F461425

General Info

Members Datasets Scaffolds Average Seq Length
541 348 486 254

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0103968|Ga0501035_0103968_1021_1908
Length 295
Sequence LIEAIHYTDISNSVAECWQIIRLNERVIFAGLWEFECREASMSSNRKIALITGASRGLGRNTAVSLARKGVDVIGTYHSNKAEADETVAAIKALGRKAVMVQLDTGNVASFSAFAQAVRTALKSIWSRDSFDYLVNNAGIGIHSPFAETSEADFDRLMNIHFKGVFFLTQTLLPLIANGGRIVNLSSGLARFCMPGFAAYAAMKGAIEVLTRYLAKELGPRGIAVNTVAPGAIATDFGGGSVRDNKQLNDFVASVTALGRVGLPDDIGPAIANLLTDENGWINAQRIEVSGGMFV

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
6 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
7 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
8 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
9 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
10 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
11 2643221559 Lysobacter sp. Root559 Isolate Unclassified
12 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
13 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
14 2643221586 Lysobacter sp. Root667 Isolate Unclassified
15 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
16 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
17 2643221611 Acidovorax sp. Root219 Isolate Unclassified
18 2643221612 Lysobacter sp. Root76 Isolate Unclassified
19 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
20 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
21 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
22 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
23 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
24 2643221720 Lysobacter sp. Root916 Isolate Unclassified
25 2643221727 Lysobacter sp. Root96 Isolate Unclassified
26 2643221728 Lysobacter sp. Root983 Isolate Unclassified
27 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
28 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
33 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
34 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
35 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
36 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
37 2842733646 Variovorax sp. R-72446 Isolate Unclassified
38 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
39 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
40 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
41 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
42 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
43 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
44 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
45 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
46 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
47 2904504865 Serratia marcescens 1822 Isolate Unclassified
48 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
49 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
50 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
51 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
52 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
53 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
59 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
60 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
61 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
113 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
114 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
218 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
219 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
292 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
309 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
310 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
331 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
340 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
348 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.46
Metatranscriptomes 0.37
Isolates 10.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.85
Nodule 0.74
Rhizoplane 4.62
Rhizosphere 62.29
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1004528 3300002738 Bacteria 2466
2 JGI25157J39369_1001901 3300002741 Bacteria 6363
3 JGI25165J46597_1000095 3300003214 Bacteria 163883
4 rootH1_10017904 3300003323 Bacteria 2649
5 rootH1_10097210 3300003323 Bacteria 4053
6 rootH1_10139221 3300003323 Bacteria 2352
7 Ga0055538_1000047 3300003751 Bacteria 135637
8 Ga0055539_1000067 3300003752 Bacteria 135637
9 Ga0055539_1001185 3300003752 Bacteria 5311
10 Ga0055533_1000077 3300003756 Bacteria 135637
11 Ga0055533_1001511 3300003756 Bacteria 6078
12 Ga0055532_1000282 3300003758 Bacteria 32708
13 Ga0055525_1000027 3300003759 Bacteria 340506
14 Ga0055525_1000101 3300003759 Bacteria 135637
15 Ga0055527_1000041 3300003760 Bacteria 116981
16 Ga0055527_1000196 3300003760 Bacteria 40200
17 Ga0055535_1000375 3300003761 Bacteria 42689
18 Ga0055535_1000414 3300003761 Bacteria 40196
19 Ga0055535_1000419 3300003761 Bacteria 40090
20 Ga0055542_1000215 3300003762 Bacteria 70610
21 Ga0055542_1000433 3300003762 Bacteria 40200
22 Ga0055542_1000639 3300003762 Bacteria 29329
23 Ga0055529_1000455 3300003763 Bacteria 40200
24 Ga0055529_1001828 3300003763 Bacteria 5060
25 Ga0055529_1005421 3300003763 Bacteria 1849
26 Ga0055536_1016751 3300003781 Bacteria 2435
27 Ga0055534_1002291 3300003784 Bacteria 6725
28 Ga0055530_10024145 3300003791 Bacteria 1731
29 Ga0055541_1000048 3300003841 Bacteria 135637
30 JGI25405J52794_10051593 3300003911 Bacteria 882
31 Ga0065165_1001841 3300005262 Bacteria 20687
32 Ga0070658_10025864 3300005327 Bacteria 4707
33 Ga0070680_100007828 3300005336 Bacteria 8145
34 Ga0070680_100219166 3300005336 Bacteria 1606
35 Ga0070689_100054030 3300005340 Bacteria 3109
36 Ga0070688_100021383 3300005365 Bacteria 3779
37 Ga0070667_100008221 3300005367 Bacteria 8648
38 Ga0070714_100209034 3300005435 Bacteria 1788
39 Ga0070681_10010483 3300005458 Bacteria 9154
40 Ga0070681_10071961 3300005458 Bacteria 3422
41 Ga0070685_10003431 3300005466 Bacteria 8059
42 Ga0070706_100008936 3300005467 Bacteria 9328
43 Ga0070706_100067791 3300005467 Bacteria 3300
44 Ga0070707_100177884 3300005468 Bacteria 2074
45 Ga0070679_100001343 3300005530 Bacteria 21712
46 Ga0070679_100010579 3300005530 Bacteria 8754
47 Ga0070697_100038503 3300005536 Bacteria 3864
48 Ga0068853_100025580 3300005539 Bacteria 4954
49 Ga0070665_100000057 3300005548 Bacteria 237271
50 Ga0068855_100023598 3300005563 Bacteria 7367
51 Ga0068855_100115918 3300005563 Bacteria 3071
52 Ga0068855_100172222 3300005563 Bacteria 2451
53 Ga0068856_100019698 3300005614 Bacteria 6548
54 Ga0068852_100008210 3300005616 Bacteria 7671
55 Ga0081455_10000087 3300005937 Bacteria 99627
56 Ga0081455_10003446 3300005937 Bacteria 18181
57 Ga0081540_1039957 3300005983 Bacteria 2452
58 Ga0075363_100080997 3300006048 Bacteria 1776
59 Ga0075364_10041210 3300006051 Bacteria 2997
60 Ga0075364_10139718 3300006051 Bacteria 1628
61 Ga0075362_10090396 3300006177 Bacteria 1420
62 Ga0075367_10062907 3300006178 Bacteria 2217
63 Ga0075366_10018914 3300006195 Bacteria 3981
64 Ga0075366_10023058 3300006195 Bacteria 3625
65 Ga0075370_10001517 3300006353 Bacteria 10150
66 Ga0075370_10019947 3300006353 Bacteria 3655
67 Ga0075370_10026988 3300006353 Bacteria 3184
68 Ga0075370_10217101 3300006353 Bacteria 1130
69 Ga0075431_100084468 3300006847 Bacteria 3277
70 Ga0075431_100168903 3300006847 Bacteria 2248
71 Ga0075433_10001415 3300006852 Bacteria 17672
72 Ga0075433_10100661 3300006852 Bacteria 2559
73 Ga0075434_100033337 3300006871 Bacteria 5082
74 Ga0075434_100091377 3300006871 Bacteria 3046
75 Ga0075436_100112238 3300006914 Bacteria 1903
76 Ga0075435_100002819 3300007076 Bacteria 11627
77 Ga0075435_100083334 3300007076 Bacteria 2629
78 Ga0099795_10000069 3300007788 Bacteria 18244
79 Ga0105244_10000017 3300009036 Bacteria 253386
80 Ga0105240_10006295 3300009093 Bacteria 17467
81 Ga0105240_10014329 3300009093 Bacteria 10829
82 Ga0105240_10022583 3300009093 Bacteria 8337
83 Ga0105247_10167174 3300009101 Bacteria 1460
84 Ga0114129_10060302 3300009147 Bacteria 5305
85 Ga0114129_10656021 3300009147 Bacteria 1354
86 Ga0105248_10000055 3300009177 Bacteria 141968
87 Ga0105237_10000119 3300009545 Bacteria 109976
88 Ga0105237_10003015 3300009545 Bacteria 20311
89 Ga0105237_10052716 3300009545 Bacteria 4082
90 Ga0105237_10264971 3300009545 Bacteria 1721
91 Ga0105238_10007316 3300009551 Bacteria 11054
92 Ga0105238_10013193 3300009551 Bacteria 8340
93 Ga0105238_10092814 3300009551 Bacteria 3007
94 Ga0105238_10136289 3300009551 Bacteria 2433
95 Ga0105249_10001609 3300009553 Bacteria 19767
96 Ga0123341_1031560 3300009765 Bacteria 3933
