F461377

General Info

Members Datasets Scaffolds Average Seq Length
541 302 1082 109

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10015534|Ga0207678_100155342
Length 134
Sequence MRTFSPQHATSCAARFDGSIFRHLSMPKSDSLQGSLDLLVLKLLFRRPRLHGYAIMSAIRETSEEALRVEEGSLYPALHRMEEAKWIRAEWVNKENGRRARVYEITAAGKKQLAAEELRWETVTAAVNRVLRMA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
98 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
99 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
100 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
201 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
202 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
208 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
209 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
210 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
218 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 2.22
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 39.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10015534 3300026067 Bacteria 6695
2 JGI24751J29686_10046722 3300002459 Bacteria 894
3 Ga0065707_10029678 3300005295 Unclassified 1442
4 Ga0070683_100007311 3300005329 Bacteria 9322
5 Ga0070683_100149516 3300005329 Unclassified 2214
6 Ga0070683_100837744 3300005329 Bacteria 882
7 Ga0070690_100965028 3300005330 Bacteria 670
8 Ga0070670_100089981 3300005331 Bacteria 2638
9 Ga0070670_100619279 3300005331 Unclassified 970
10 Ga0070677_10010083 3300005333 Bacteria 3220
11 Ga0070666_11007920 3300005335 Unclassified 618
12 Ga0070680_100007311 3300005336 Bacteria 8419
13 Ga0070680_100366850 3300005336 Bacteria 1225
14 Ga0070680_100554103 3300005336 Bacteria 985
15 Ga0070680_100687543 3300005336 Unclassified 880
16 Ga0070682_100164560 3300005337 Bacteria 1535
17 Ga0070682_100940032 3300005337 Unclassified 713
18 Ga0068868_101148457 3300005338 Unclassified 716
19 Ga0070660_100496313 3300005339 Unclassified 1015
20 Ga0070660_101630465 3300005339 Unclassified 549
21 Ga0070689_101356117 3300005340 Bacteria 642
22 Ga0070687_100315517 3300005343 Bacteria 997
23 Ga0070661_100353264 3300005344 Bacteria 1154
24 Ga0070661_101551722 3300005344 Unclassified 559
25 Ga0070692_10142062 3300005345 Bacteria 1360
26 Ga0070668_100255407 3300005347 Unclassified 1456
27 Ga0070668_100608697 3300005347 Bacteria 956
28 Ga0070669_100496843 3300005353 Bacteria 1011
29 Ga0070669_101371293 3300005353 Unclassified 613
30 Ga0070675_100451807 3300005354 Bacteria 1152
31 Ga0070675_100658656 3300005354 Unclassified 952
32 Ga0070675_101394558 3300005354 Unclassified 646
33 Ga0070671_101239920 3300005355 Bacteria 657
34 Ga0070671_101521319 3300005355 Unclassified 592
35 Ga0070671_101551991 3300005355 Unclassified 586
36 Ga0070674_100226322 3300005356 Unclassified 1457
37 Ga0070673_101120845 3300005364 Unclassified 735
38 Ga0070688_100127756 3300005365 Bacteria 1711
39 Ga0070659_100406446 3300005366 Bacteria 1150
40 Ga0070659_100799532 3300005366 Unclassified 820
41 Ga0070659_101093269 3300005366 Bacteria 703
42 Ga0070667_100211254 3300005367 Bacteria 1725
43 Ga0070667_100242638 3300005367 Bacteria 1609
44 Ga0070667_100925520 3300005367 Bacteria 812
45 Ga0070667_101014031 3300005367 Unclassified 775
46 Ga0070667_102044572 3300005367 Unclassified 540
47 Ga0070703_10096488 3300005406 Bacteria 1035
48 Ga0070709_10435784 3300005434 Unclassified 985
49 Ga0070709_10577669 3300005434 Unclassified 863
50 Ga0070709_11568019 3300005434 Unclassified 536
51 Ga0070714_100148068 3300005435 Bacteria 2113
52 Ga0070714_101090551 3300005435 Unclassified 778
53 Ga0070713_100387145 3300005436 Bacteria 1304
54 Ga0070713_100920835 3300005436 Bacteria 841
55 Ga0070713_101740058 3300005436 Unclassified 605
56 Ga0070710_10099810 3300005437 Bacteria 1727
57 Ga0070710_10636775 3300005437 Unclassified 746
58 Ga0070701_10392318 3300005438 Bacteria 878
59 Ga0070711_100023661 3300005439 Unclassified 3998
60 Ga0070700_100349558 3300005441 Bacteria 1095
61 Ga0070708_100624957 3300005445 Unclassified 1015
62 Ga0070663_100675337 3300005455 Unclassified 876
63 Ga0070678_100404037 3300005456 Unclassified 1187
64 Ga0070678_100569622 3300005456 Bacteria 1007
65 Ga0070681_10113850 3300005458 Bacteria 2644
66 Ga0070681_10149034 3300005458 Bacteria 2267
67 Ga0070681_10207251 3300005458 Bacteria 1877
68 Ga0070681_10589173 3300005458 Unclassified 1026
69 Ga0068867_100394239 3300005459 Bacteria 1166
70 Ga0068867_100872580 3300005459 Bacteria 808
71 Ga0068867_100912287 3300005459 Unclassified 791
72 Ga0070706_100940339 3300005467 Unclassified 798
73 Ga0070698_100532958 3300005471 Bacteria 1113
74 Ga0070698_101270238 3300005471 Bacteria 686
75 Ga0070679_100199821 3300005530 Bacteria 1966
76 Ga0070679_101505428 3300005530 Bacteria 620
77 Ga0070684_100000081 3300005535 Bacteria 62318
78 Ga0070684_100203047 3300005535 Unclassified 1806
79 Ga0070684_100422219 3300005535 Bacteria 1231
80 Ga0070684_101220625 3300005535 Unclassified 707
81 Ga0070684_101507294 3300005535 Unclassified 634
82 Ga0068853_100011090 3300005539 Bacteria 7310
83 Ga0068853_101850076 3300005539 Unclassified 585
84 Ga0070695_100237845 3300005545 Bacteria 1320
85 Ga0070696_100231235 3300005546 Bacteria 1391
