316584_0867479 3300036712 Unclassified 610
369 Ga0316581_0082396 3300037588 Bacteria 990
370 Ga0400488_33751 3300038741 Bacteria 29765
371 Ga0400483_068246 3300039062 Bacteria 1381
372 Ga0400483_207593 3300039062 Bacteria 1972
373 Ga0436365_1266695 3300039437 Bacteria 1509
374 Ga0439458_0013654 3300042157 Bacteria 1829
375 Ga0439460_0027007 3300042461 Bacteria 1610
376 Ga0451577_0151605 3300042876 Bacteria 2086
377 Ga0453683_0037368 3300044673 Bacteria 3056
378 Ga0453684_0890563 3300044712 Bacteria 954
379 Ga0451576_0409260 3300045051 Bacteria 1422
380 Ga0495629_0909024 3300046459 Bacteria 577
381 Ga0495580_0000546 3300046472 Bacteria 31815
382 Ga0495586_0598807 3300046535 Bacteria 637
383 Ga0495581_0548461 3300047315 Bacteria 671
384 Ga0495636_0445386 3300047318 Bacteria 621
385 Ga0496104_0075274 3300048907 Bacteria 3215
386 Ga0496104_0206124 3300048907 Bacteria 1878
387 Ga0496104_0558215 3300048907 Bacteria 1056
388 Ga0496105_1000547 3300048908 Unclassified 625
389 Ga0496106_1003530 3300048909 Unclassified 656
390 Ga0496108_0435314 3300048911 Unclassified 1145
391 Ga0496108_1325621 3300048911 Bacteria 605
392 Ga0496109_0248998 3300048912 Unclassified 1673
393 Ga0496111_1012972 3300048914 Bacteria 595
394 Ga0496112_0497515 3300048915 Bacteria 1155
395 Ga0496112_0617904 3300048915 Bacteria 1015
396 Ga0496112_1480158 3300048915 Unclassified 593
397 Ga0496113_0788011 3300048916 Bacteria 756
398 Ga0496114_1680520 3300048917 Unclassified 523
399 Ga0501292_022995 3300049515 Unclassified 1017
400 Ga0501325_054160 3300049541 Bacteria 517
401 Ga0501031_0384256 3300049568 Bacteria 908
402 Ga0501033_0008897 3300049570 Bacteria 7756
403 Ga0501033_1081345 3300049570 Unclassified 534
404 Ga0501036_0076824 3300049572 Bacteria 2825
405 Ga0501036_0179528 3300049572 Bacteria 1782
406 Ga0501036_1147430 3300049572 Unclassified 634
407 Ga0501037_0170882 3300049573 Bacteria 1545
408 Ga0501038_0133572 3300049574 Bacteria 2035
409 Ga0501038_0191895 3300049574 Bacteria 1643
410 Ga0501039_0004501 3300049575 Bacteria 10525
411 Ga0501039_0031070 3300049575 Bacteria 4117
412 Ga0501039_0050772 3300049575 Bacteria 3209
413 Ga0501039_0223028 3300049575 Bacteria 1482
414 Ga0501040_0006047 3300049576 Bacteria 7838
415 Ga0501041_0000218 3300049577 Bacteria 26770
416 Ga0501041_0105330 3300049577 Bacteria 1748
417 Ga0501041_0840196 3300049577 Bacteria 589
418 Ga0501042_0061843 3300049578 Bacteria 2674
419 Ga0501042_0110221 3300049578 Bacteria 1982
420 Ga0501042_0305299 3300049578 Unclassified 1150
421 Ga0501043_0017538 3300049579 Bacteria 5613
422 Ga0501043_0424824 3300049579 Bacteria 1001
423 Ga0501046_0240104 3300049580 Bacteria 1336
424 Ga0501048_0469200 3300049582 Bacteria 902
425 Ga0501068_0106125 3300049584 Bacteria 1744
426 Ga0501069_0967258 3300049585 Bacteria 519
427 Ga0501071_0010067 3300049587 Bacteria 6320
428 Ga0501071_0206950 3300049587 Bacteria 1475
429 Ga0501071_0296905 3300049587 Bacteria 1224