97 Ga0123342_1036038 3300009766 Bacteria 2070
98 Ga0105147_100842 3300009982 Bacteria 2484
99 Ga0099796_10000208 3300010159 Bacteria 9086
100 Ga0105239_10021410 3300010375 Bacteria 7127
101 Ga0105239_10025394 3300010375 Bacteria 6523
102 Ga0105239_10101844 3300010375 Bacteria 3178
103 Ga0105239_10317860 3300010375 Bacteria 1755
104 Ga0157347_1000186 3300012502 Bacteria 3444
105 Ga0157370_10006510 3300013104 Bacteria 12862
106 Ga0157370_10069306 3300013104 Bacteria 3331
107 Ga0157370_10132882 3300013104 Bacteria 2321
108 Ga0157369_10147236 3300013105 Bacteria 2489
109 Ga0157369_10489871 3300013105 Bacteria 1272
110 Ga0157369_10502552 3300013105 Bacteria 1254
111 Ga0157378_10074375 3300013297 Bacteria 3057
112 Ga0163162_10011578 3300013306 Bacteria 8605
113 Ga0157372_11275657 3300013307 Bacteria 848
114 Ga0182008_10002989 3300014497 Bacteria 10406
115 Ga0182006_1054813 3300015261 Bacteria 1524
116 Ga0182007_10001698 3300015262 Bacteria 11628
117 Ga0163161_10311322 3300017792 Bacteria 1242
118 Ga0213872_10000229 3300021361 Bacteria 49150
119 Ga0213874_10015308 3300021377 Bacteria 2021
120 Ga0213876_10090312 3300021384 Bacteria 1622
121 Ga0209435_100529 3300025206 Bacteria 7363
122 Ga0209784_100080 3300025224 Bacteria 135689
123 Ga0209566_100096 3300025225 Bacteria 135689
124 Ga0209674_100086 3300025226 Bacteria 187776
125 Ga0209674_100117 3300025226 Bacteria 135689
126 Ga0209672_100005 3300025228 Bacteria 1069303
127 Ga0209672_100029 3300025228 Bacteria 339298
128 Ga0209672_101334 3300025228 Bacteria 9368
129 Ga0209147_100123 3300025229 Bacteria 135689
130 Ga0209563_100023 3300025230 Bacteria 636844
131 Ga0209563_100114 3300025230 Bacteria 135689
132 Ga0209258_100006 3300025242 Bacteria 1069303
133 Ga0209258_100053 3300025242 Bacteria 339233
134 Ga0209258_100174 3300025242 Bacteria 143702
135 Ga0209258_100290 3300025242 Bacteria 82647
136 Ga0209258_102002 3300025242 Bacteria 5889
137 Ga0209646_1000401 3300025246 Bacteria 25669
138 Ga0209026_1000060 3300025250 Bacteria 220052
139 Ga0209677_100073 3300025253 Bacteria 135689
140 Ga0209677_104274 3300025253 Bacteria 4199
141 Ga0209148_1000009 3300025254 Bacteria 1395625
142 Ga0209148_1000012 3300025254 Bacteria 1069303
143 Ga0209148_1000262 3300025254 Bacteria 82647
144 Ga0209759_1000171 3300025256 Bacteria 109243
145 Ga0209233_1000052 3300025261 Bacteria 445813
146 Ga0209455_1000008 3300025272 Bacteria 1069303
147 Ga0209455_1000060 3300025272 Bacteria 339298
148 Ga0209455_1000687 3300025272 Bacteria 19947
149 Ga0209455_1002312 3300025272 Bacteria 7460
150 Ga0209673_1006348 3300025273 Bacteria 5726
151 Ga0209130_1005673 3300025284 Bacteria 4264
152 Ga0209675_1000925 3300025291 Bacteria 18727
153 Ga0209676_1035812 3300025292 Bacteria 1451
154 Ga0209025_1006591 3300025294 Bacteria 8947
155 Ga0209564_1040217 3300025295 Bacteria 1273
156 Ga0209758_1004712 3300025297 Bacteria 11128
157 Ga0209758_1010290 3300025297 Bacteria 5624
158 Ga0209050_1000149 3300025298 Bacteria 163252
159 Ga0209050_1011352 3300025298 Bacteria 4238
160 Ga0209256_1026308 3300025299 Bacteria 1678
161 Ga0209257_1025414 3300025304 Bacteria 2024
162 Ga0207655_1000053 3300025728 Bacteria 284129
163 Ga0207682_10058256 3300025893 Bacteria 1612
164 Ga0207705_10000587 3300025909 Bacteria 30561
165 Ga0207684_10113420 3300025910 Bacteria 2320
166 Ga0207707_10003607 3300025912 Bacteria 13719
167 Ga0207707_10010346 3300025912 Bacteria 8095
168 Ga0207707_10088041 3300025912 Bacteria 2713
169 Ga0207695_10008331 3300025913 Bacteria 12990
170 Ga0207695_10011584 3300025913 Bacteria 10665
171 Ga0207695_10068938 3300025913 Bacteria 3622
172 Ga0207695_10420362 3300025913 Bacteria 1221
173 Ga0207671_10000156 3300025914 Bacteria 106318
174 Ga0207671_10000640 3300025914 Bacteria 45841
175 Ga0207671_10049776 3300025914 Bacteria 3102
176 Ga0207660_10255720 3300025917 Bacteria 1383
177 Ga0207652_10010157 3300025921 Bacteria 7581
178 Ga0207652_10032503 3300025921 Bacteria 4387
179 Ga0207694_10005752 3300025924 Bacteria 9501
180 Ga0207694_10027286 3300025924 Bacteria 4348
181 Ga0207694_10094555 3300025924 Bacteria 2362
182 Ga0207694_10137580 3300025924 Bacteria 1963
183 Ga0207664_10298136 3300025929 Bacteria 1418
184 Ga0207691_10410281 3300025940 Bacteria 1155
185 Ga0207711_10000030 3300025941 Bacteria 206250
186 Ga0207711_10003032 3300025941 Bacteria 14672
187 Ga0207667_10057977 3300025949 Bacteria 4063
188 Ga0207667_10107129 3300025949 Bacteria 2883
189 Ga0207712_10001073 3300025961 Bacteria 19130
190 Ga0207668_10795436 3300025972 Bacteria 837
191 Ga0207658_10000148 3300025986 Bacteria 73530
192 Ga0207658_10003352 3300025986 Bacteria 11362
193 Ga0207703_10651652 3300026035 Bacteria 999
194 Ga0207678_10000199 3300026067 Bacteria 52540
195 Ga0207702_10032682 3300026078 Bacteria 4341
196 Ga0207702_10140488 3300026078 Bacteria 2185
197 Ga0207674_10662966 3300026116 Bacteria 1007
198 Ga0207683_10064477 3300026121 Bacteria 3228
199 Ga0207698_10004350 3300026142 Bacteria 8627
200 Ga0209179_1000085 3300027512 Bacteria 14076
201 Ga0209970_1001076 3300027614 Bacteria 4824
202 Ga0209974_10074714 3300027876 Bacteria 1160
203 Ga0268266_10000001 3300028379 Bacteria 4040580
204 Ga0268266_10191626 3300028379 Bacteria 1867
205 Ga0265323_10005756 3300028653 Bacteria 5248
206 Ga0307515_10274163 3300028794 Bacteria 1403
207 Ga0265338_10025376 3300028800 Bacteria 6016
208 Ga0265770_1000137 3300030878 Bacteria 8966
209 Ga0265760_10001244 3300031090 Bacteria 7461
210 Ga0265330_10165078 3300031235 Bacteria 939
211 Ga0265328_10015820 3300031239 Bacteria 2949
212 Ga0265340_10014609 3300031247 Bacteria 4096
213 Ga0265339_10012292 3300031249 Bacteria 5231
214 Ga0265331_10008461 3300031250 Bacteria 5849
215 Ga0265327_10000012 3300031251 Bacteria 530403
216 Ga0265327_10000236 3300031251 Bacteria 110434
217 Ga0307509_10282738 3300031507 Bacteria 1419
218 Ga0307408_100004266 3300031548 Bacteria 9724
219 Ga0307408_100298368 3300031548 Bacteria 1349
220 Ga0307408_100897300 3300031548 Bacteria 811
221 Ga0265313_10029197 3300031595 Unclassified 2856
222 Ga0265314_10073018 3300031711 Bacteria 2289
223 Ga0307516_10130429 3300031730 Bacteria 2294
224 Ga0307413_10000173 3300031824 Bacteria 18182
225 Ga0307406_10002920 3300031901 Bacteria 9306
226 Ga0307409_100002157 3300031995 Bacteria 10139
227 Ga0307411_10447404 3300032005 Bacteria 1080
228 Ga0307415_100157908 3300032126 Bacteria 1754
229 Ga0307510_10148185 3300033180 Bacteria 1973
230 Ga0373940_0007066 3300035088 Bacteria 2519
231 Ga0373949_0000005 3300035090 Bacteria 81783
232 Ga0373949_0041611 3300035090 Bacteria 1131
233 Ga0373932_0007832 3300035112 Bacteria 2550
234 Ga0316574_0051890 3300035398 Bacteria 2557
235 Ga0373931_0006828 3300035691 Bacteria 5365
236 Ga0316582_0407046 3300036647 Bacteria 937
237 Ga0395899_0000068 3300037312 Bacteria 202264
238 Ga0395899_0031663 3300037312 Bacteria 3974
239 Ga0395899_0096575 3300037312 Bacteria 2136
240 Ga0395899_0132367 3300037312 Bacteria 1780
241 Ga0395900_0000012 3300037418 Bacteria 401198
242 Ga0395900_0026413 3300037418 Bacteria 5945
243 Ga0395900_0155473 3300037418 Bacteria 2336
244 Ga0395900_0508288 3300037418 Bacteria 1154
245 Ga0395900_0837112 3300037418 Bacteria 846
246 Ga0395898_0000278 3300037466 Bacteria 124490
247 Ga0395898_0072085 3300037466 Bacteria 3337
248 Ga0395898_0168967 3300037466 Bacteria 2090
249 Ga0395898_0224751 3300037466 Bacteria 1790
250 Ga0395905_0041900 3300037471 Bacteria 4297
251 Ga0395905_0390055 3300037471 Bacteria 1287
252 Ga0395905_0433535 3300037471 Bacteria 1211
253 Ga0395905_0435892 3300037471 Bacteria 1207
254 Ga0395901_0020290 3300038443 Bacteria 6803
255 Ga0395901_0470852 3300038443 Bacteria 1282
256 Ga0436365_1196494 3300039437 Bacteria 1802
257 Ga0436361_0590566 3300039447 Bacteria 41611
258 Ga0451787_077612 3300041441 Bacteria 1943
259 Ga0451789_1158798 3300041443 Bacteria 1059
260 Ga0451837_0505559 3300041494 Bacteria 993
261 Ga0451853_0567680 3300041512 Bacteria 3820
262 Ga0451853_0616356 3300041512 Bacteria 2097
263 Ga0439449_0027591 3300042007 Bacteria 2119
264 Ga0439462_0018220 3300042015 Bacteria 1822
265 Ga0439446_0002028 3300042156 Bacteria 4794
266 Ga0450918_000962 3300042531 Bacteria 5998
267 Ga0466988_0011655 3300044536 Bacteria 4460
268 Ga0466969_0000683 3300044656 Bacteria 18470
269 Ga0466969_0002180 3300044656 Bacteria 10464
270 Ga0466989_0038709 3300044663 Bacteria 2887
271 Ga0466965_0003152 3300044683 Bacteria 7195
272 Ga0466965_0300335 3300044683 Bacteria 871
273 Ga0466961_0000736 3300044693 Bacteria 20526
274 Ga0466961_0000993 3300044693 Bacteria 17503