86 Ga0070696_100440962 3300005546 Bacteria 1026
87 Ga0070696_101409772 3300005546 Unclassified 594
88 Ga0070693_100492712 3300005547 Bacteria 868
89 Ga0070665_100485697 3300005548 Bacteria 1246
90 Ga0068855_100015667 3300005563 Bacteria 9123
91 Ga0068855_100131849 3300005563 Unclassified 2854
92 Ga0068855_102408242 3300005563 Bacteria 525
93 Ga0070664_100067734 3300005564 Bacteria 3051
94 Ga0070664_101324368 3300005564 Unclassified 680
95 Ga0068857_100100287 3300005577 Bacteria 2598
96 Ga0068857_100288777 3300005577 Bacteria 1510
97 Ga0068854_101507212 3300005578 Unclassified 611
98 Ga0068854_102165717 3300005578 Unclassified 514
99 Ga0068856_100193168 3300005614 Bacteria 2049
100 Ga0068856_100205029 3300005614 Unclassified 1987
101 Ga0068856_100702030 3300005614 Unclassified 1032
102 Ga0068856_101775917 3300005614 Bacteria 629
103 Ga0068856_102011334 3300005614 Unclassified 588
104 Ga0070702_100292010 3300005615 Bacteria 1124
105 Ga0068859_102494916 3300005617 Unclassified 569
106 Ga0068864_100093760 3300005618 Bacteria 2652
107 Ga0068864_100508400 3300005618 Bacteria 1160
108 Ga0068870_10101236 3300005840 Bacteria 1628
109 Ga0068863_100112021 3300005841 Bacteria 2599
110 Ga0068863_100807961 3300005841 Bacteria 935
111 Ga0068858_102053946 3300005842 Unclassified 565
112 Ga0068860_100851708 3300005843 Bacteria 926
113 Ga0068860_100912504 3300005843 Bacteria 895
114 Ga0068860_102166550 3300005843 Unclassified 577
115 Ga0081455_10067400 3300005937 Bacteria 2983
116 Ga0081455_10078726 3300005937 Bacteria 2708
117 Ga0070717_10035887 3300006028 Unclassified 4018
118 Ga0070717_10042564 3300006028 Bacteria 3704
119 Ga0070717_10043199 3300006028 Unclassified 3678
120 Ga0075365_10181014 3300006038 Bacteria 1473
121 Ga0075368_10284864 3300006042 Bacteria 710
122 Ga0075368_10438306 3300006042 Unclassified 577
123 Ga0075432_10237697 3300006058 Unclassified 735
124 Ga0070715_10963580 3300006163 Unclassified 529
125 Ga0070716_100238021 3300006173 Bacteria 1233
126 Ga0070716_100998555 3300006173 Bacteria 662
127 Ga0070712_100005796 3300006175 Bacteria 7635
128 Ga0070712_100207949 3300006175 Bacteria 1542
129 Ga0070712_100600769 3300006175 Unclassified 931
130 Ga0070712_100900220 3300006175 Bacteria 763
131 Ga0075362_10467384 3300006177 Bacteria 642
132 Ga0075367_10015191 3300006178 Bacteria 4179
133 Ga0075367_10023662 3300006178 Bacteria 3458
134 Ga0075366_10123593 3300006195 Bacteria 1560
135 Ga0075366_10871666 3300006195 Unclassified 560
136 Ga0097621_100660479 3300006237 Unclassified 960
137 Ga0097621_101029839 3300006237 Unclassified 771
138 Ga0075370_10035596 3300006353 Bacteria 2794
139 Ga0068871_100881959 3300006358 Unclassified 828
140 Ga0068871_101468327 3300006358 Unclassified 644
141 Ga0068871_102288282 3300006358 Unclassified 515
142 Ga0075430_100655611 3300006846 Unclassified 865
143 Ga0075430_100768690 3300006846 Unclassified 794
144 Ga0075430_100787906 3300006846 Bacteria 783
145 Ga0075431_100009540 3300006847 Bacteria 9746
146 Ga0075431_100108727 3300006847 Bacteria 2861
147 Ga0075431_100213523 3300006847 Unclassified 1970
148 Ga0075431_100577822 3300006847 Unclassified 1109
149 Ga0075433_10124058 3300006852 Bacteria 2294
150 Ga0075433_10190675 3300006852 Bacteria 1823
151 Ga0075433_10517076 3300006852 Bacteria 1050
152 Ga0075434_101173982 3300006871 Unclassified 780
153 Ga0075436_100225465 3300006914 Unclassified 1330
154 Ga0097620_102496268 3300006931 Unclassified 569
155 Ga0075435_100009339 3300007076 Bacteria 7094
156 Ga0075435_100115701 3300007076 Bacteria 2233
157 Ga0075435_100733314 3300007076 Bacteria 859
158 Ga0075435_100965618 3300007076 Bacteria 744
159 Ga0075435_101018408 3300007076 Unclassified 723
160 Ga0099794_10199747 3300007265 Bacteria 1024
161 Ga0099795_10003278 3300007788 Bacteria 3982
162 Ga0105240_10000350 3300009093 Bacteria 86419
163 Ga0105240_10005029 3300009093 Bacteria 19847
164 Ga0105240_10339261 3300009093 Bacteria 1708
165 Ga0105240_10369141 3300009093 Bacteria 1623
166 Ga0105240_10784217 3300009093 Bacteria 1033
167 Ga0105240_12229838 3300009093 Unclassified 568
168 Ga0111539_10105875 3300009094 Bacteria 3300
169 Ga0111539_12418899 3300009094 Unclassified 609
170 Ga0105245_10406385 3300009098 Bacteria 1362
171 Ga0105245_11115876 3300009098 Bacteria 835
172 Ga0105245_11796074 3300009098 Unclassified 666
173 Ga0105245_12309738 3300009098 Unclassified 591
174 Ga0105247_10216079 3300009101 Unclassified 1296
175 Ga0105247_11264928 3300009101 Unclassified 591
176 Ga0114129_10597737 3300009147 Bacteria 1430
177 Ga0114129_12381981 3300009147 Unclassified 634
178 Ga0114129_12716693 3300009147 Unclassified 590
179 Ga0105241_10066473 3300009174 Unclassified 2788
180 Ga0105241_10199653 3300009174 Bacteria 1670
181 Ga0105242_10303152 3300009176 Unclassified 1459
182 Ga0105242_10554793 3300009176 Bacteria 1102
183 Ga0105242_10791809 3300009176 Bacteria 938
184 Ga0105248_10070281 3300009177 Bacteria 3932
185 Ga0105248_10506402 3300009177 Unclassified 1361
186 Ga0105248_10551620 3300009177 Bacteria 1300
187 Ga0105248_10776496 3300009177 Unclassified 1081
188 Ga0105248_10803338 3300009177 Bacteria 1062
189 Ga0105248_11858670 3300009177 Unclassified 683