430 Ga0501071_0429147 3300049587 Bacteria 1010
431 Ga0501071_0658751 3300049587 Unclassified 806
432 Ga0501072_0143075 3300049588 Bacteria 1907
433 Ga0501072_0233101 3300049588 Bacteria 1466
434 Ga0501072_0488468 3300049588 Unclassified 974
435 Ga0501073_0974222 3300049589 Unclassified 584
436 Ga0501074_0780124 3300049590 Bacteria 674
437 Ga0501075_0016782 3300049591 Bacteria 5280
438 Ga0501075_0034580 3300049591 Bacteria 3763
439 Ga0501075_0060999 3300049591 Bacteria 2841
440 Ga0501075_0424865 3300049591 Unclassified 1013
441 Ga0501076_0054172 3300049592 Bacteria 3178
442 Ga0501076_0133977 3300049592 Bacteria 2011
443 Ga0501076_0612066 3300049592 Bacteria 899
444 Ga0501076_0626483 3300049592 Bacteria 887
445 Ga0501077_0218500 3300049593 Bacteria 1211
446 Ga0501077_0297346 3300049593 Bacteria 1028
447 Ga0501077_0449327 3300049593 Bacteria 825
448 Ga0501077_0558600 3300049593 Bacteria 735
449 Ga0501077_0649730 3300049593 Bacteria 678
450 Ga0501198_005615 3300049649 Unclassified 1770
451 Ga0501202_004419 3300049652 Unclassified 2461
452 Ga0501207_002239 3300049654 Unclassified 2485
453 Ga0501208_011943 3300049655 Unclassified 1265
454 Ga0501209_033374 3300049656 Unclassified 1320
455 Ga0501216_010300 3300049660 Unclassified 1501
456 Ga0501217_000924 3300049661 Bacteria 5251
457 Ga0501223_002194 3300049663 Unclassified 4379
458 Ga0501224_024887 3300049664 Unclassified 894
459 Ga0501227_000370 3300049665 Bacteria 9439
460 Ga0501230_000545 3300049667 Unclassified 3881
461 Ga0501233_002952 3300049668 Unclassified 3036
462 Ga0501243_002709 3300049675 Unclassified 2609
463 Ga0501249_048932 3300049679 Unclassified 968
464 Ga0501251_022602 3300049681 Unclassified 846
465 Ga0501259_006855 3300049688 Unclassified 1818
466 Ga0501261_074739 3300049690 Unclassified 601
467 Ga0501221_016794 3300049704 Unclassified 1390
468 Ga0501225_0016490 3300049705 Unclassified 2054
469 Ga0501225_0049148 3300049705 Bacteria 1172
470 Ga0501229_003395 3300049706 Unclassified 1910
471 Ga0501234_000506 3300049707 Bacteria 5986
472 Ga0501245_003271 3300049708 Unclassified 2195
473 Ga0501079_0000621 3300049741 Bacteria 23559
474 Ga0501079_0031174 3300049741 Bacteria 4097
475 Ga0501079_0422669 3300049741 Unclassified 1046
476 Ga0501079_0859222 3300049741 Unclassified 714
477 Ga0501080_0023271 3300049742 Bacteria 5744
478 Ga0501080_0806986 3300049742 Bacteria 823
479 Ga0501081_0066818 3300049743 Unclassified 2501
480 Ga0501081_0203439 3300049743 Bacteria 1436
481 Ga0501081_0235484 3300049743 Bacteria 1334
482 Ga0501081_0998535 3300049743 Bacteria 632
483 Ga0501083_0039052 3300049744 Bacteria 3225
484 Ga0501267_047437 3300049764 Unclassified 551
485 Ga0501273_006305 3300049770 Unclassified 1369
486 Ga0501035_0027382 3300049822 Bacteria 5211
487 Ga0501035_0128881 3300049822 Bacteria 2207
488 Ga0501035_0506339 3300049822 Bacteria 993
489 Ga0501045_0156522 3300049824 Bacteria 1695