275 Ga0466961_0047888 3300044693 Bacteria 2732
276 Ga0466971_0157436 3300044719 Bacteria 1062
277 Ga0466970_0058609 3300044765 Bacteria 2061
278 Ga0466957_0000548 3300044842 Bacteria 18973
279 Ga0466957_0023951 3300044842 Bacteria 3612
280 Ga0466959_0000068 3300045049 Bacteria 73132
281 Ga0466959_0002548 3300045049 Bacteria 11689
282 Ga0466959_0018467 3300045049 Bacteria 5120
283 Ga0466959_0027305 3300045049 Bacteria 4234
284 Ga0466959_0101069 3300045049 Bacteria 2064
285 Ga0466958_0030025 3300045836 Bacteria 3226
286 Ga0466958_0048655 3300045836 Bacteria 2563
287 Ga0495617_009132 3300046452 Bacteria 3410
288 Ga0495591_000078 3300046458 Bacteria 109382
289 Ga0495591_000156 3300046458 Bacteria 72588
290 Ga0495591_003246 3300046458 Bacteria 8537
291 Ga0495629_0185550 3300046459 Bacteria 1441
292 Ga0495605_0000817 3300046474 Bacteria 22213
293 Ga0495605_0021789 3300046474 Bacteria 3390
294 Ga0495639_0013428 3300046475 Bacteria 3536
295 Ga0495585_0000497 3300046492 Bacteria 37109
296 Ga0495585_0001131 3300046492 Bacteria 21889
297 Ga0495607_0000163 3300046501 Bacteria 71182
298 Ga0495607_0000171 3300046501 Bacteria 68792
299 Ga0495607_0000258 3300046501 Bacteria 56810
300 Ga0495607_0007681 3300046501 Bacteria 7430
301 Ga0495607_0047106 3300046501 Bacteria 2527
302 Ga0495607_0067170 3300046501 Bacteria 2015
303 Ga0495607_0196809 3300046501 Bacteria 1000
304 Ga0495583_0000854 3300046506 Bacteria 37046
305 Ga0495583_0000871 3300046506 Bacteria 36594
306 Ga0495583_0001724 3300046506 Bacteria 20981
307 Ga0495583_0004274 3300046506 Bacteria 10344
308 Ga0495583_0011582 3300046506 Bacteria 5056
309 Ga0495606_0000028 3300046507 Bacteria 251032
310 Ga0495606_0006815 3300046507 Bacteria 10431
311 Ga0495606_0092832 3300046507 Bacteria 1853
312 Ga0495616_0004434 3300046513 Bacteria 8841
313 Ga0495620_0000159 3300046515 Bacteria 54696
314 Ga0495620_0002659 3300046515 Bacteria 10326
315 Ga0495620_0061174 3300046515 Bacteria 1567
316 Ga0495631_0001918 3300046518 Bacteria 12240
317 Ga0495632_0004698 3300046519 Bacteria 9227
318 Ga0495632_0017688 3300046519 Bacteria 3929
319 Ga0495632_0169678 3300046519 Bacteria 1003
320 Ga0495637_0000202 3300046520 Bacteria 46505
321 Ga0495637_0002422 3300046520 Bacteria 10304
322 Ga0495637_0010612 3300046520 Bacteria 4449
323 Ga0495643_0012501 3300046522 Bacteria 5120
324 Ga0495644_0007518 3300046523 Bacteria 4200
325 Ga0495648_0000616 3300046524 Bacteria 38074
326 Ga0495648_0000900 3300046524 Bacteria 31062
327 Ga0495642_0044391 3300046528 Bacteria 1814
328 Ga0495654_0000393 3300046530 Bacteria 37516
329 Ga0495654_0007598 3300046530 Bacteria 6040
330 Ga0495654_0076679 3300046530 Bacteria 1575
331 Ga0495609_0003617 3300046538 Bacteria 8777
332 Ga0495609_0021570 3300046538 Bacteria 2972
333 Ga0495597_0000002 3300046542 Bacteria 420382
334 Ga0495597_0000160 3300046542 Bacteria 59617
335 Ga0495656_0022721 3300046615 Bacteria 2460
336 Ga0495668_0012877 3300046616 Bacteria 4952
337 Ga0495668_0270696 3300046616 Bacteria 930
338 Ga0495611_0002061 3300046648 Bacteria 9465
339 Ga0495625_0020129 3300046660 Bacteria 5157
340 Ga0495661_0006975 3300046665 Bacteria 7898
341 Ga0495661_0007469 3300046665 Bacteria 7621
342 Ga0495661_0160079 3300046665 Bacteria 1209
343 Ga0495588_0003147 3300046674 Bacteria 7142
344 Ga0495669_0023491 3300046684 Bacteria 2684
345 Ga0495671_0001449 3300046692 Bacteria 15926
346 Ga0495660_0000111 3300046810 Bacteria 87624
347 Ga0495660_0000244 3300046810 Bacteria 53184
348 Ga0495660_0079501 3300046810 Bacteria 1722
349 Ga0495672_0003227 3300047320 Bacteria 14183
350 Ga0495672_0026471 3300047320 Bacteria 3701
351 Ga0495672_0053668 3300047320 Bacteria 2360
352 Ga0495683_0013075 3300047323 Bacteria 4347
353 Ga0495683_0121309 3300047323 Bacteria 1240
354 Ga0495673_0001033 3300047469 Bacteria 24509
355 Ga0495673_0001617 3300047469 Bacteria 17458
356 Ga0495673_0003483 3300047469 Bacteria 10353
357 Ga0495673_0004359 3300047469 Bacteria 8884
358 Ga0495673_0005537 3300047469 Bacteria 7613
359 Ga0495673_0033014 3300047469 Bacteria 2406
360 Ga0495686_0000457 3300047472 Bacteria 61264
361 Ga0495686_0022704 3300047472 Bacteria 4149
362 Ga0495686_0071138 3300047472 Bacteria 2142
363 Ga0496100_0046666 3300048903 Bacteria 2787
364 Ga0496101_0039343 3300048904 Bacteria 3362
365 Ga0496102_0001102 3300048905 Bacteria 24871
366 Ga0496102_0051921 3300048905 Bacteria 3735
367 Ga0496102_0091059 3300048905 Bacteria 2823
368 Ga0496103_0009695 3300048906 Bacteria 5699
369 Ga0496104_0002515 3300048907 Bacteria 15789
370 Ga0496104_0267724 3300048907 Bacteria 1621
371 Ga0496105_0001264 3300048908 Bacteria 17667
372 Ga0496105_0091045 3300048908 Bacteria 2519
373 Ga0496107_0088271 3300048910 Bacteria 2264
374 Ga0496109_0314597 3300048912 Bacteria 1477
375 Ga0496110_0015671 3300048913 Bacteria 6315
376 Ga0496110_0083301 3300048913 Bacteria 2853
377 Ga0496110_0169826 3300048913 Bacteria 1978
378 Ga0496111_0229965 3300048914 Bacteria 1377
379 Ga0496112_0775661 3300048915 Bacteria 884
380 Ga0496114_0002895 3300048917 Bacteria 13148
381 Ga0496114_0320993 3300048917 Bacteria 1368
382 Ga0496116_0064526 3300048919 Bacteria 2354
383 Ga0496117_0000912 3300048920 Bacteria 45269
384 Ga0496117_0014787 3300048920 Bacteria 6699
385 Ga0496117_0022584 3300048920 Bacteria 5042
386 Ga0496118_0004217 3300048921 Bacteria 17259
387 Ga0496118_0005604 3300048921 Bacteria 14186
388 Ga0496118_0073812 3300048921 Bacteria 2441
389 Ga0496121_0005351 3300048924 Bacteria 16505
390 Ga0496121_0064865 3300048924 Bacteria 2975
391 Ga0496121_0182810 3300048924 Bacteria 1511
392 Ga0496122_0002072 3300048925 Bacteria 29724
393 Ga0496122_0006119 3300048925 Bacteria 14012
394 Ga0496122_0135448 3300048925 Bacteria 1554
395 Ga0496123_0000094 3300048926 Bacteria 178612
396 Ga0496123_0000113 3300048926 Bacteria 163689
397 Ga0496123_0032655 3300048926 Bacteria 3762
398 Ga0496124_0003960 3300048927 Bacteria 17664
399 Ga0496124_0032257 3300048927 Bacteria 4627
400 Ga0496125_0002252 3300048928 Bacteria 25630
401 Ga0496126_0009309 3300048929 Bacteria 10458
402 Ga0496126_0018449 3300048929 Bacteria 6913
403 Ga0496126_0103943 3300048929 Bacteria 2482
404 Ga0495678_000072 3300049459 Bacteria 128270
405 Ga0495678_003197 3300049459 Bacteria 10314
406 Ga0495682_0000023 3300049460 Bacteria 158998
407 Ga0501031_0020909 3300049568 Bacteria 4267
408 Ga0501031_0041521 3300049568 Bacteria 3003
409 Ga0501032_0001932 3300049569 Bacteria 16328
410 Ga0501032_0374200 3300049569 Bacteria 916
411 Ga0501033_0359193 3300049570 Bacteria 1019
412 Ga0501034_0001874 3300049571 Bacteria 26681
413 Ga0501034_0017080 3300049571 Bacteria 7442
414 Ga0501034_0766589 3300049571 Bacteria 859
415 Ga0501036_0055206 3300049572 Bacteria 3365
416 Ga0501037_0001836 3300049573 Bacteria 15423
417 Ga0501037_0153417 3300049573 Bacteria 1645
418 Ga0501037_0430479 3300049573 Bacteria 902
419 Ga0501038_0016910 3300049574 Bacteria 6601
420 Ga0501039_0001164 3300049575 Bacteria 19327
421 Ga0501043_0115607 3300049579 Bacteria 2106
422 Ga0501046_0003034 3300049580 Bacteria 15518
423 Ga0501046_0192109 3300049580 Bacteria 1522
424 Ga0501047_0005642 3300049581 Bacteria 11792
425 Ga0501047_0024618 3300049581 Bacteria 5778
426 Ga0501048_0255758 3300049582 Bacteria 1244
427 Ga0501067_0000831 3300049583 Bacteria 16661
428 Ga0501067_0030292 3300049583 Bacteria 3001
429 Ga0501069_0037700 3300049585 Bacteria 2668
430 Ga0501070_0004272 3300049586 Bacteria 12286
431 Ga0501070_0010898 3300049586 Bacteria 7679
432 Ga0501073_0006486 3300049589 Bacteria 8706
433 Ga0501209_000025 3300049656 Bacteria 14691
434 Ga0501223_017750 3300049663 Bacteria 1404
435 Ga0501227_001477 3300049665 Bacteria 5249
436 Ga0501079_0546984 3300049741 Bacteria 910
437 Ga0501080_0000002 3300049742 Bacteria 218492
438 Ga0501035_0000089 3300049822 Bacteria 112536
439 Ga0501035_0103968 3300049822 Bacteria 2491
440 Ga0501035_0125909 3300049822 Bacteria 2236
441 Ga0501035_0256354 3300049822 Bacteria 1484
442 Ga0501044_0000249 3300049823 Bacteria 68464
443 Ga0501044_0055288 3300049823 Bacteria 4077
444 nmdc:mga00v17_19836_c1 3300050491 Bacteria 3844
445 nmdc:mga0k408_10397_c1 3300050493 Bacteria 5032
446 nmdc:mga0k408_253846_c1 3300050493 Bacteria 1050
447 nmdc:mga0k408_49901_c2 3300050493 Bacteria 1605
448 nmdc:mga0k408_94744_c1 3300050493 Bacteria 1756
449 nmdc:mga07m45_170988_c1 3300050496 Bacteria 1263
450 nmdc:mga07m45_21945_c1 3300050496 Bacteria 3482
451 nmdc:mga05p37_82175_c1 3300050507 Bacteria 3969
452 nmdc:mga09592_395184_c1 3300050508 Bacteria 1195
453 nmdc:mga06r32_11831_c1 3300050510 Bacteria 7857
454 nmdc:mga06r32_56233_c1 3300050510 Bacteria 3777