190 Ga0105237_10001342 3300009545 Bacteria 32642
191 Ga0105237_10216750 3300009545 Bacteria 1914
192 Ga0105237_10310996 3300009545 Bacteria 1579
193 Ga0105237_10869035 3300009545 Bacteria 909
194 Ga0105237_10953553 3300009545 Unclassified 865
195 Ga0105238_10091771 3300009551 Bacteria 3024
196 Ga0105238_12820690 3300009551 Unclassified 522
197 Ga0105249_10239324 3300009553 Bacteria 1794
198 Ga0105249_12433451 3300009553 Unclassified 596
199 Ga0099796_10003775 3300010159 Bacteria 3569
200 Ga0105239_10709767 3300010375 Bacteria 1150
201 Ga0105239_12604955 3300010375 Bacteria 590
202 Ga0105246_10082134 3300011119 Unclassified 2299
203 Ga0105246_10431934 3300011119 Unclassified 1102
204 Ga0157343_1041098 3300012488 Unclassified 503
205 Ga0157347_1032319 3300012502 Bacteria 661
206 Ga0157342_1040679 3300012507 Unclassified 621
207 Ga0157327_1020517 3300012512 Bacteria 741
208 Ga0157373_10537072 3300013100 Unclassified 847
209 Ga0157373_10785950 3300013100 Bacteria 701
210 Ga0157370_10014111 3300013104 Bacteria 8195
211 Ga0157370_10265073 3300013104 Bacteria 1587
212 Ga0157369_10007867 3300013105 Bacteria 12259
213 Ga0157369_10015808 3300013105 Bacteria 8501
214 Ga0157369_11144301 3300013105 Bacteria 795
215 Ga0157374_10001857 3300013296 Bacteria 17775
216 Ga0157374_11119861 3300013296 Unclassified 808
217 Ga0157374_11946616 3300013296 Bacteria 614
218 Ga0157378_10574467 3300013297 Bacteria 1136
219 Ga0157378_10787107 3300013297 Bacteria 976
220 Ga0157378_11189446 3300013297 Unclassified 801
221 Ga0157378_12122441 3300013297 Bacteria 613
222 Ga0157378_12542150 3300013297 Unclassified 564
223 Ga0163162_10716042 3300013306 Bacteria 1122
224 Ga0163162_11297042 3300013306 Unclassified 827
225 Ga0163162_12111636 3300013306 Unclassified 646
226 Ga0163162_12217936 3300013306 Unclassified 631
227 Ga0163162_12519127 3300013306 Bacteria 592
228 Ga0157372_10146856 3300013307 Unclassified 2719
229 Ga0157372_10568295 3300013307 Unclassified 1322
230 Ga0157372_12202260 3300013307 Unclassified 633
231 Ga0157375_12198175 3300013308 Bacteria 657
232 Ga0157375_12244000 3300013308 Unclassified 650
233 Ga0163163_10006827 3300014325 Bacteria 10013
234 Ga0163163_10045778 3300014325 Bacteria 4296
235 Ga0163163_10219270 3300014325 Bacteria 1951
236 Ga0163163_10417148 3300014325 Bacteria 1401
237 Ga0157380_10696297 3300014326 Bacteria 1020
238 Ga0157377_10196184 3300014745 Bacteria 1279
239 Ga0157379_10004144 3300014968 Bacteria 12373
240 Ga0157379_10007484 3300014968 Bacteria 9454
241 Ga0157379_10016676 3300014968 Bacteria 6461
242 Ga0157379_12055193 3300014968 Unclassified 565
243 Ga0157376_10158598 3300014969 Unclassified 2048
244 Ga0157376_10265071 3300014969 Bacteria 1611
245 Ga0157376_11100463 3300014969 Unclassified 820
246 Ga0157376_12870833 3300014969 Unclassified 521
247 Ga0163161_10781007 3300017792 Bacteria 801
248 Ga0213875_10289298 3300021388 Unclassified 774
249 Ga0213875_10672888 3300021388 Unclassified 502
250 Ga0207666_1000893 3300025271 Bacteria 3577
251 Ga0207653_10184370 3300025885 Bacteria 782
252 Ga0207682_10006984 3300025893 Bacteria 4524
253 Ga0207692_10075866 3300025898 Bacteria 1785
254 Ga0207692_10106424 3300025898 Bacteria 1549
255 Ga0207642_10453316 3300025899 Bacteria 777
256 Ga0207688_10379569 3300025901 Bacteria 874
257 Ga0207680_10910367 3300025903 Unclassified 630
258 Ga0207647_10220261 3300025904 Bacteria 1094
259 Ga0207685_10362350 3300025905 Unclassified 734
260 Ga0207699_10082483 3300025906 Unclassified 1997
261 Ga0207699_10314146 3300025906 Bacteria 1097
262 Ga0207699_10392677 3300025906 Unclassified 987
263 Ga0207699_10640990 3300025906 Bacteria 776
264 Ga0207699_11450266 3300025906 Unclassified 508
265 Ga0207643_10015837 3300025908 Unclassified 4106
266 Ga0207654_10537194 3300025911 Unclassified 829
267 Ga0207707_10121867 3300025912 Bacteria 2280
268 Ga0207707_10380467 3300025912 Bacteria 1213
269 Ga0207707_10382632 3300025912 Bacteria 1209
270 Ga0207707_10401350 3300025912 Unclassified 1177
271 Ga0207695_10001593 3300025913 Bacteria 36862
272 Ga0207695_10141756 3300025913 Bacteria 2351
273 Ga0207695_10149116 3300025913 Bacteria 2279
274 Ga0207695_10149397 3300025913 Bacteria 2277
275 Ga0207695_10180749 3300025913 Bacteria 2030
276 Ga0207671_10055868 3300025914 Bacteria 2925
277 Ga0207671_10200922 3300025914 Bacteria 1557
278 Ga0207671_10786028 3300025914 Bacteria 755
279 Ga0207693_10002764 3300025915 Bacteria 15191
280 Ga0207693_10056926 3300025915 Bacteria 3065
281 Ga0207693_10570076 3300025915 Unclassified 882
282 Ga0207693_10698795 3300025915 Bacteria 786
283 Ga0207660_10003362 3300025917 Bacteria 10438
284 Ga0207660_10103568 3300025917 Bacteria 2129
285 Ga0207662_10105693 3300025918 Unclassified 1750
286 Ga0207657_10048952 3300025919 Bacteria 3687
287 Ga0207657_10329609 3300025919 Unclassified 1206
288 Ga0207649_11306534 3300025920 Unclassified 574
289 Ga0207652_10413629 3300025921 Bacteria 1216
290 Ga0207681_11325487 3300025923 Unclassified 604
291 Ga0207694_10158619 3300025924 Bacteria 1826
292 Ga0207694_10996085 3300025924 Unclassified 709
293 Ga0207650_10245692 3300025925 Unclassified 1447
294 Ga0207650_10259854 3300025925 Bacteria 1408
295 Ga0207700_10936071 3300025928 Unclassified 775