490 Ga0501045_1076226 3300049824 Bacteria 588
491 Ga0501204_031409 3300049850 Unclassified 740
492 Ga0501226_001168 3300049853 Unclassified 3406
493 nmdc:mga05p37_1308818_c1 3300050507 Unclassified 738
494 nmdc:mga05p37_155775_c1 3300050507 Bacteria 2792
495 nmdc:mga05p37_182205_c1 3300050507 Unclassified 2555
496 nmdc:mga05p37_190328_c1 3300050507 Bacteria 2492
497 nmdc:mga05p37_2226030_c1 3300050507 Bacteria 508
498 nmdc:mga05p37_292178_c1 3300050507 Unclassified 1940
499 nmdc:mga05p37_331067_c1 3300050507 Bacteria 1799
500 nmdc:mga05p37_6136_c1 3300050507 Bacteria 14148
501 nmdc:mga05p37_67957_c1 3300050507 Bacteria 4383
502 nmdc:mga09592_102369_c1 3300050508 Unclassified 2453
503 nmdc:mga09592_134586_c1 3300050508 Bacteria 2128
504 nmdc:mga09592_205754_c1 3300050508 Bacteria 1705
505 nmdc:mga09592_602327_c1 3300050508 Bacteria 941
506 nmdc:mga09592_70267_c1 3300050508 Unclassified 2971
507 nmdc:mga0qj67_291184_c2 3300050509 Unclassified 851
508 nmdc:mga0qj67_323132_c1 3300050509 Bacteria 1249
509 nmdc:mga0qj67_938018_c1 3300050509 Bacteria 681
510 nmdc:mga06r32_1305900_c1 3300050510 Bacteria 669
511 nmdc:mga06r32_1335400_c1 3300050510 Bacteria 660
512 nmdc:mga06r32_25420_c1 3300050510 Bacteria 5510
513 nmdc:mga06r32_356112_c1 3300050510 Bacteria 1448
514 nmdc:mga06r32_387168_c1 3300050510 Unclassified 1381
515 nmdc:mga06r32_71929_c1 3300050510 Unclassified 3348
516 nmdc:mga08y16_118045_c1 3300050511 Bacteria 2761
517 nmdc:mga08y16_256953_c1 3300050511 Bacteria 1804
518 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
519 nmdc:mga08y16_436043_c1 3300050511 Bacteria 1338
520 nmdc:mga0n895_1389431_c1 3300050512 Unclassified 671
521 nmdc:mga0n895_152233_c1 3300050512 Bacteria 2343
522 nmdc:mga0n895_1840364_c1 3300050512 Bacteria 565
523 nmdc:mga0n895_208125_c1 3300050512 Unclassified 1987
524 nmdc:mga0n895_277188_c1 3300050512 Unclassified 1701
525 nmdc:mga0rr50_1163562_c1 3300050513 Unclassified 656
526 nmdc:mga0rr50_1750003_c1 3300050513 Unclassified 523
527 nmdc:mga0rr50_356319_c1 3300050513 Bacteria 1231
528 nmdc:mga0rr50_373050_c1 3300050513 Bacteria 1202
529 nmdc:mga0rr50_586148_c1 3300050513 Bacteria 950
530 nmdc:mga0rr50_994156_c1 3300050513 Unclassified 715
531 nmdc:mga08x19_720589_c1 3300050514 Unclassified 708
532 nmdc:mga0a205_266570_c1 3300050515 Bacteria 1590
533 nmdc:mga0a205_301389_c1 3300050515 Unclassified 1476
534 nmdc:mga0a205_428334_c1 3300050515 Unclassified 1184
535 nmdc:mga0a205_441641_c1 3300050515 Bacteria 1162
536 Ga0501084_0018752 3300054114 Bacteria 5761
537 Ga0501084_0053572 3300054114 Bacteria 3375
538 Ga0501084_0066183 3300054114 Bacteria 3023
539 Ga0501084_0505533 3300054114 Unclassified 1021
540 Ga0501082_0163332 3300060353 Bacteria 1935
541 Ga0501082_1858936 3300060353 Unclassified 525
542 Ga0530510_0001244 3300061734 Bacteria 17001
543 Ga0530510_0055261 3300061734 Bacteria 2868
544 Ga0530510_0059279 3300061734 Bacteria 2769