455 nmdc:mga06r32_721607_c1 3300050510 Bacteria 961
456 nmdc:mga08y16_185104_c1 3300050511 Bacteria 2162
457 nmdc:mga0n895_10082_c1 3300050512 Bacteria 8317
458 nmdc:mga0n895_365959_c1 3300050512 Bacteria 1460
459 nmdc:mga0n895_79774_c1 3300050512 Bacteria 3260
460 nmdc:mga0rr50_39600_c1 3300050513 Bacteria 3420
461 nmdc:mga08x19_128740_c1 3300050514 Bacteria 1701
462 nmdc:mga0a205_59935_c1 3300050515 Bacteria 3676
463 nmdc:mga0sz30_169781_c1 3300050516 Bacteria 967
464 Ga0500578_0000011 3300053086 Bacteria 217243
465 Ga0500646_0018797 3300053090 Bacteria 1823
466 Ga0500651_0034442 3300053093 Bacteria 3193
467 Ga0500650_0148007 3300053098 Bacteria 1087
468 Ga0500597_037596 3300053120 Bacteria 2023
469 Ga0500618_005891 3300053125 Bacteria 3666
470 Ga0500623_163583 3300053127 Bacteria 891
471 Ga0500642_0113872 3300053130 Bacteria 1263
472 Ga0500652_000495 3300053131 Bacteria 13817
473 Ga0500655_004767 3300053133 Bacteria 2440
474 Ga0500658_0127886 3300053134 Bacteria 1131
475 Ga0500568_0028370 3300053139 Bacteria 2334
476 Ga0500568_0044050 3300053139 Bacteria 1781
477 Ga0500573_0001008 3300053140 Bacteria 12950
478 Ga0500573_0207610 3300053140 Bacteria 1035
479 Ga0500603_025709 3300053150 Bacteria 1483
480 Ga0500604_0015980 3300053151 Bacteria 2062
481 Ga0500604_0064738 3300053151 Bacteria 1155
482 Ga0500622_0000689 3300053156 Bacteria 29849
483 Ga0500636_0063532 3300053177 Bacteria 2152
484 Ga0500570_073252 3300053724 Bacteria 1586
485 Ga0501082_0026413 3300060353 Bacteria 5004
486 Ga0466962_0076405 3300061719 Bacteria 1600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042007 Ga0439449_0027591 Ga0439449_0027591_1159_1923 211
2 3300049663 Ga0501223_017750 Ga0501223_017750_160_921 224
3 3300049665 Ga0501227_001477 Ga0501227_001477_2345_3106 226
4 3300048917 Ga0496114_0320993 Ga0496114_0320993_41_742 233
5 3300003323 rootH1_10097210 rootH1_100972102 235
6 3300048920 Ga0496117_0014787 Ga0496117_0014787_847_1614 235
7 3300048921 Ga0496118_0004217 Ga0496118_0004217_3979_4746 235
8 3300048929 Ga0496126_0009309 Ga0496126_0009309_9618_10385 235
9 3300046523 Ga0495644_0007518 Ga0495644_0007518_1391_2149 238
10 3300046538 Ga0495609_0003617 Ga0495609_0003617_1735_2493 238
11 3300048917 Ga0496114_0002895 Ga0496114_0002895_2193_2957 238
12 3300048929 Ga0496126_0018449 Ga0496126_0018449_2482_3246 238
13 3300041512 Ga0451853_0567680 Ga0451853_0567680_1811_2533 240
14 3300042015 Ga0439462_0018220 Ga0439462_0018220_1025_1810 240
15 3300005983 Ga0081540_1039957 Ga0081540_10399575 241
16 3300049579 Ga0501043_0115607 Ga0501043_0115607_251_1000 241
17 3300050516 nmdc:mga0sz30_169781_c1 nmdc:mga0sz30_169781_c1_101_850 241
18 3300005937 Ga0081455_10000087 Ga0081455_1000008793 243
19 3300006852 Ga0075433_10001415 Ga0075433_1000141514 243
20 3300006871 Ga0075434_100033337 Ga0075434_1000333372 243
21 3300006871 Ga0075434_100091377 Ga0075434_1000913772 243
22 3300006914 Ga0075436_100112238 Ga0075436_1001122384 243
23 3300007076 Ga0075435_100002819 Ga0075435_10000281911 243
24 3300007076 Ga0075435_100083334 Ga0075435_1000833342 243
25 3300028800 Ga0265338_10025376 Ga0265338_100253762 243
26 3300031548 Ga0307408_100298368 Ga0307408_1002983682 243
27 3300035088 Ga0373940_0007066 Ga0373940_0007066_1044_1799 243
28 3300035090 Ga0373949_0041611 Ga0373949_0041611_178_933 243
29 3300035112 Ga0373932_0007832 Ga0373932_0007832_1020_1775 243
30 3300035691 Ga0373931_0006828 Ga0373931_0006828_3273_4028 243
31 3300050511 nmdc:mga08y16_185104_c1 nmdc:mga08y16_185104_c1_1331_2086 243
32 3300050512 nmdc:mga0n895_10082_c1 nmdc:mga0n895_10082_c1_832_1587 243
33 3300050512 nmdc:mga0n895_79774_c1 nmdc:mga0n895_79774_c1_1373_2128 243
34 3300050513 nmdc:mga0rr50_39600_c1 nmdc:mga0rr50_39600_c1_1508_2263 243
35 3300050514 nmdc:mga08x19_128740_c1 nmdc:mga08x19_128740_c1_535_1290 243
36 3300009765 Ga0123341_1031560 Ga0123341_10315606 245
37 3300009766 Ga0123342_1036038 Ga0123342_10360383 245
38 3300025294 Ga0209025_1006591 Ga0209025_10065913 245
39 3300025297 Ga0209758_1010290 Ga0209758_10102904 245
40 iso_pu_bacteria 2643221541 2643730637 247
41 iso_pu_bacteria 2643221606 2644043806 247
42 iso_pu_bacteria 2643221671 2644393965 247
43 iso_pu_bacteria 2738541317 2738945555 247
44 iso_pu_bacteria 2891373044 2891375782 247
45 iso_pu_bacteria 2913308742 2913310262 247
46 3300003323 rootH1_10017904 rootH1_100179043 248
47 3300021377 Ga0213874_10015308 Ga0213874_100153082 248
48 3300037312 Ga0395899_0132367 Ga0395899_0132367_652_1410 248
49 3300037418 Ga0395900_0837112 Ga0395900_0837112_56_814 248
50 3300049569 Ga0501032_0374200 Ga0501032_0374200_45_803 248
51 3300049570 Ga0501033_0359193 Ga0501033_0359193_213_971 248
52 3300049585 Ga0501069_0037700 Ga0501069_0037700_1345_2103 248
53 3300049586 Ga0501070_0004272 Ga0501070_0004272_1367_2125 248
54 3300049822 Ga0501035_0125909 Ga0501035_0125909_1173_1931 248
55 iso_pu_bacteria 2508501039 2508678568 248
56 iso_pu_bacteria 2597489889 2597871360 248
57 iso_pu_bacteria 2599185189 2599510205 248
58 iso_pu_bacteria 2599185307 2599974142 248
59 iso_pu_bacteria 2600255283 2601624391 248
60 iso_pu_bacteria 2600255296 2601692990 248
61 iso_pu_bacteria 2643221571 2643873859 248
62 iso_pu_bacteria 2687453743 2689990604 248
63 iso_pu_bacteria 2721755607 2723250275 248
64 iso_pu_bacteria 2840878972 2840882839 248
65 iso_pu_bacteria 2842733646 2842734062 248
66 iso_pu_bacteria 2842826826 2842831904 248
67 iso_pu_bacteria 2842837860 2842840797 248
68 iso_pu_bacteria 2843690924 2843692327 248
69 iso_pu_bacteria 2881609920 2881613391 248
70 iso_pu_bacteria 2895511927 2895515076 248
71 iso_pu_bacteria 2904504865 2904508192 248
72 iso_pu_bacteria 2908669403 2908674336 248
73 iso_pu_bacteria 2939602548 2939607087 248
74 iso_pu_bacteria 2946006987 2946008062 248
75 iso_pu_bacteria 2947233263 2947233340 248
76 iso_pu_bacteria 3007419365 3007424721 248
77 iso_pu_bacteria 8054347763 8054351362 248
78 iso_pu_bacteria 8056148874 8056153736 248
79 3300009545 Ga0105237_10000119 Ga0105237_1000011972 249
80 3300009551 Ga0105238_10013193 Ga0105238_100131934 249
81 3300013104 Ga0157370_10132882 Ga0157370_101328822 249
82 3300025297 Ga0209758_1004712 Ga0209758_10047128 249
83 3300025909 Ga0207705_10000587 Ga0207705_1000058713 249
84 3300025914 Ga0207671_10000156 Ga0207671_1000015610 249
85 3300025924 Ga0207694_10027286 Ga0207694_100272863 249
86 3300028379 Ga0268266_10191626 Ga0268266_101916262 249
87 3300031595 Ga0265313_10029197 Ga0265313_100291972 249
88 3300041441 Ga0451787_077612 Ga0451787_077612_896_1651 249
89 3300041443 Ga0451789_1158798 Ga0451789_1158798_208_963 249
90 3300041494 Ga0451837_0505559 Ga0451837_0505559_133_888 249
91 3300048920 Ga0496117_0000912 Ga0496117_0000912_9709_10464 249
92 3300048926 Ga0496123_0000094 Ga0496123_0000094_86285_87040 249
93 3300048928 Ga0496125_0002252 Ga0496125_0002252_9147_9902 249
94 3300053093 Ga0500651_0034442 Ga0500651_0034442_1204_1959 249
95 3300053140 Ga0500573_0207610 Ga0500573_0207610_261_1019 249
96 iso_pu_bacteria 2585428057 2587730356 249
97 iso_pu_bacteria 2585428058 2587736871 249
98 iso_pu_bacteria 2588253510 2588291776 249
99 iso_pu_bacteria 2643221559 2643817020 249
100 iso_pu_bacteria 2643221577 2643894398 249
101 iso_pu_bacteria 2643221586 2643939442 249
102 iso_pu_bacteria 2643221592 2643972401 249
103 iso_pu_bacteria 2643221612 2644078121 249
104 iso_pu_bacteria 2643221625 2644138591 249
105 iso_pu_bacteria 2643221644 2644244142 249
106 iso_pu_bacteria 2643221648 2644272909 249
107 iso_pu_bacteria 2643221685 2644476602 249
108 iso_pu_bacteria 2643221720 2644662077 249
109 iso_pu_bacteria 2643221727 2644696424 249
110 iso_pu_bacteria 2643221728 2644700214 249
111 iso_pu_bacteria 2808606386 2808981950 249
112 iso_pu_bacteria 2808606415 2809131573 249
113 iso_pu_bacteria 2808606419 2809151195 249
114 iso_pu_bacteria 2828305725 2828306238 249
115 iso_pu_bacteria 2852618963 2852622523 249
116 iso_pu_bacteria 2891395885 2891397600 249
117 iso_pu_bacteria 2891554331 2891561432 249
118 3300005458 Ga0070681_10071961 Ga0070681_100719612 250
119 3300005530 Ga0070679_100001343 Ga0070679_10000134311 250
120 3300006051 Ga0075364_10139718 Ga0075364_101397183 250
121 3300031507 Ga0307509_10282738 Ga0307509_102827382 250
122 3300050491 nmdc:mga00v17_19836_c1 nmdc:mga00v17_19836_c1_2614_3366 250
123 3300003214 JGI25165J46597_1000095 JGI25165J46597_100009537 251
124 3300003323 rootH1_10139221 rootH1_101392212 251
125 3300005467 Ga0070706_100008936 Ga0070706_1000089368 251
126 3300005468 Ga0070707_100177884 Ga0070707_1001778843 251