296 Ga0207664_11098171 3300025929 Unclassified 711
297 Ga0207664_11236476 3300025929 Unclassified 665
298 Ga0207690_10169236 3300025932 Bacteria 1635
299 Ga0207690_10721995 3300025932 Unclassified 820
300 Ga0207706_10064349 3300025933 Bacteria 3229
301 Ga0207686_10564980 3300025934 Bacteria 891
302 Ga0207686_11124049 3300025934 Bacteria 641
303 Ga0207709_10138824 3300025935 Bacteria 1668
304 Ga0207670_10100405 3300025936 Bacteria 2066
305 Ga0207670_10267361 3300025936 Bacteria 1328
306 Ga0207670_10558605 3300025936 Bacteria 936
307 Ga0207669_10494135 3300025937 Bacteria 978
308 Ga0207691_10049087 3300025940 Bacteria 3867
309 Ga0207711_10109601 3300025941 Bacteria 2454
310 Ga0207711_11067424 3300025941 Unclassified 748
311 Ga0207711_11588771 3300025941 Bacteria 597
312 Ga0207689_10269161 3300025942 Bacteria 1410
313 Ga0207661_10000028 3300025944 Bacteria 173347
314 Ga0207661_10005323 3300025944 Bacteria 9061
315 Ga0207661_10067927 3300025944 Unclassified 2901
316 Ga0207661_11088133 3300025944 Unclassified 736
317 Ga0207661_11416598 3300025944 Unclassified 638
318 Ga0207679_10315443 3300025945 Bacteria 1352
319 Ga0207679_10769508 3300025945 Bacteria 876
320 Ga0207679_11205056 3300025945 Unclassified 695
321 Ga0207667_10167885 3300025949 Bacteria 2256
322 Ga0207667_11579996 3300025949 Unclassified 625
323 Ga0207651_11793003 3300025960 Unclassified 552
324 Ga0207712_10987668 3300025961 Bacteria 747
325 Ga0207668_10437746 3300025972 Unclassified 1113
326 Ga0207640_11396251 3300025981 Bacteria 627
327 Ga0207640_11448484 3300025981 Bacteria 616
328 Ga0207658_10209147 3300025986 Bacteria 1634
329 Ga0207658_11349874 3300025986 Unclassified 652
330 Ga0207658_11850597 3300025986 Unclassified 550
331 Ga0207677_10629357 3300026023 Bacteria 945
332 Ga0207639_10007791 3300026041 Bacteria 7314
333 Ga0207678_10028595 3300026067 Bacteria 4865
334 Ga0207678_10209668 3300026067 Bacteria 1667
335 Ga0207678_11528886 3300026067 Bacteria 589
336 Ga0207708_10104937 3300026075 Bacteria 2190
337 Ga0207708_10556961 3300026075 Unclassified 967
338 Ga0207702_10007173 3300026078 Bacteria 9539
339 Ga0207702_10256323 3300026078 Bacteria 1645
340 Ga0207702_10682952 3300026078 Bacteria 1011
341 Ga0207702_10696660 3300026078 Unclassified 1001
342 Ga0207641_10240891 3300026088 Bacteria 1685
343 Ga0207641_11570569 3300026088 Unclassified 660
344 Ga0207648_10249525 3300026089 Bacteria 1582
345 Ga0207648_10818621 3300026089 Unclassified 867
346 Ga0207648_10887894 3300026089 Bacteria 832
347 Ga0207648_11461153 3300026089 Bacteria 643
348 Ga0207676_10082084 3300026095 Bacteria 2621
349 Ga0207676_10523227 3300026095 Bacteria 1129
350 Ga0207674_10098603 3300026116 Bacteria 2905
351 Ga0207674_10310967 3300026116 Bacteria 1525
352 Ga0207674_10543762 3300026116 Bacteria 1122
353 Ga0207683_10107419 3300026121 Unclassified 2497
354 Ga0207683_10401608 3300026121 Unclassified 1261
355 Ga0207683_11132592 3300026121 Unclassified 726
356 Ga0207698_10597666 3300026142 Unclassified 1087
357 Ga0207698_11468605 3300026142 Unclassified 697
358 Ga0209969_1052156 3300027360 Bacteria 642
359 Ga0209967_1043851 3300027364 Unclassified 682
360 Ga0209996_1011443 3300027395 Bacteria 1185
361 Ga0209995_1093700 3300027471 Bacteria 517
362 Ga0209982_1043651 3300027552 Unclassified 717
363 Ga0209970_1052430 3300027614 Bacteria 739
364 Ga0209983_1007347 3300027665 Bacteria 2258
365 Ga0209974_10242750 3300027876 Unclassified 676
366 Ga0207428_10034759 3300027907 Unclassified 4127
367 Ga0207428_10039502 3300027907 Bacteria 3832
368 Ga0268266_11996287 3300028379 Unclassified 554
369 Ga0268265_10204506 3300028380 Bacteria 1715
370 Ga0268264_11424544 3300028381 Unclassified 703
371 Ga0265762_1116063 3300030760 Bacteria 608
372 Ga0265762_1165550 3300030760 Bacteria 535
373 Ga0265332_10164197 3300031238 Bacteria 927
374 Ga0265331_10035843 3300031250 Bacteria 2439
375 Ga0307509_10489803 3300031507 Unclassified 916
376 Ga0307408_101751706 3300031548 Unclassified 593
377 Ga0265342_10017240 3300031712 Bacteria 4703
378 Ga0373959_0214230 3300034820 Unclassified 514
379 Ga0373926_0026416 3300035083 Bacteria 2031
380 Ga0373926_0303937 3300035083 Unclassified 623
381 Ga0373939_0243554 3300035114 Bacteria 697
382 Ga0373946_0366720 3300035171 Unclassified 722
383 Ga0373931_0212597 3300035691 Bacteria 1161
384 Ga0373931_0539544 3300035691 Bacteria 757
385 Ga0373935_0131249 3300035692 Bacteria 1683
386 Ga0373927_0002217 3300035695 Bacteria 14291
387 Ga0373947_0000895 3300035725 Bacteria 18055
388 Ga0373937_0754115 3300036401 Bacteria 921
389 Ga0373925_0000143 3300037068 Bacteria 76104
390 Ga0395900_1461360 3300037418 Unclassified 596
391 Ga0436364_0211233 3300037853 Unclassified 545
392 Ga0436364_0700924 3300037853 Unclassified 767
393 Ga0436364_1444716 3300037853 Bacteria 1530
394 Ga0436364_1450312 3300037853 Unclassified 2338
395 Ga0242420_083434 3300038996 Bacteria 663
396 Ga0439453_0012271 3300041408 Bacteria 1441
397 Ga0439461_0239156 3300041410 Unclassified 501
398 Ga0439437_013612 3300042000 Bacteria 946
399 Ga0439441_054302 3300042001 Bacteria 831
400 Ga0439442_075943 3300042002 Unclassified 717
401 Ga0439443_015503 3300042003 Bacteria 1157