545 Ga0530510_0127396 3300061734 Bacteria 1872
546 Ga0530510_0332280 3300061734 Bacteria 1140
547 Ga0075435_100967814
548 Ga0065714_10064435
549 Ga0065712_10280951
550 Ga0065712_10685357
551 Ga0065715_11121700
552 Ga0065707_10000913
553 Ga0070690_100061192
554 Ga0070670_100200911
555 Ga0070670_101839002
556 Ga0068869_100410011
557 Ga0070680_101505428
558 Ga0070682_101838007
559 Ga0070689_100333356
560 Ga0070689_101088953
561 Ga0070689_101167691
562 Ga0070687_100143425
563 Ga0070668_101441810
564 Ga0070669_100062411
565 Ga0070669_100079204
566 Ga0070675_101297202
567 Ga0070671_101643371
568 Ga0070671_101980922
569 Ga0070674_100090129
570 Ga0070674_100832187
571 Ga0070673_100910727
572 Ga0070673_101489376
573 Ga0070673_101974012
574 Ga0070688_100881541
575 Ga0070688_101201061
576 Ga0070703_10122819
577 Ga0070709_11402356
578 Ga0070705_100722260
579 Ga0070705_101382204
580 Ga0070705_101801285
581 Ga0070694_100002102
582 Ga0070694_100408782
583 Ga0070694_100498478
584 Ga0070694_100514116
585 Ga0070694_100779291
586 Ga0070708_100439261
587 Ga0070708_100693372
588 Ga0070708_101130734
589 Ga0070708_101868274
590 Ga0070662_100140774
591 Ga0070662_100954103
592 Ga0070662_102003482
593 Ga0070681_10028068
594 Ga0068867_100206862
595 Ga0068867_100499827
596 Ga0068867_100622031
597 Ga0068867_100891030
598 Ga0070685_10608193
599 Ga0070706_100058929
600 Ga0070706_100254012
601 Ga0070706_100799460
602 Ga0070706_101108218
603 Ga0070707_100014544
604 Ga0070707_100080764
605 Ga0070707_100600970
606 Ga0070707_101274488
607 Ga0070698_100068372
608 Ga0070698_100115416
609 Ga0070698_100337664
610 Ga0070698_100773583
611 Ga0070698_102213393
612 Ga0070699_100012074
613 Ga0070699_100229189
614 Ga0070699_101784959
615 Ga0070679_100121557
616 Ga0070697_100000535
617 Ga0070697_100023206
618 Ga0070697_100273611
619 Ga0070697_100338681
620 Ga0070697_100383982
621 Ga0070697_100429311
622 Ga0070697_101061000
623 Ga0068853_100390397
624 Ga0070686_100065548
625 Ga0070686_100204177
626 Ga0070686_101096678
627 Ga0070695_100023054
628 Ga0070695_100116321
629 Ga0070695_100117905
630 Ga0070695_100374946
631 Ga0070695_100394165
632 Ga0070695_101165690
633 Ga0070696_100073877
634 Ga0070696_100091343
635 Ga0070696_100618184
636 Ga0070696_100860360
637 Ga0070693_100373444
638 Ga0070693_100739658
639 Ga0070693_100965718
640 Ga0070704_100014222
641 Ga0070704_100096100
642 Ga0070704_100398226
643 Ga0070704_100686626
644 Ga0070704_102090932
645 Ga0070664_101987133
646 Ga0068857_101749323
647 Ga0068857_102191866
648 Ga0068854_100568192
649 Ga0068854_101133082
650 Ga0068859_100010191
651 Ga0068859_100666540
652 Ga0068859_101387149
653 Ga0068864_100079523
654 Ga0068864_100237518
655 Ga0068866_10060247
656 Ga0068861_100001436
657 Ga0068861_100411671
658 Ga0068870_10601864
659 Ga0068863_100037661
660 Ga0068858_102437786
661 Ga0068860_100025879
662 Ga0068860_100347784
663 Ga0068860_101239640