127 3300005536 Ga0070697_100038503 Ga0070697_1000385034 251
128 3300005616 Ga0068852_100008210 Ga0068852_1000082107 251
129 3300006177 Ga0075362_10090396 Ga0075362_100903963 251
130 3300009177 Ga0105248_10000055 Ga0105248_1000005564 251
131 3300009982 Ga0105147_100842 Ga0105147_1008422 251
132 3300013105 Ga0157369_10489871 Ga0157369_104898711 251
133 3300013306 Ga0163162_10011578 Ga0163162_100115784 251
134 3300013307 Ga0157372_11275657 Ga0157372_112756571 251
135 3300021361 Ga0213872_10000229 Ga0213872_1000022910 251
136 3300025261 Ga0209233_1000052 Ga0209233_1000052120 251
137 3300025893 Ga0207682_10058256 Ga0207682_100582562 251
138 3300025940 Ga0207691_10410281 Ga0207691_104102812 251
139 3300025941 Ga0207711_10000030 Ga0207711_1000003061 251
140 3300025972 Ga0207668_10795436 Ga0207668_107954361 251
141 3300026035 Ga0207703_10651652 Ga0207703_106516522 251
142 3300026116 Ga0207674_10662966 Ga0207674_106629662 251
143 3300026121 Ga0207683_10064477 Ga0207683_100644773 251
144 3300026142 Ga0207698_10004350 Ga0207698_100043504 251
145 3300027614 Ga0209970_1001076 Ga0209970_10010762 251
146 3300027876 Ga0209974_10074714 Ga0209974_100747143 251
147 3300028653 Ga0265323_10005756 Ga0265323_100057563 251
148 3300030878 Ga0265770_1000137 Ga0265770_10001379 251
149 3300031090 Ga0265760_10001244 Ga0265760_100012446 251
150 3300031548 Ga0307408_100004266 Ga0307408_1000042662 251
151 3300031548 Ga0307408_100897300 Ga0307408_1008973001 251
152 3300031901 Ga0307406_10002920 Ga0307406_100029208 251
153 3300031995 Ga0307409_100002157 Ga0307409_1000021572 251
154 3300032005 Ga0307411_10447404 Ga0307411_104474041 251
155 3300033180 Ga0307510_10148185 Ga0307510_101481851 251
156 3300035090 Ga0373949_0000005 Ga0373949_0000005_33838_34617 251
157 3300037418 Ga0395900_0155473 Ga0395900_0155473_756_1532 251
158 3300037418 Ga0395900_0508288 Ga0395900_0508288_286_1050 251
159 3300039447 Ga0436361_0590566 Ga0436361_0590566_3587_4345 251
160 3300044656 Ga0466969_0000683 Ga0466969_0000683_13365_14123 251
161 3300044683 Ga0466965_0003152 Ga0466965_0003152_5965_6723 251
162 3300044693 Ga0466961_0000736 Ga0466961_0000736_151_909 251
163 3300045049 Ga0466959_0002548 Ga0466959_0002548_4955_5713 251
164 3300045049 Ga0466959_0018467 Ga0466959_0018467_3057_3815 251
165 3300046452 Ga0495617_009132 Ga0495617_009132_1352_2110 251
166 3300046459 Ga0495629_0185550 Ga0495629_0185550_547_1314 251
167 3300046475 Ga0495639_0013428 Ga0495639_0013428_2582_3349 251
168 3300046492 Ga0495585_0000497 Ga0495585_0000497_7198_7956 251
169 3300046492 Ga0495585_0001131 Ga0495585_0001131_19307_20065 251
170 3300046506 Ga0495583_0011582 Ga0495583_0011582_1195_1953 251
171 3300046507 Ga0495606_0092832 Ga0495606_0092832_682_1440 251
172 3300046513 Ga0495616_0004434 Ga0495616_0004434_6681_7439 251
173 3300046519 Ga0495632_0169678 Ga0495632_0169678_62_820 251
174 3300046524 Ga0495648_0000616 Ga0495648_0000616_2177_2935 251
175 3300046528 Ga0495642_0044391 Ga0495642_0044391_61_828 251
176 3300046615 Ga0495656_0022721 Ga0495656_0022721_1246_2013 251
177 3300046674 Ga0495588_0003147 Ga0495588_0003147_4016_4783 251
178 3300047323 Ga0495683_0013075 Ga0495683_0013075_948_1706 251
179 3300047323 Ga0495683_0121309 Ga0495683_0121309_36_794 251
180 3300048903 Ga0496100_0046666 Ga0496100_0046666_1092_1859 251
181 3300048904 Ga0496101_0039343 Ga0496101_0039343_2568_3335 251
182 3300048905 Ga0496102_0001102 Ga0496102_0001102_21357_22124 251
183 3300048906 Ga0496103_0009695 Ga0496103_0009695_799_1566 251
184 3300048907 Ga0496104_0002515 Ga0496104_0002515_12071_12838 251
185 3300048908 Ga0496105_0001264 Ga0496105_0001264_7428_8195 251
186 3300048910 Ga0496107_0088271 Ga0496107_0088271_1222_1989 251
187 3300048912 Ga0496109_0314597 Ga0496109_0314597_196_963 251
188 3300048913 Ga0496110_0015671 Ga0496110_0015671_3990_4757 251
189 3300048913 Ga0496110_0169826 Ga0496110_0169826_1094_1861 251
190 3300048914 Ga0496111_0229965 Ga0496111_0229965_553_1320 251
191 3300048915 Ga0496112_0775661 Ga0496112_0775661_35_793 251
192 3300048920 Ga0496117_0022584 Ga0496117_0022584_4248_5006 251
193 3300048921 Ga0496118_0073812 Ga0496118_0073812_27_785 251
194 3300049568 Ga0501031_0020909 Ga0501031_0020909_1101_1865 251
195 3300049571 Ga0501034_0017080 Ga0501034_0017080_4522_5367 251
196 3300049571 Ga0501034_0766589 Ga0501034_0766589_20_784 251
197 3300049573 Ga0501037_0153417 Ga0501037_0153417_614_1378 251
198 3300049573 Ga0501037_0430479 Ga0501037_0430479_66_830 251
199 3300049580 Ga0501046_0192109 Ga0501046_0192109_337_1101 251
200 3300049581 Ga0501047_0024618 Ga0501047_0024618_2718_3482 251
201 3300049583 Ga0501067_0030292 Ga0501067_0030292_1076_1840 251
202 3300049822 Ga0501035_0103968 Ga0501035_0103968_1021_1908 251
203 3300049823 Ga0501044_0055288 Ga0501044_0055288_2323_3087 251
204 3300053139 Ga0500568_0044050 Ga0500568_0044050_741_1502 251
205 iso_pu_bacteria 2643221611 2644070899 251
206 3300002738 JGI25154J39366_1004528 JGI25154J39366_10045283 252
207 3300002741 JGI25157J39369_1001901 JGI25157J39369_10019014 252
208 3300003751 Ga0055538_1000047 Ga0055538_1000047104 252
209 3300003752 Ga0055539_1000067 Ga0055539_1000067104 252
210 3300003752 Ga0055539_1001185 Ga0055539_10011854 252
211 3300003756 Ga0055533_1000077 Ga0055533_1000077104 252
212 3300003756 Ga0055533_1001511 Ga0055533_10015113 252
213 3300003758 Ga0055532_1000282 Ga0055532_10002829 252
214 3300003759 Ga0055525_1000027 Ga0055525_1000027296 252
215 3300003759 Ga0055525_1000101 Ga0055525_100010129 252
216 3300003760 Ga0055527_1000041 Ga0055527_100004134 252
217 3300003760 Ga0055527_1000196 Ga0055527_100019639 252
218 3300003761 Ga0055535_1000375 Ga0055535_100037519 252
219 3300003761 Ga0055535_1000414 Ga0055535_100041439 252
220 3300003761 Ga0055535_1000419 Ga0055535_100041934 252
221 3300003762 Ga0055542_1000215 Ga0055542_100021519 252
222 3300003762 Ga0055542_1000433 Ga0055542_100043339 252
223 3300003762 Ga0055542_1000639 Ga0055542_10006396 252
224 3300003763 Ga0055529_1000455 Ga0055529_10004552 252
225 3300003763 Ga0055529_1001828 Ga0055529_10018283 252
226 3300003763 Ga0055529_1005421 Ga0055529_10054212 252
227 3300003781 Ga0055536_1016751 Ga0055536_10167511 252
228 3300003784 Ga0055534_1002291 Ga0055534_10022913 252
229 3300003791 Ga0055530_10024145 Ga0055530_100241452 252
230 3300003841 Ga0055541_1000048 Ga0055541_100004829 252
231 3300003911 JGI25405J52794_10051593 JGI25405J52794_100515931 252
232 3300005262 Ga0065165_1001841 Ga0065165_10018413 252
233 3300005327 Ga0070658_10025864 Ga0070658_100258644 252
234 3300005336 Ga0070680_100007828 Ga0070680_1000078286 252
235 3300005336 Ga0070680_100219166 Ga0070680_1002191662 252
236 3300005340 Ga0070689_100054030 Ga0070689_1000540302 252
237 3300005365 Ga0070688_100021383 Ga0070688_1000213833 252
238 3300005367 Ga0070667_100008221 Ga0070667_1000082216 252
239 3300005435 Ga0070714_100209034 Ga0070714_1002090342 252
240 3300005458 Ga0070681_10010483 Ga0070681_100104835 252
241 3300005466 Ga0070685_10003431 Ga0070685_100034316 252
242 3300005467 Ga0070706_100067791 Ga0070706_1000677913 252
243 3300005530 Ga0070679_100010579 Ga0070679_1000105796 252
244 3300005539 Ga0068853_100025580 Ga0068853_1000255802 252
245 3300005548 Ga0070665_100000057 Ga0070665_100000057148 252
246 3300005563 Ga0068855_100023598 Ga0068855_1000235983 252
247 3300005563 Ga0068855_100115918 Ga0068855_1001159183 252
248 3300005563 Ga0068855_100172222 Ga0068855_1001722222 252
249 3300005614 Ga0068856_100019698 Ga0068856_1000196982 252
250 3300005937 Ga0081455_10003446 Ga0081455_1000344612 252
251 3300006048 Ga0075363_100080997 Ga0075363_1000809972 252
252 3300006051 Ga0075364_10041210 Ga0075364_100412102 252
253 3300006178 Ga0075367_10062907 Ga0075367_100629072 252
254 3300006195 Ga0075366_10018914 Ga0075366_100189145 252
255 3300006195 Ga0075366_10023058 Ga0075366_100230584 252
256 3300006353 Ga0075370_10001517 Ga0075370_1000151710 252
257 3300006353 Ga0075370_10019947 Ga0075370_100199474 252
258 3300006353 Ga0075370_10026988 Ga0075370_100269882 252
259 3300006353 Ga0075370_10217101 Ga0075370_102171012 252
260 3300006847 Ga0075431_100084468 Ga0075431_1000844684 252
261 3300006847 Ga0075431_100168903 Ga0075431_1001689032 252
262 3300006852 Ga0075433_10100661 Ga0075433_101006612 252
263 3300007788 Ga0099795_10000069 Ga0099795_100000693 252
264 3300009036 Ga0105244_10000017 Ga0105244_10000017102 252
265 3300009093 Ga0105240_10006295 Ga0105240_1000629510 252
266 3300009093 Ga0105240_10014329 Ga0105240_100143299 252
267 3300009093 Ga0105240_10022583 Ga0105240_100225833 252
268 3300009101 Ga0105247_10167174 Ga0105247_101671742 252