402 Ga0439445_0194520 3300042004 Unclassified 598
403 Ga0439450_188816 3300042008 Bacteria 549
404 Ga0439456_135369 3300042013 Bacteria 570
405 Ga0450923_013616 3300042125 Bacteria 1497
406 Ga0450896_015026 3300042133 Bacteria 1107
407 Ga0450898_029050 3300042134 Bacteria 1007
408 Ga0439446_0194430 3300042156 Bacteria 683
409 Ga0439434_0184771 3300042435 Unclassified 699
410 Ga0439444_0021657 3300042437 Bacteria 1140
411 Ga0439459_0190003 3300042438 Unclassified 556
412 Ga0439464_0079745 3300042439 Bacteria 976
413 Ga0439464_0225778 3300042439 Unclassified 601
414 Ga0450893_0029442 3300042532 Unclassified 974
415 Ga0439440_0127785 3300042993 Bacteria 712
416 Ga0466966_0997507 3300044684 Unclassified 505
417 Ga0453684_0981746 3300044712 Unclassified 899
418 Ga0466971_0674259 3300044719 Unclassified 519
419 Ga0466959_0598437 3300045049 Unclassified 742
420 Ga0451576_0143469 3300045051 Bacteria 2490
421 Ga0451576_0199145 3300045051 Bacteria 2092
422 Ga0466958_0511555 3300045836 Bacteria 779
423 Ga0466958_1026122 3300045836 Unclassified 538
424 Ga0495580_0042596 3300046472 Bacteria 3234
425 Ga0495580_0281090 3300046472 Bacteria 1135
426 Ga0495662_0073802 3300046476 Unclassified 1655
427 Ga0495662_0280798 3300046476 Unclassified 820
428 Ga0495664_0002400 3300046477 Bacteria 10052
429 Ga0495594_0268887 3300046499 Unclassified 971
430 Ga0495594_0413797 3300046499 Bacteria 767
431 Ga0495628_0236145 3300046516 Bacteria 1369
432 Ga0495630_0221671 3300046517 Unclassified 1444
433 Ga0495630_0483758 3300046517 Unclassified 949
434 Ga0495630_1190025 3300046517 Unclassified 576
435 Ga0495652_0604023 3300046529 Bacteria 748
436 Ga0495652_0803490 3300046529 Bacteria 626
437 Ga0495665_0390356 3300046531 Bacteria 706
438 Ga0495640_0291248 3300046533 Bacteria 1015
439 Ga0495587_0049190 3300046536 Unclassified 2496
440 Ga0495587_0281056 3300046536 Unclassified 933
441 Ga0495645_0242072 3300046543 Unclassified 1203
442 Ga0495667_0140544 3300046559 Bacteria 1556
443 Ga0495634_0344294 3300046642 Bacteria 894
444 Ga0495635_0270830 3300046663 Bacteria 1142
445 Ga0495635_0455125 3300046663 Unclassified 846
446 Ga0495635_0611935 3300046663 Bacteria 711
447 Ga0495661_0206048 3300046665 Bacteria 1027
448 Ga0495588_0628661 3300046674 Unclassified 562
449 Ga0495646_0658298 3300046680 Unclassified 529
450 Ga0495669_0370431 3300046684 Unclassified 693
451 Ga0495669_0610493 3300046684 Bacteria 531
452 Ga0495649_0418085 3300046694 Bacteria 672
453 Ga0495581_0658946 3300047315 Bacteria 605
454 Ga0495604_0036063 3300047317 Unclassified 3901
455 Ga0495604_0732205 3300047317 Bacteria 626
456 Ga0495636_0412836 3300047318 Bacteria 644
457 Ga0495674_0008000 3300047319 Bacteria 10093
458 Ga0495674_0255088 3300047319 Bacteria 1442
459 Ga0495675_0446132 3300047444 Bacteria 749
460 Ga0495675_0741675 3300047444 Unclassified 547
461 Ga0495684_0031413 3300047471 Bacteria 4077
462 Ga0495684_0326847 3300047471 Bacteria 1095
463 Ga0495684_0569786 3300047471 Unclassified 768
464 Ga0495686_0001778 3300047472 Bacteria 21957
465 Ga0496100_0260993 3300048903 Bacteria 1285
466 Ga0496104_0510904 3300048907 Bacteria 1113
467 Ga0496106_0082680 3300048909 Unclassified 2469
468 Ga0496110_1166000 3300048913 Bacteria 679
469 Ga0496111_0912145 3300048914 Bacteria 632
470 Ga0496112_0301097 3300048915 Bacteria 1549
471 Ga0496112_0408754 3300048915 Bacteria 1297
472 Ga0496112_0438816 3300048915 Unclassified 1244
473 Ga0496112_0487384 3300048915 Unclassified 1169
474 Ga0496113_0699934 3300048916 Unclassified 809
475 Ga0496115_0017584 3300048918 Bacteria 5471
476 Ga0496115_0169735 3300048918 Unclassified 1804
477 Ga0496126_0039046 3300048929 Bacteria 4410
478 Ga0496126_0138176 3300048929 Unclassified 2099
479 Ga0501032_0103911 3300049569 Bacteria 1882
480 Ga0501033_0141403 3300049570 Unclassified 1739
481 Ga0501033_0384422 3300049570 Bacteria 980
482 Ga0501034_0184013 3300049571 Unclassified 2053
483 Ga0501036_0942363 3300049572 Unclassified 708
484 Ga0501037_0032021 3300049573 Bacteria 3882
485 Ga0501038_0890937 3300049574 Unclassified 657
486 Ga0501039_0834898 3300049575 Bacteria 718
487 Ga0501041_0111048 3300049577 Bacteria 1700
488 Ga0501042_0564715 3300049578 Unclassified 827
489 Ga0501043_0253185 3300049579 Bacteria 1356
490 Ga0501046_0054147 3300049580 Unclassified 3158
491 Ga0501047_0466922 3300049581 Bacteria 1090
492 Ga0501067_0105906 3300049583 Bacteria 1563
493 Ga0501068_0193141 3300049584 Unclassified 1290
494 Ga0501068_0867074 3300049584 Unclassified 593
495 Ga0501069_0048814 3300049585 Bacteria 2352
496 Ga0501071_0056136 3300049587 Bacteria 2844
497 Ga0501072_0949327 3300049588 Unclassified 671
498 Ga0501073_0117364 3300049589 Unclassified 1844
499 Ga0501074_0038115 3300049590 Bacteria 3484
500 Ga0501075_0485725 3300049591 Bacteria 942
501 Ga0501076_0292614 3300049592 Unclassified 1334
502 Ga0501079_0078877 3300049741 Bacteria 2547
503 Ga0501079_0147015 3300049741 Bacteria 1837
504 Ga0501083_1002425 3300049744 Unclassified 543
505 Ga0501035_0616267 3300049822 Unclassified 883
506 Ga0501044_0007033 3300049823 Bacteria 12379
507 Ga0501045_0434189 3300049824 Bacteria 977
508 nmdc:mga03683_415882_c1 3300050489 Bacteria 643
509 nmdc:mga03n38_712744_c1 3300050490 Bacteria 579