664 Ga0081455_10015575
665 Ga0081455_10521614
666 Ga0081455_10564913
667 Ga0081538_10043121
668 Ga0070717_10345202
669 Ga0070715_10194297
670 Ga0070716_101493702
671 Ga0097621_101055091
672 Ga0068871_100036469
673 Ga0068871_101759565
674 Ga0068871_102312687
675 Ga0075428_100004121
676 Ga0075428_100346969
677 Ga0075428_100930470
678 Ga0075428_101009223
679 Ga0075428_102169274
680 Ga0075430_100502026
681 Ga0075430_100511525
682 Ga0075430_100640420
683 Ga0075430_100909978
684 Ga0075431_100000038
685 Ga0075431_100034184
686 Ga0075431_100049980
687 Ga0075431_100148256
688 Ga0075431_100424526
689 Ga0075433_10085919
690 Ga0075433_10461419
691 Ga0075433_10494329
692 Ga0075434_100192772
693 Ga0075434_101204457
694 Ga0075434_102103746
695 Ga0075434_102190422
696 Ga0075429_100005554
697 Ga0075429_100077823
698 Ga0075429_100587899
699 Ga0075429_100901133
700 Ga0075429_100958076
701 Ga0075429_101421462
702 Ga0068865_100111230
703 Ga0097620_100010191
704 Ga0097620_100666631
705 Ga0097620_101387554
706 Ga0075435_100392694
707 Ga0075435_100728184
708 Ga0105240_10719836
709 Ga0105240_11365485
710 Ga0105240_11434646
711 Ga0111539_10140794
712 Ga0111539_10174955
713 Ga0111539_10653745
714 Ga0111539_11288019
715 Ga0111539_12158209
716 Ga0111539_12629423
717 Ga0105245_10459315
718 Ga0105245_11780398
719 Ga0105247_10077095
720 Ga0114129_10009756
721 Ga0114129_10029406
722 Ga0114129_10058475
723 Ga0114129_10125175
724 Ga0114129_10138414
725 Ga0114129_10363915
726 Ga0114129_10899268
727 Ga0114129_11185927
728 Ga0105243_10198983
729 Ga0105243_10607131
730 Ga0105243_12818565
731 Ga0105241_10035486
732 Ga0105241_11217350
733 Ga0105242_10235115
734 Ga0105248_10324143
735 Ga0105248_11657392
736 Ga0105237_10155789
737 Ga0105249_10332558
738 Ga0105249_12141887
739 Ga0157374_10645169
740 Ga0157374_10727110
741 Ga0157378_10009379
742 Ga0157378_10079456
743 Ga0157378_10089275
744 Ga0157378_10179919
745 Ga0157378_11897770
746 Ga0157378_12204419
747 Ga0157378_12946364
748 Ga0163162_10007168
749 Ga0163162_12286546
750 Ga0163162_12829976
751 Ga0157375_10267756
752 Ga0157375_10645822
753 Ga0157375_11034432
754 Ga0157375_11076535
755 Ga0157375_12410876
756 Ga0157375_12661811
757 Ga0163163_10002192
758 Ga0163163_10842573
759 Ga0157380_10036865
760 Ga0157380_10105529
761 Ga0157380_10343617
762 Ga0157380_10471277
763 Ga0157380_12850193
764 Ga0157379_10453403
765 Ga0157376_10233574
766 Ga0163161_10040270
767 Ga0207653_10092867
768 Ga0207653_10448111
769 Ga0207710_10155539
770 Ga0207688_10968864
771 Ga0207647_10562387
772 Ga0207685_10049349
773 Ga0207685_10074444
774 Ga0207685_10204199
775 Ga0207645_11232349
776 Ga0207643_10296355
777 Ga0207684_10543639
778 Ga0207684_10545291
779 Ga0207684_10805370
780 Ga0207684_11366834
781 Ga0207707_10318043
782 Ga0207707_11055334
783 Ga0207695_10658065
784 Ga0207695_11756810
785 Ga0207671_10107978
786 Ga0207660_10476199
787 Ga0207660_11471195
788 Ga0207662_10174528