269 3300009147 Ga0114129_10060302 Ga0114129_100603024 252
270 3300009147 Ga0114129_10656021 Ga0114129_106560212 252
271 3300009545 Ga0105237_10003015 Ga0105237_1000301513 252
272 3300009545 Ga0105237_10052716 Ga0105237_100527162 252
273 3300009545 Ga0105237_10264971 Ga0105237_102649712 252
274 3300009551 Ga0105238_10007316 Ga0105238_100073168 252
275 3300009551 Ga0105238_10092814 Ga0105238_100928142 252
276 3300009551 Ga0105238_10136289 Ga0105238_101362893 252
277 3300009553 Ga0105249_10001609 Ga0105249_100016097 252
278 3300010159 Ga0099796_10000208 Ga0099796_100002086 252
279 3300010375 Ga0105239_10021410 Ga0105239_100214105 252
280 3300010375 Ga0105239_10025394 Ga0105239_100253947 252
281 3300010375 Ga0105239_10101844 Ga0105239_101018442 252
282 3300010375 Ga0105239_10317860 Ga0105239_103178602 252
283 3300012502 Ga0157347_1000186 Ga0157347_10001863 252
284 3300013104 Ga0157370_10006510 Ga0157370_1000651010 252
285 3300013104 Ga0157370_10069306 Ga0157370_100693065 252
286 3300013105 Ga0157369_10147236 Ga0157369_101472364 252
287 3300013105 Ga0157369_10502552 Ga0157369_105025521 252
288 3300013297 Ga0157378_10074375 Ga0157378_100743752 252
289 3300014497 Ga0182008_10002989 Ga0182008_100029899 252
290 3300015261 Ga0182006_1054813 Ga0182006_10548132 252
291 3300015262 Ga0182007_10001698 Ga0182007_100016984 252
292 3300017792 Ga0163161_10311322 Ga0163161_103113222 252
293 3300021384 Ga0213876_10090312 Ga0213876_100903122 252
294 3300025206 Ga0209435_100529 Ga0209435_1005292 252
295 3300025224 Ga0209784_100080 Ga0209784_10008029 252
296 3300025225 Ga0209566_100096 Ga0209566_10009629 252
297 3300025226 Ga0209674_100086 Ga0209674_10008674 252
298 3300025226 Ga0209674_100117 Ga0209674_10011729 252
299 3300025228 Ga0209672_100005 Ga0209672_100005786 252
300 3300025228 Ga0209672_100029 Ga0209672_100029186 252
301 3300025228 Ga0209672_101334 Ga0209672_1013345 252
302 3300025229 Ga0209147_100123 Ga0209147_10012329 252
303 3300025230 Ga0209563_100023 Ga0209563_100023451 252
304 3300025230 Ga0209563_100114 Ga0209563_10011429 252
305 3300025242 Ga0209258_100006 Ga0209258_100006786 252
306 3300025242 Ga0209258_100053 Ga0209258_100053144 252
307 3300025242 Ga0209258_100174 Ga0209258_10017429 252
308 3300025242 Ga0209258_100290 Ga0209258_10029030 252
309 3300025242 Ga0209258_102002 Ga0209258_1020026 252
310 3300025246 Ga0209646_1000401 Ga0209646_100040129 252
311 3300025250 Ga0209026_1000060 Ga0209026_1000060183 252
312 3300025253 Ga0209677_100073 Ga0209677_10007329 252
313 3300025253 Ga0209677_104274 Ga0209677_1042742 252
314 3300025254 Ga0209148_1000009 Ga0209148_1000009186 252
315 3300025254 Ga0209148_1000012 Ga0209148_1000012786 252
316 3300025254 Ga0209148_1000262 Ga0209148_100026230 252
317 3300025256 Ga0209759_1000171 Ga0209759_100017135 252
318 3300025272 Ga0209455_1000008 Ga0209455_1000008786 252
319 3300025272 Ga0209455_1000060 Ga0209455_1000060186 252
320 3300025272 Ga0209455_1000687 Ga0209455_10006878 252
321 3300025272 Ga0209455_1002312 Ga0209455_10023123 252
322 3300025273 Ga0209673_1006348 Ga0209673_10063484 252
323 3300025284 Ga0209130_1005673 Ga0209130_10056734 252
324 3300025291 Ga0209675_1000925 Ga0209675_100092515 252
325 3300025292 Ga0209676_1035812 Ga0209676_10358121 252
326 3300025295 Ga0209564_1040217 Ga0209564_10402171 252
327 3300025298 Ga0209050_1000149 Ga0209050_1000149127 252
328 3300025298 Ga0209050_1011352 Ga0209050_10113523 252
329 3300025299 Ga0209256_1026308 Ga0209256_10263081 252
330 3300025304 Ga0209257_1025414 Ga0209257_10254143 252
331 3300025728 Ga0207655_1000053 Ga0207655_1000053152 252
332 3300025910 Ga0207684_10113420 Ga0207684_101134202 252
333 3300025912 Ga0207707_10003607 Ga0207707_1000360710 252
334 3300025912 Ga0207707_10010346 Ga0207707_100103462 252
335 3300025912 Ga0207707_10088041 Ga0207707_100880413 252
336 3300025913 Ga0207695_10008331 Ga0207695_1000833111 252
337 3300025913 Ga0207695_10011584 Ga0207695_100115848 252
338 3300025913 Ga0207695_10068938 Ga0207695_100689382 252
339 3300025913 Ga0207695_10420362 Ga0207695_104203621 252
340 3300025914 Ga0207671_10000640 Ga0207671_1000064046 252
341 3300025914 Ga0207671_10049776 Ga0207671_100497763 252
342 3300025917 Ga0207660_10255720 Ga0207660_102557201 252
343 3300025921 Ga0207652_10010157 Ga0207652_100101578 252
344 3300025921 Ga0207652_10032503 Ga0207652_100325035 252
345 3300025924 Ga0207694_10005752 Ga0207694_100057527 252
346 3300025924 Ga0207694_10094555 Ga0207694_100945552 252
347 3300025924 Ga0207694_10137580 Ga0207694_101375802 252
348 3300025929 Ga0207664_10298136 Ga0207664_102981362 252
349 3300025941 Ga0207711_10003032 Ga0207711_100030323 252
350 3300025949 Ga0207667_10057977 Ga0207667_100579772 252
351 3300025949 Ga0207667_10107129 Ga0207667_101071294 252
352 3300025961 Ga0207712_10001073 Ga0207712_1000107313 252
353 3300025986 Ga0207658_10000148 Ga0207658_100001482 252
354 3300025986 Ga0207658_10003352 Ga0207658_100033528 252
355 3300026067 Ga0207678_10000199 Ga0207678_1000019947 252
356 3300026078 Ga0207702_10032682 Ga0207702_100326822 252
357 3300026078 Ga0207702_10140488 Ga0207702_101404883 252
358 3300027512 Ga0209179_1000085 Ga0209179_10000853 252
359 3300028379 Ga0268266_10000001 Ga0268266_100000012887 252
360 3300028794 Ga0307515_10274163 Ga0307515_102741632 252
361 3300031235 Ga0265330_10165078 Ga0265330_101650781 252
362 3300031239 Ga0265328_10015820 Ga0265328_100158204 252
363 3300031247 Ga0265340_10014609 Ga0265340_100146094 252
364 3300031249 Ga0265339_10012292 Ga0265339_100122924 252
365 3300031250 Ga0265331_10008461 Ga0265331_100084614 252
366 3300031251 Ga0265327_10000012 Ga0265327_10000012315 252
367 3300031251 Ga0265327_10000236 Ga0265327_1000023683 252
368 3300031711 Ga0265314_10073018 Ga0265314_100730182 252
369 3300031730 Ga0307516_10130429 Ga0307516_101304292 252
370 3300031824 Ga0307413_10000173 Ga0307413_100001733 252
371 3300032126 Ga0307415_100157908 Ga0307415_1001579082 252
372 3300035398 Ga0316574_0051890 Ga0316574_0051890_1432_2190 252
373 3300036647 Ga0316582_0407046 Ga0316582_0407046_128_886 252
374 3300037312 Ga0395899_0000068 Ga0395899_0000068_25176_25943 252
375 3300037312 Ga0395899_0031663 Ga0395899_0031663_164_949 252
376 3300037312 Ga0395899_0096575 Ga0395899_0096575_999_1760 252
377 3300037418 Ga0395900_0000012 Ga0395900_0000012_236391_237158 252
378 3300037418 Ga0395900_0026413 Ga0395900_0026413_755_1540 252
379 3300037466 Ga0395898_0000278 Ga0395898_0000278_123511_124278 252
380 3300037466 Ga0395898_0072085 Ga0395898_0072085_262_1029 252
381 3300037466 Ga0395898_0168967 Ga0395898_0168967_1016_1801 252
382 3300037466 Ga0395898_0224751 Ga0395898_0224751_139_900 252
383 3300037471 Ga0395905_0041900 Ga0395905_0041900_1189_1950 252
384 3300037471 Ga0395905_0390055 Ga0395905_0390055_347_1123 252
385 3300037471 Ga0395905_0433535 Ga0395905_0433535_441_1199 252
386 3300037471 Ga0395905_0435892 Ga0395905_0435892_29_790 252
387 3300038443 Ga0395901_0020290 Ga0395901_0020290_2911_3678 252
388 3300038443 Ga0395901_0470852 Ga0395901_0470852_40_807 252
389 3300039437 Ga0436365_1196494 Ga0436365_1196494_697_1461 252
390 3300041512 Ga0451853_0616356 Ga0451853_0616356_236_1003 252
391 3300042156 Ga0439446_0002028 Ga0439446_0002028_26_796 252
392 3300042531 Ga0450918_000962 Ga0450918_000962_4494_5267 252
393 3300044536 Ga0466988_0011655 Ga0466988_0011655_1485_2246 252
394 3300044656 Ga0466969_0002180 Ga0466969_0002180_7546_8307 252
395 3300044663 Ga0466989_0038709 Ga0466989_0038709_1614_2375 252
396 3300044683 Ga0466965_0300335 Ga0466965_0300335_93_854 252
397 3300044693 Ga0466961_0000993 Ga0466961_0000993_12381_13148 252
398 3300044693 Ga0466961_0047888 Ga0466961_0047888_171_938 252
399 3300044719 Ga0466971_0157436 Ga0466971_0157436_85_852 252
400 3300044765 Ga0466970_0058609 Ga0466970_0058609_1077_1844 252
401 3300044842 Ga0466957_0000548 Ga0466957_0000548_7275_8042 252
402 3300044842 Ga0466957_0023951 Ga0466957_0023951_993_1751 252
403 3300045049 Ga0466959_0000068 Ga0466959_0000068_4937_5704 252
404 3300045049 Ga0466959_0027305 Ga0466959_0027305_785_1546 252
405 3300045049 Ga0466959_0101069 Ga0466959_0101069_385_1152 252
406 3300045836 Ga0466958_0030025 Ga0466958_0030025_2427_3188 252
407 3300045836 Ga0466958_0048655 Ga0466958_0048655_301_1068 252
408 3300046458 Ga0495591_000078 Ga0495591_000078_50139_50897 252
409 3300046458 Ga0495591_000156 Ga0495591_000156_9363_10121 252
410 3300046458 Ga0495591_003246 Ga0495591_003246_1040_1798 252
411 3300046474 Ga0495605_0000817 Ga0495605_0000817_12496_13254 252