510 nmdc:mga00v17_163758_c1 3300050491 Bacteria 1433
511 nmdc:mga00v17_490451_c1 3300050491 Bacteria 797
512 nmdc:mga0k408_100049_c2 3300050493 Bacteria 1333
513 nmdc:mga0k408_20630_c1 3300050493 Bacteria 3694
514 nmdc:mga06z11_30595_c1 3300050494 Bacteria 900
515 nmdc:mga06z11_46853_c1 3300050494 Bacteria 2193
516 nmdc:mga07m45_189252_c1 3300050496 Bacteria 1197
517 nmdc:mga05p37_1030759_c1 3300050507 Unclassified 870
518 nmdc:mga05p37_1682307_c1 3300050507 Unclassified 620
519 nmdc:mga05p37_1991569_c1 3300050507 Unclassified 550
520 nmdc:mga05p37_42779_c1 3300050507 Bacteria 5568
521 nmdc:mga09592_164075_c1 3300050508 Bacteria 1920
522 nmdc:mga09592_7324_c1 3300050508 Bacteria 8969
523 nmdc:mga0qj67_437715_c1 3300050509 Bacteria 1053
524 nmdc:mga06r32_1916_c2 3300050510 Bacteria 15932
525 nmdc:mga06r32_204035_c1 3300050510 Bacteria 1965
526 nmdc:mga06r32_22718_c1 3300050510 Bacteria 5801
527 nmdc:mga06r32_986421_c1 3300050510 Unclassified 796
528 nmdc:mga08y16_150470_c1 3300050511 Bacteria 2420
529 nmdc:mga08y16_267898_c1 3300050511 Bacteria 1764
530 nmdc:mga08y16_643029_c1 3300050511 Bacteria 1066
531 nmdc:mga0n895_1257539_c1 3300050512 Unclassified 712
532 nmdc:mga0n895_1272172_c1 3300050512 Bacteria 707
533 nmdc:mga0rr50_1191385_c1 3300050513 Unclassified 647
534 nmdc:mga0rr50_162179_c1 3300050513 Bacteria 1815
535 nmdc:mga0rr50_851140_c1 3300050513 Bacteria 778
536 nmdc:mga0a205_139578_c1 3300050515 Bacteria 2324
537 nmdc:mga0a205_227441_c1 3300050515 Bacteria 1750
538 nmdc:mga0a205_532752_c1 3300050515 Bacteria 1030
539 Ga0500592_004412 3300053116 Bacteria 2244
540 Ga0501084_0140565 3300054114 Bacteria 2033
541 Ga0501082_0009253 3300060353 Bacteria 8491
542 Ga0207678_10015534
543 JGI24751J29686_10046722
544 Ga0065707_10029678
545 Ga0070683_100007311
546 Ga0070683_100149516
547 Ga0070683_100837744
548 Ga0070690_100965028
549 Ga0070670_100089981
550 Ga0070670_100619279
551 Ga0070677_10010083
552 Ga0070666_11007920
553 Ga0070680_100007311
554 Ga0070680_100366850
555 Ga0070680_100554103
556 Ga0070680_100687543
557 Ga0070682_100164560
558 Ga0070682_100940032
559 Ga0068868_101148457
560 Ga0070660_100496313
561 Ga0070660_101630465
562 Ga0070689_101356117
563 Ga0070687_100315517
564 Ga0070661_100353264
565 Ga0070661_101551722
566 Ga0070692_10142062
567 Ga0070668_100255407
568 Ga0070668_100608697
569 Ga0070669_100496843
570 Ga0070669_101371293
571 Ga0070675_100451807
572 Ga0070675_100658656
573 Ga0070675_101394558
574 Ga0070671_101239920
575 Ga0070671_101521319
576 Ga0070671_101551991
577 Ga0070674_100226322
578 Ga0070673_101120845
579 Ga0070688_100127756
580 Ga0070659_100406446
581 Ga0070659_100799532
582 Ga0070659_101093269
583 Ga0070667_100211254
584 Ga0070667_100242638
585 Ga0070667_100925520
586 Ga0070667_101014031
587 Ga0070667_102044572
588 Ga0070703_10096488
589 Ga0070709_10435784
590 Ga0070709_10577669
591 Ga0070709_11568019
592 Ga0070714_100148068
593 Ga0070714_101090551
594 Ga0070713_100387145
595 Ga0070713_100920835
596 Ga0070713_101740058
597 Ga0070710_10099810
598 Ga0070710_10636775
599 Ga0070701_10392318
600 Ga0070711_100023661
601 Ga0070700_100349558
602 Ga0070708_100624957
603 Ga0070663_100675337
604 Ga0070678_100404037
605 Ga0070678_100569622
606 Ga0070681_10113850
607 Ga0070681_10149034
608 Ga0070681_10207251
609 Ga0070681_10589173
610 Ga0068867_100394239
611 Ga0068867_100872580
612 Ga0068867_100912287
613 Ga0070706_100940339
614 Ga0070698_100532958
615 Ga0070698_101270238
616 Ga0070679_100199821
617 Ga0070679_101505428
618 Ga0070684_100000081
619 Ga0070684_100203047
620 Ga0070684_100422219
621 Ga0070684_101220625
622 Ga0070684_101507294
623 Ga0068853_100011090
624 Ga0068853_101850076
625 Ga0070695_100237845
626 Ga0070696_100231235
627 Ga0070696_100440962
628 Ga0070696_101409772
629 Ga0070693_100492712
630 Ga0070665_100485697
631 Ga0068855_100015667
632 Ga0068855_100131849
633 Ga0068855_102408242
634 Ga0070664_100067734
635 Ga0070664_101324368
636 Ga0068857_100100287
637 Ga0068857_100288777
638 Ga0068854_101507212
639 Ga0068854_102165717
640 Ga0068856_100193168
641 Ga0068856_100205029
642 Ga0068856_100702030
643 Ga0068856_101775917
644 Ga0068856_102011334
645 Ga0070702_100292010
646 Ga0068859_102494916
647 Ga0068864_100093760
648 Ga0068864_100508400
649 Ga0068870_10101236
650 Ga0068863_100112021
651 Ga0068863_100807961
652 Ga0068858_102053946
653 Ga0068860_100851708
654 Ga0068860_100912504
655 Ga0068860_102166550
656 Ga0081455_10067400
657 Ga0081455_10078726
658 Ga0070717_10035887
659 Ga0070717_10042564
660 Ga0070717_10043199
661 Ga0075365_10181014
662 Ga0075368_10284864
663 Ga0075368_10438306
664 Ga0075432_10237697
665 Ga0070715_10963580
666 Ga0070716_100238021
667 Ga0070716_100998555
668 Ga0070712_100005796
669 Ga0070712_100207949
670 Ga0070712_100600769
671 Ga0070712_100900220
672 Ga0075362_10467384
673 Ga0075367_10015191
674 Ga0075367_10023662
675 Ga0075366_10123593
676 Ga0075366_10871666
677 Ga0097621_100660479
678 Ga0097621_101029839
679 Ga0075370_10035596
680 Ga0068871_100881959
681 Ga0068871_101468327
682 Ga0068871_102288282
683 Ga0075430_100655611
684 Ga0075430_100768690
685 Ga0075430_100787906
686 Ga0075431_100009540
687 Ga0075431_100108727