789 Ga0207662_10219353
790 Ga0207662_10251974
791 Ga0207662_10289158
792 Ga0207652_10041851
793 Ga0207646_10016400
794 Ga0207646_10069780
795 Ga0207646_10102997
796 Ga0207681_10120460
797 Ga0207681_10157670
798 Ga0207650_10380387
799 Ga0207659_10503159
800 Ga0207659_10588992
801 Ga0207659_11451444
802 Ga0207690_11804016
803 Ga0207706_11443438
804 Ga0207686_11245760
805 Ga0207670_10615190
806 Ga0207670_10971420
807 Ga0207669_10107736
808 Ga0207704_10103316
809 Ga0207711_10045926
810 Ga0207651_10400974
811 Ga0207651_10762831
812 Ga0207651_11186568
813 Ga0207712_10415112
814 Ga0207708_10541572
815 Ga0207641_10150534
816 Ga0207648_10181763
817 Ga0207648_10207261
818 Ga0207648_10443100
819 Ga0207648_10949774
820 Ga0207676_12115343
821 Ga0207674_11532600
822 Ga0207675_100003627
823 Ga0207675_100064683
824 Ga0207675_100823712
825 Ga0209984_1023123
826 Ga0209970_1005854
827 Ga0209971_1006339
828 Ga0209813_10252124
829 Ga0209974_10031803
830 Ga0209974_10125484
831 Ga0207428_10000009
832 Ga0207428_10055883
833 Ga0207428_10728395
834 Ga0268266_12105552
835 Ga0268265_10272700
836 Ga0268264_10408047
837 Ga0268264_11300139
838 Ga0268264_11598806
839 Ga0265326_10027874
840 Ga0265319_1005301
841 Ga0265334_10016945
842 Ga0265318_10000061
843 Ga0265338_10354282
844 Ga0265324_10269027
845 Ga0265330_10005459
846 Ga0265332_10001592
847 Ga0265328_10001320
848 Ga0265320_10006346
849 Ga0265325_10310855
850 Ga0265329_10000188
851 Ga0265339_10030606
852 Ga0265331_10001193
853 Ga0265316_10000710
854 Ga0265316_10083250
855 Ga0307408_100003612
856 Ga0265313_10332928
857 Ga0316575_10315148
858 Ga0316579_10140842
859 Ga0265314_10002305
860 Ga0265342_10000991
861 Ga0316576_10109954
862 Ga0316576_10529535
863 Ga0316578_10164476
864 Ga0316578_10215096
865 Ga0307405_10256265
866 Ga0307405_10394531
867 Ga0307413_10111399
868 Ga0307413_11019857
869 Ga0307413_11165978
870 Ga0307410_10102113
871 Ga0307410_10182764
872 Ga0307410_10682327
873 Ga0307410_11028183
874 Ga0307406_10000578
875 Ga0307406_10254809
876 Ga0307407_10163782
877 Ga0307407_10833861
878 Ga0307412_10003104
879 Ga0307412_10038799
880 Ga0307412_11523768
881 Ga0307409_100029817
882 Ga0307409_100271774
883 Ga0307409_100993015
884 Ga0307409_101175902
885 Ga0307416_100002833
886 Ga0307416_100006320
887 Ga0307416_102254109
888 Ga0307414_10003090
889 Ga0307414_11377860
890 Ga0307411_10336824
891 Ga0307411_10738110
892 Ga0307415_100001307
893 Ga0307415_100022905
894 Ga0373948_0137975
895 Ga0373938_0017228
896 Ga0373940_0021444
897 Ga0373940_0030283
898 Ga0373949_0025180
899 Ga0373949_0071645
900 Ga0373939_0010738
901 Ga0373939_0068792
902 Ga0373942_0050697
903 Ga0373961_0132501
904 Ga0373962_0017697
905 Ga0316574_0039928
906 Ga0316574_0043243
907 Ga0316574_0095148
908 Ga0316574_0144982
909 Ga0373931_0003692
910 Ga0373933_1021207
911 Ga0373937_1599783
912 Ga0316582_0366642
913 Ga0316584_0797371
914 Ga0316584_0867479
915 Ga0316581_0082396