412 3300046474 Ga0495605_0021789 Ga0495605_0021789_1244_2002 252
413 3300046501 Ga0495607_0000163 Ga0495607_0000163_8918_9676 252
414 3300046501 Ga0495607_0000171 Ga0495607_0000171_32406_33164 252
415 3300046501 Ga0495607_0000258 Ga0495607_0000258_18290_19048 252
416 3300046501 Ga0495607_0007681 Ga0495607_0007681_4424_5182 252
417 3300046501 Ga0495607_0047106 Ga0495607_0047106_1747_2505 252
418 3300046501 Ga0495607_0067170 Ga0495607_0067170_1182_1940 252
419 3300046501 Ga0495607_0196809 Ga0495607_0196809_22_780 252
420 3300046506 Ga0495583_0000854 Ga0495583_0000854_27257_28015 252
421 3300046506 Ga0495583_0000871 Ga0495583_0000871_17802_18560 252
422 3300046506 Ga0495583_0001724 Ga0495583_0001724_4705_5463 252
423 3300046506 Ga0495583_0004274 Ga0495583_0004274_3484_4242 252
424 3300046507 Ga0495606_0000028 Ga0495606_0000028_134485_135243 252
425 3300046507 Ga0495606_0006815 Ga0495606_0006815_8080_8838 252
426 3300046515 Ga0495620_0000159 Ga0495620_0000159_36146_36904 252
427 3300046515 Ga0495620_0002659 Ga0495620_0002659_5895_6653 252
428 3300046515 Ga0495620_0061174 Ga0495620_0061174_160_918 252
429 3300046518 Ga0495631_0001918 Ga0495631_0001918_3523_4281 252
430 3300046519 Ga0495632_0004698 Ga0495632_0004698_5963_6730 252
431 3300046519 Ga0495632_0017688 Ga0495632_0017688_2808_3566 252
432 3300046520 Ga0495637_0000202 Ga0495637_0000202_18266_19024 252
433 3300046520 Ga0495637_0002422 Ga0495637_0002422_9224_9982 252
434 3300046520 Ga0495637_0010612 Ga0495637_0010612_26_784 252
435 3300046522 Ga0495643_0012501 Ga0495643_0012501_3728_4486 252
436 3300046524 Ga0495648_0000900 Ga0495648_0000900_16340_17098 252
437 3300046530 Ga0495654_0000393 Ga0495654_0000393_27711_28469 252
438 3300046530 Ga0495654_0007598 Ga0495654_0007598_694_1452 252
439 3300046530 Ga0495654_0076679 Ga0495654_0076679_30_824 252
440 3300046538 Ga0495609_0021570 Ga0495609_0021570_874_1632 252
441 3300046542 Ga0495597_0000002 Ga0495597_0000002_383543_384301 252
442 3300046542 Ga0495597_0000160 Ga0495597_0000160_37905_38672 252
443 3300046616 Ga0495668_0012877 Ga0495668_0012877_1192_1950 252
444 3300046616 Ga0495668_0270696 Ga0495668_0270696_22_780 252
445 3300046648 Ga0495611_0002061 Ga0495611_0002061_8272_9030 252
446 3300046660 Ga0495625_0020129 Ga0495625_0020129_3197_3970 252
447 3300046665 Ga0495661_0006975 Ga0495661_0006975_978_1736 252
448 3300046665 Ga0495661_0007469 Ga0495661_0007469_5132_5890 252
449 3300046665 Ga0495661_0160079 Ga0495661_0160079_255_1013 252
450 3300046684 Ga0495669_0023491 Ga0495669_0023491_1629_2402 252
451 3300046692 Ga0495671_0001449 Ga0495671_0001449_5512_6270 252
452 3300046810 Ga0495660_0000111 Ga0495660_0000111_21262_22020 252
453 3300046810 Ga0495660_0000244 Ga0495660_0000244_47409_48167 252
454 3300046810 Ga0495660_0079501 Ga0495660_0079501_354_1112 252
455 3300047320 Ga0495672_0003227 Ga0495672_0003227_3732_4490 252
456 3300047320 Ga0495672_0026471 Ga0495672_0026471_2079_2837 252
457 3300047320 Ga0495672_0053668 Ga0495672_0053668_545_1303 252
458 3300047469 Ga0495673_0001033 Ga0495673_0001033_8180_8938 252
459 3300047469 Ga0495673_0001617 Ga0495673_0001617_6351_7109 252
460 3300047469 Ga0495673_0003483 Ga0495673_0003483_8336_9094 252
461 3300047469 Ga0495673_0004359 Ga0495673_0004359_7256_8014 252
462 3300047469 Ga0495673_0005537 Ga0495673_0005537_3729_4487 252
463 3300047469 Ga0495673_0033014 Ga0495673_0033014_1397_2155 252
464 3300047472 Ga0495686_0000457 Ga0495686_0000457_45386_46144 252
465 3300047472 Ga0495686_0022704 Ga0495686_0022704_3301_4059 252
466 3300047472 Ga0495686_0071138 Ga0495686_0071138_1306_2064 252
467 3300048905 Ga0496102_0051921 Ga0496102_0051921_1760_2524 252
468 3300048905 Ga0496102_0091059 Ga0496102_0091059_1551_2309 252
469 3300048907 Ga0496104_0267724 Ga0496104_0267724_573_1346 252
470 3300048908 Ga0496105_0091045 Ga0496105_0091045_1149_1922 252
471 3300048913 Ga0496110_0083301 Ga0496110_0083301_1411_2169 252
472 3300048919 Ga0496116_0064526 Ga0496116_0064526_1504_2280 252
473 3300048921 Ga0496118_0005604 Ga0496118_0005604_1095_1859 252
474 3300048924 Ga0496121_0005351 Ga0496121_0005351_9419_10177 252
475 3300048924 Ga0496121_0064865 Ga0496121_0064865_95_862 252
476 3300048924 Ga0496121_0182810 Ga0496121_0182810_373_1143 252
477 3300048925 Ga0496122_0002072 Ga0496122_0002072_14781_15551 252
478 3300048925 Ga0496122_0006119 Ga0496122_0006119_6258_7016 252
479 3300048925 Ga0496122_0135448 Ga0496122_0135448_39_815 252
480 3300048926 Ga0496123_0000113 Ga0496123_0000113_15020_15790 252
481 3300048926 Ga0496123_0032655 Ga0496123_0032655_2879_3637 252
482 3300048927 Ga0496124_0003960 Ga0496124_0003960_10055_10813 252
483 3300048927 Ga0496124_0032257 Ga0496124_0032257_1061_1819 252
484 3300048929 Ga0496126_0103943 Ga0496126_0103943_1409_2179 252
485 3300049459 Ga0495678_000072 Ga0495678_000072_76532_77290 252
486 3300049459 Ga0495678_003197 Ga0495678_003197_5090_5848 252
487 3300049460 Ga0495682_0000023 Ga0495682_0000023_76515_77273 252
488 3300049568 Ga0501031_0041521 Ga0501031_0041521_418_1194 252
489 3300049569 Ga0501032_0001932 Ga0501032_0001932_10907_11755 252
490 3300049571 Ga0501034_0001874 Ga0501034_0001874_13601_14449 252
491 3300049572 Ga0501036_0055206 Ga0501036_0055206_1501_2349 252
492 3300049573 Ga0501037_0001836 Ga0501037_0001836_5557_6405 252
493 3300049574 Ga0501038_0016910 Ga0501038_0016910_2816_3664 252
494 3300049575 Ga0501039_0001164 Ga0501039_0001164_8728_9576 252
495 3300049580 Ga0501046_0003034 Ga0501046_0003034_4724_5572 252
496 3300049581 Ga0501047_0005642 Ga0501047_0005642_2928_3776 252
497 3300049582 Ga0501048_0255758 Ga0501048_0255758_58_906 252
498 3300049583 Ga0501067_0000831 Ga0501067_0000831_9650_10498 252
499 3300049586 Ga0501070_0010898 Ga0501070_0010898_348_1196 252
500 3300049589 Ga0501073_0006486 Ga0501073_0006486_6158_7006 252
501 3300049656 Ga0501209_000025 Ga0501209_000025_7076_7837 252
502 3300049741 Ga0501079_0546984 Ga0501079_0546984_83_874 252
503 3300049742 Ga0501080_0000002 Ga0501080_0000002_55174_56022 252
504 3300049822 Ga0501035_0000089 Ga0501035_0000089_103118_103966 252
505 3300049822 Ga0501035_0256354 Ga0501035_0256354_320_1096 252
506 3300049823 Ga0501044_0000249 Ga0501044_0000249_35522_36370 252
507 3300050493 nmdc:mga0k408_10397_c1 nmdc:mga0k408_10397_c1_414_1172 252
508 3300050493 nmdc:mga0k408_253846_c1 nmdc:mga0k408_253846_c1_223_993 252
509 3300050493 nmdc:mga0k408_49901_c2 nmdc:mga0k408_49901_c2_761_1519 252
510 3300050493 nmdc:mga0k408_94744_c1 nmdc:mga0k408_94744_c1_667_1425 252
511 3300050496 nmdc:mga07m45_170988_c1 nmdc:mga07m45_170988_c1_454_1212 252
512 3300050496 nmdc:mga07m45_21945_c1 nmdc:mga07m45_21945_c1_2461_3228 252
513 3300050507 nmdc:mga05p37_82175_c1 nmdc:mga05p37_82175_c1_1263_2063 252
514 3300050508 nmdc:mga09592_395184_c1 nmdc:mga09592_395184_c1_42_842 252
515 3300050510 nmdc:mga06r32_11831_c1 nmdc:mga06r32_11831_c1_3329_4129 252
516 3300050510 nmdc:mga06r32_56233_c1 nmdc:mga06r32_56233_c1_1054_1854 252
517 3300050510 nmdc:mga06r32_721607_c1 nmdc:mga06r32_721607_c1_36_836 252
518 3300050512 nmdc:mga0n895_365959_c1 nmdc:mga0n895_365959_c1_285_1085 252
519 3300050515 nmdc:mga0a205_59935_c1 nmdc:mga0a205_59935_c1_1959_2759 252
520 3300053086 Ga0500578_0000011 Ga0500578_0000011_127016_127876 252
521 3300053090 Ga0500646_0018797 Ga0500646_0018797_877_1644 252
522 3300053098 Ga0500650_0148007 Ga0500650_0148007_32_808 252
523 3300053120 Ga0500597_037596 Ga0500597_037596_838_1608 252
524 3300053125 Ga0500618_005891 Ga0500618_005891_689_1489 252
525 3300053127 Ga0500623_163583 Ga0500623_163583_61_831 252
526 3300053130 Ga0500642_0113872 Ga0500642_0113872_378_1145 252
527 3300053131 Ga0500652_000495 Ga0500652_000495_6428_7195 252
528 3300053133 Ga0500655_004767 Ga0500655_004767_491_1258 252
529 3300053134 Ga0500658_0127886 Ga0500658_0127886_305_1081 252
530 3300053139 Ga0500568_0028370 Ga0500568_0028370_1448_2224 252
531 3300053140 Ga0500573_0001008 Ga0500573_0001008_4355_5152 252
532 3300053150 Ga0500603_025709 Ga0500603_025709_17_787 252
533 3300053151 Ga0500604_0015980 Ga0500604_0015980_1235_2002 252
534 3300053151 Ga0500604_0064738 Ga0500604_0064738_131_991 252
535 3300053156 Ga0500622_0000689 Ga0500622_0000689_5911_6678 252
536 3300053177 Ga0500636_0063532 Ga0500636_0063532_1288_2058 252
537 3300053724 Ga0500570_073252 Ga0500570_073252_398_1165 252
538 3300060353 Ga0501082_0026413 Ga0501082_0026413_2000_2848 252
539 3300061719 Ga0466962_0076405 Ga0466962_0076405_42_803 252
540 iso_pu_bacteria 2738541277 2738720594 252
541 iso_pu_bacteria 2738543019 2739279793 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