688 Ga0075431_100213523
689 Ga0075431_100577822
690 Ga0075433_10124058
691 Ga0075433_10190675
692 Ga0075433_10517076
693 Ga0075434_101173982
694 Ga0075436_100225465
695 Ga0097620_102496268
696 Ga0075435_100009339
697 Ga0075435_100115701
698 Ga0075435_100733314
699 Ga0075435_100965618
700 Ga0075435_101018408
701 Ga0099794_10199747
702 Ga0099795_10003278
703 Ga0105240_10000350
704 Ga0105240_10005029
705 Ga0105240_10339261
706 Ga0105240_10369141
707 Ga0105240_10784217
708 Ga0105240_12229838
709 Ga0111539_10105875
710 Ga0111539_12418899
711 Ga0105245_10406385
712 Ga0105245_11115876
713 Ga0105245_11796074
714 Ga0105245_12309738
715 Ga0105247_10216079
716 Ga0105247_11264928
717 Ga0114129_10597737
718 Ga0114129_12381981
719 Ga0114129_12716693
720 Ga0105241_10066473
721 Ga0105241_10199653
722 Ga0105242_10303152
723 Ga0105242_10554793
724 Ga0105242_10791809
725 Ga0105248_10070281
726 Ga0105248_10506402
727 Ga0105248_10551620
728 Ga0105248_10776496
729 Ga0105248_10803338
730 Ga0105248_11858670
731 Ga0105237_10001342
732 Ga0105237_10216750
733 Ga0105237_10310996
734 Ga0105237_10869035
735 Ga0105237_10953553
736 Ga0105238_10091771
737 Ga0105238_12820690
738 Ga0105249_10239324
739 Ga0105249_12433451
740 Ga0099796_10003775
741 Ga0105239_10709767
742 Ga0105239_12604955
743 Ga0105246_10082134
744 Ga0105246_10431934
745 Ga0157343_1041098
746 Ga0157347_1032319
747 Ga0157342_1040679
748 Ga0157327_1020517
749 Ga0157373_10537072
750 Ga0157373_10785950
751 Ga0157370_10014111
752 Ga0157370_10265073
753 Ga0157369_10007867
754 Ga0157369_10015808
755 Ga0157369_11144301
756 Ga0157374_10001857
757 Ga0157374_11119861
758 Ga0157374_11946616
759 Ga0157378_10574467
760 Ga0157378_10787107
761 Ga0157378_11189446
762 Ga0157378_12122441
763 Ga0157378_12542150
764 Ga0163162_10716042
765 Ga0163162_11297042
766 Ga0163162_12111636
767 Ga0163162_12217936
768 Ga0163162_12519127
769 Ga0157372_10146856
770 Ga0157372_10568295
771 Ga0157372_12202260
772 Ga0157375_12198175
773 Ga0157375_12244000
774 Ga0163163_10006827
775 Ga0163163_10045778
776 Ga0163163_10219270
777 Ga0163163_10417148
778 Ga0157380_10696297
779 Ga0157377_10196184
780 Ga0157379_10004144
781 Ga0157379_10007484
782 Ga0157379_10016676
783 Ga0157379_12055193
784 Ga0157376_10158598
785 Ga0157376_10265071
786 Ga0157376_11100463
787 Ga0157376_12870833
788 Ga0163161_10781007
789 Ga0213875_10289298
790 Ga0213875_10672888
791 Ga0207666_1000893
792 Ga0207653_10184370
793 Ga0207682_10006984
794 Ga0207692_10075866
795 Ga0207692_10106424
796 Ga0207642_10453316
797 Ga0207688_10379569
798 Ga0207680_10910367
799 Ga0207647_10220261
800 Ga0207685_10362350
801 Ga0207699_10082483
802 Ga0207699_10314146
803 Ga0207699_10392677
804 Ga0207699_10640990
805 Ga0207699_11450266
806 Ga0207643_10015837
807 Ga0207654_10537194
808 Ga0207707_10121867
809 Ga0207707_10380467
810 Ga0207707_10382632
811 Ga0207707_10401350
812 Ga0207695_10001593
813 Ga0207695_10141756
814 Ga0207695_10149116
815 Ga0207695_10149397
816 Ga0207695_10180749
817 Ga0207671_10055868
818 Ga0207671_10200922
819 Ga0207671_10786028
820 Ga0207693_10002764
821 Ga0207693_10056926
822 Ga0207693_10570076
823 Ga0207693_10698795
824 Ga0207660_10003362
825 Ga0207660_10103568
826 Ga0207662_10105693
827 Ga0207657_10048952
828 Ga0207657_10329609
829 Ga0207649_11306534
830 Ga0207652_10413629
831 Ga0207681_11325487
832 Ga0207694_10158619
833 Ga0207694_10996085
834 Ga0207650_10245692
835 Ga0207650_10259854
836 Ga0207700_10936071
837 Ga0207664_11098171
838 Ga0207664_11236476
839 Ga0207690_10169236
840 Ga0207690_10721995
841 Ga0207706_10064349
842 Ga0207686_10564980
843 Ga0207686_11124049
844 Ga0207709_10138824
845 Ga0207670_10100405
846 Ga0207670_10267361
847 Ga0207670_10558605
848 Ga0207669_10494135
849 Ga0207691_10049087
850 Ga0207711_10109601
851 Ga0207711_11067424
852 Ga0207711_11588771
853 Ga0207689_10269161
854 Ga0207661_10000028
855 Ga0207661_10005323
856 Ga0207661_10067927
857 Ga0207661_11088133
858 Ga0207661_11416598
859 Ga0207679_10315443
860 Ga0207679_10769508
861 Ga0207679_11205056
862 Ga0207667_10167885
863 Ga0207667_11579996
864 Ga0207651_11793003
865 Ga0207712_10987668
866 Ga0207668_10437746
867 Ga0207640_11396251
868 Ga0207640_11448484
869 Ga0207658_10209147
870 Ga0207658_11349874
871 Ga0207658_11850597
872 Ga0207677_10629357
873 Ga0207639_10007791
874 Ga0207678_10028595
875 Ga0207678_10209668
876 Ga0207678_11528886
877 Ga0207708_10104937
878 Ga0207708_10556961
879 Ga0207702_10007173
880 Ga0207702_10256323
881 Ga0207702_10682952
882 Ga0207702_10696660
883 Ga0207641_10240891
884 Ga0207641_11570569
885 Ga0207648_10249525
886 Ga0207648_10818621
887 Ga0207648_10887894
888 Ga0207648_11461153
889 Ga0207676_10082084
890 Ga0207676_10523227
891 Ga0207674_10098603
892 Ga0207674_10310967
893 Ga0207674_10543762
894 Ga0207683_10107419
895 Ga0207683_10401608
896 Ga0207683_11132592
897 Ga0207698_10597666
898 Ga0207698_11468605
899 Ga0209969_1052156
900 Ga0209967_1043851
901 Ga0209996_1011443
902 Ga0209995_1093700
903 Ga0209982_1043651
904 Ga0209970_1052430
905 Ga0209983_1007347
906 Ga0209974_10242750
907 Ga0207428_10034759
908 Ga0207428_10039502
909 Ga0268266_11996287
910 Ga0268265_10204506
911 Ga0268264_11424544
912 Ga0265762_1116063