916 Ga0400488_33751
917 Ga0400483_068246
918 Ga0400483_207593
919 Ga0436365_1266695
920 Ga0439458_0013654
921 Ga0439460_0027007
922 Ga0451577_0151605
923 Ga0453683_0037368
924 Ga0453684_0890563
925 Ga0451576_0409260
926 Ga0495629_0909024
927 Ga0495580_0000546
928 Ga0495586_0598807
929 Ga0495581_0548461
930 Ga0495636_0445386
931 Ga0496104_0075274
932 Ga0496104_0206124
933 Ga0496104_0558215
934 Ga0496105_1000547
935 Ga0496106_1003530
936 Ga0496108_0435314
937 Ga0496108_1325621
938 Ga0496109_0248998
939 Ga0496111_1012972
940 Ga0496112_0497515
941 Ga0496112_0617904
942 Ga0496112_1480158
943 Ga0496113_0788011
944 Ga0496114_1680520
945 Ga0501292_022995
946 Ga0501325_054160
947 Ga0501031_0384256
948 Ga0501033_0008897
949 Ga0501033_1081345
950 Ga0501036_0076824
951 Ga0501036_0179528
952 Ga0501036_1147430
953 Ga0501037_0170882
954 Ga0501038_0133572
955 Ga0501038_0191895
956 Ga0501039_0004501
957 Ga0501039_0031070
958 Ga0501039_0050772
959 Ga0501039_0223028
960 Ga0501040_0006047
961 Ga0501041_0000218
962 Ga0501041_0105330
963 Ga0501041_0840196
964 Ga0501042_0061843
965 Ga0501042_0110221
966 Ga0501042_0305299
967 Ga0501043_0017538
968 Ga0501043_0424824
969 Ga0501046_0240104
970 Ga0501048_0469200
971 Ga0501068_0106125
972 Ga0501069_0967258
973 Ga0501071_0010067
974 Ga0501071_0206950
975 Ga0501071_0296905
976 Ga0501071_0429147
977 Ga0501071_0658751
978 Ga0501072_0143075
979 Ga0501072_0233101
980 Ga0501072_0488468
981 Ga0501073_0974222
982 Ga0501074_0780124
983 Ga0501075_0016782
984 Ga0501075_0034580
985 Ga0501075_0060999
986 Ga0501075_0424865
987 Ga0501076_0054172
988 Ga0501076_0133977
989 Ga0501076_0612066
990 Ga0501076_0626483
991 Ga0501077_0218500
992 Ga0501077_0297346
993 Ga0501077_0449327
994 Ga0501077_0558600
995 Ga0501077_0649730
996 Ga0501198_005615
997 Ga0501202_004419
998 Ga0501207_002239
999 Ga0501208_011943
1000 Ga0501209_033374
1001 Ga0501216_010300
1002 Ga0501217_000924
1003 Ga0501223_002194
1004 Ga0501224_024887
1005 Ga0501227_000370
1006 Ga0501230_000545
1007 Ga0501233_002952
1008 Ga0501243_002709
1009 Ga0501249_048932
1010 Ga0501251_022602
1011 Ga0501259_006855
1012 Ga0501261_074739
1013 Ga0501221_016794
1014 Ga0501225_0016490
1015 Ga0501225_0049148
1016 Ga0501229_003395
1017 Ga0501234_000506
1018 Ga0501245_003271
1019 Ga0501079_0000621
1020 Ga0501079_0031174
1021 Ga0501079_0422669
1022 Ga0501079_0859222
1023 Ga0501080_0023271
1024 Ga0501080_0806986
1025 Ga0501081_0066818
1026 Ga0501081_0203439
1027 Ga0501081_0235484
1028 Ga0501081_0998535
1029 Ga0501083_0039052
1030 Ga0501267_047437
1031 Ga0501273_006305
1032 Ga0501035_0027382
1033 Ga0501035_0128881
1034 Ga0501035_0506339
1035 Ga0501045_0156522
1036 Ga0501045_1076226
1037 Ga0501204_031409
1038 Ga0501226_001168
1039 nmdc:mga05p37_1308818_c1
1040 nmdc:mga05p37_155775_c1
1041 nmdc:mga05p37_182205_c1
1042 nmdc:mga05p37_190328_c1
1043 nmdc:mga05p37_2226030_c1
1044 nmdc:mga05p37_292178_c1