47

246

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

53

294

0.91

PF08659

KR

KR domain

48

230

0.86

PF23441

40

295

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nm8-assembly1.cif.gz_AAA the crystal structure of the antimycin pathway standalone ketoreductase, antm, in complex with nadph 0.9649 4 250
4osp-assembly1.cif.gz_C the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9648 2 251
4osp-assembly1.cif.gz_D the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9612 2 251
4kwh-assembly1.cif.gz_B the crystal structure of angucycline c-6 ketoreductase lanv with bound nadp 0.9584 4 251
6yq3-assembly1.cif.gz_AAA promiscuous reductase lugoii catalyzes keto-reduction at c1 during lugdunomycin biosynthesis 0.9583 2 251
ID Description Score Start End Superfamily
4ospB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 2 251 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 4 250 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 1 252 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9398 4 250 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9397 4 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0B6S5B2-F1-model_v4 Putative short-chain dehydrogenase/reductase SDR 0.9959 2 252
AF-A0A377XTH1-F1-model_v4 7-alpha-hydroxysteroid dehydrogenase (EC 1.1.1.100) 0.9913 45 184 GO:0004316
GO:0030497
AF-A0A0E3VWU8-F1-model_v4 Putative oxidoreductase 0.9909 21 252 GO:0016616
GO:0030497
AF-A0A7X2MTI2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9901 1 73
AF-A0A0B6S5B2-F1-model_v4 Putative short-chain dehydrogenase/reductase SDR 0.988 2 252

Feature Viewer

pLDDT pTM Quality
96.04 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map