913 Ga0265762_1165550
914 Ga0265332_10164197
915 Ga0265331_10035843
916 Ga0307509_10489803
917 Ga0307408_101751706
918 Ga0265342_10017240
919 Ga0373959_0214230
920 Ga0373926_0026416
921 Ga0373926_0303937
922 Ga0373939_0243554
923 Ga0373946_0366720
924 Ga0373931_0212597
925 Ga0373931_0539544
926 Ga0373935_0131249
927 Ga0373927_0002217
928 Ga0373947_0000895
929 Ga0373937_0754115
930 Ga0373925_0000143
931 Ga0395900_1461360
932 Ga0436364_0211233
933 Ga0436364_0700924
934 Ga0436364_1444716
935 Ga0436364_1450312
936 Ga0242420_083434
937 Ga0439453_0012271
938 Ga0439461_0239156
939 Ga0439437_013612
940 Ga0439441_054302
941 Ga0439442_075943
942 Ga0439443_015503
943 Ga0439445_0194520
944 Ga0439450_188816
945 Ga0439456_135369
946 Ga0450923_013616
947 Ga0450896_015026
948 Ga0450898_029050
949 Ga0439446_0194430
950 Ga0439434_0184771
951 Ga0439444_0021657
952 Ga0439459_0190003
953 Ga0439464_0079745
954 Ga0439464_0225778
955 Ga0450893_0029442
956 Ga0439440_0127785
957 Ga0466966_0997507
958 Ga0453684_0981746
959 Ga0466971_0674259
960 Ga0466959_0598437
961 Ga0451576_0143469
962 Ga0451576_0199145
963 Ga0466958_0511555
964 Ga0466958_1026122
965 Ga0495580_0042596
966 Ga0495580_0281090
967 Ga0495662_0073802
968 Ga0495662_0280798
969 Ga0495664_0002400
970 Ga0495594_0268887
971 Ga0495594_0413797
972 Ga0495628_0236145
973 Ga0495630_0221671
974 Ga0495630_0483758
975 Ga0495630_1190025
976 Ga0495652_0604023
977 Ga0495652_0803490
978 Ga0495665_0390356
979 Ga0495640_0291248
980 Ga0495587_0049190
981 Ga0495587_0281056
982 Ga0495645_0242072
983 Ga0495667_0140544
984 Ga0495634_0344294
985 Ga0495635_0270830
986 Ga0495635_0455125
987 Ga0495635_0611935
988 Ga0495661_0206048
989 Ga0495588_0628661
990 Ga0495646_0658298
991 Ga0495669_0370431
992 Ga0495669_0610493
993 Ga0495649_0418085
994 Ga0495581_0658946
995 Ga0495604_0036063
996 Ga0495604_0732205
997 Ga0495636_0412836
998 Ga0495674_0008000
999 Ga0495674_0255088
1000 Ga0495675_0446132
1001 Ga0495675_0741675
1002 Ga0495684_0031413
1003 Ga0495684_0326847
1004 Ga0495684_0569786
1005 Ga0495686_0001778
1006 Ga0496100_0260993
1007 Ga0496104_0510904
1008 Ga0496106_0082680
1009 Ga0496110_1166000
1010 Ga0496111_0912145
1011 Ga0496112_0301097
1012 Ga0496112_0408754
1013 Ga0496112_0438816
1014 Ga0496112_0487384
1015 Ga0496113_0699934
1016 Ga0496115_0017584
1017 Ga0496115_0169735
1018 Ga0496126_0039046
1019 Ga0496126_0138176
1020 Ga0501032_0103911
1021 Ga0501033_0141403
1022 Ga0501033_0384422
1023 Ga0501034_0184013
1024 Ga0501036_0942363
1025 Ga0501037_0032021
1026 Ga0501038_0890937
1027 Ga0501039_0834898
1028 Ga0501041_0111048
1029 Ga0501042_0564715
1030 Ga0501043_0253185
1031 Ga0501046_0054147
1032 Ga0501047_0466922
1033 Ga0501067_0105906
1034 Ga0501068_0193141
1035 Ga0501068_0867074
1036 Ga0501069_0048814
1037 Ga0501071_0056136
1038 Ga0501072_0949327
1039 Ga0501073_0117364
1040 Ga0501074_0038115
1041 Ga0501075_0485725
1042 Ga0501076_0292614
1043 Ga0501079_0078877
1044 Ga0501079_0147015
1045 Ga0501083_1002425
1046 Ga0501035_0616267
1047 Ga0501044_0007033
1048 Ga0501045_0434189
1049 nmdc:mga03683_415882_c1
1050 nmdc:mga03n38_712744_c1
1051 nmdc:mga00v17_163758_c1
1052 nmdc:mga00v17_490451_c1
1053 nmdc:mga0k408_100049_c2
1054 nmdc:mga0k408_20630_c1
1055 nmdc:mga06z11_30595_c1
1056 nmdc:mga06z11_46853_c1
1057 nmdc:mga07m45_189252_c1
1058 nmdc:mga05p37_1030759_c1
1059 nmdc:mga05p37_1682307_c1
1060 nmdc:mga05p37_1991569_c1
1061 nmdc:mga05p37_42779_c1
1062 nmdc:mga09592_164075_c1
1063 nmdc:mga09592_7324_c1
1064 nmdc:mga0qj67_437715_c1
1065 nmdc:mga06r32_1916_c2
1066 nmdc:mga06r32_204035_c1
1067 nmdc:mga06r32_22718_c1
1068 nmdc:mga06r32_986421_c1
1069 nmdc:mga08y16_150470_c1
1070 nmdc:mga08y16_267898_c1
1071 nmdc:mga08y16_643029_c1
1072 nmdc:mga0n895_1257539_c1
1073 nmdc:mga0n895_1272172_c1
1074 nmdc:mga0rr50_1191385_c1
1075 nmdc:mga0rr50_162179_c1
1076 nmdc:mga0rr50_851140_c1
1077 nmdc:mga0a205_139578_c1
1078 nmdc:mga0a205_227441_c1
1079 nmdc:mga0a205_532752_c1
1080 Ga0500592_004412
1081 Ga0501084_0140565
1082 Ga0501082_0009253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

40

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9377 7 105
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.929 7 107
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9219 5 104
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8997 10 88
5x11-assembly1.cif.gz_A crystal structure of bacillus subtilis padr in complex with operator dna 0.8994 10 88
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9219 5 104 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9099 15 81 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9065 14 81 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9012 11 88 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8994 10 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V7X039-F1-model_v4 PadR family transcriptional regulator 0.9845 11 106
AF-A0A4Q0SZP5-F1-model_v4 Transcriptional regulator, PadR family 0.9841 8 106
AF-A0A2N1UAI5-F1-model_v4 PadR family transcriptional regulator 0.9799 7 106
AF-A0A2V9DAB1-F1-model_v4 PadR family transcriptional regulator 0.9759 24 108
AF-A0A1I4FIW9-F1-model_v4 Transcriptional regulator, PadR family 0.973 13 108

Map