1045 nmdc:mga05p37_331067_c1
1046 nmdc:mga05p37_6136_c1
1047 nmdc:mga05p37_67957_c1
1048 nmdc:mga09592_102369_c1
1049 nmdc:mga09592_134586_c1
1050 nmdc:mga09592_205754_c1
1051 nmdc:mga09592_602327_c1
1052 nmdc:mga09592_70267_c1
1053 nmdc:mga0qj67_291184_c2
1054 nmdc:mga0qj67_323132_c1
1055 nmdc:mga0qj67_938018_c1
1056 nmdc:mga06r32_1305900_c1
1057 nmdc:mga06r32_1335400_c1
1058 nmdc:mga06r32_25420_c1
1059 nmdc:mga06r32_356112_c1
1060 nmdc:mga06r32_387168_c1
1061 nmdc:mga06r32_71929_c1
1062 nmdc:mga08y16_118045_c1
1063 nmdc:mga08y16_256953_c1
1064 nmdc:mga08y16_40_c1
1065 nmdc:mga08y16_436043_c1
1066 nmdc:mga0n895_1389431_c1
1067 nmdc:mga0n895_152233_c1
1068 nmdc:mga0n895_1840364_c1
1069 nmdc:mga0n895_208125_c1
1070 nmdc:mga0n895_277188_c1
1071 nmdc:mga0rr50_1163562_c1
1072 nmdc:mga0rr50_1750003_c1
1073 nmdc:mga0rr50_356319_c1
1074 nmdc:mga0rr50_373050_c1
1075 nmdc:mga0rr50_586148_c1
1076 nmdc:mga0rr50_994156_c1
1077 nmdc:mga08x19_720589_c1
1078 nmdc:mga0a205_266570_c1
1079 nmdc:mga0a205_301389_c1
1080 nmdc:mga0a205_428334_c1
1081 nmdc:mga0a205_441641_c1
1082 Ga0501084_0018752
1083 Ga0501084_0053572
1084 Ga0501084_0066183
1085 Ga0501084_0505533
1086 Ga0501082_0163332
1087 Ga0501082_1858936
1088 Ga0530510_0001244
1089 Ga0530510_0055261
1090 Ga0530510_0059279
1091 Ga0530510_0127396
1092 Ga0530510_0332280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01169

UPF0016

Uncharacterized protein family UPF0016

15

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z1u-assembly1.cif.gz_M bovine atp synthase f1c8-peripheral stalk domain, state 3 0.327 2 66
8asp-assembly1.cif.gz_f rcii/psi complex, focused refinement of psi 0.3206 1 64
6z1u-assembly1.cif.gz_M bovine atp synthase f1c8-peripheral stalk domain, state 3 0.2878 2 66
4jq5-assembly2.cif.gz_E crystal structure of the human nup49ccs2+3* coiled-coil segment 0.2461 4 79
8asp-assembly1.cif.gz_f rcii/psi complex, focused refinement of psi 0.2297 1 64
ID Description Score Start End Superfamily
af_Q96QE2_73_430_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6353 25 88 1.20.1250.20
af_Q7YWS1_44_312_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5349 1 63 1.20.1070.10
4ysxG00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5254 6 76 1.20.1300.10
af_Q96QE2_73_430_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4832 25 88 1.20.1250.20
af_Q7YWS1_44_312_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4134 1 63 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A0G1GYY1-F1-model_v4 GDT1 family protein 0.6635 8 84 GO:0016020
GO:0046873
AF-A0A1Q2ZU34-F1-model_v4 GDT1 family protein 0.6356 7 89 GO:0000329
GO:0005384
GO:0005794
GO:0015085
GO:0032468
GO:0032472
AF-A0A7J7PEG9-F1-model_v4 Uncharacterized protein 0.6147 5 81 GO:0016020
AF-A0A3T1DR84-F1-model_v4 deleted 0.5905 6 82
AF-A0A1Q2ZU34-F1-model_v4 GDT1 family protein 0.586 7 89 GO:0000329
GO:0005384
GO:0005794
GO:0015085
GO:0032468
GO:0032472

Map