F461368

General Info

Members Datasets Scaffolds Average Seq Length
541 273 1082 119

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10054748|Ga0182008_100547481
Length 140
Sequence MPFVAYAETDIGSGRSEGADMPEYLIYFNQQWVGDHTEEWFRGRGPLARAVVDEIKAAGAFVFAGGLEEEDGPVFSADATSGATLFTDGPYVESKEFLGGLTIVDVPDEATVRMWAGKIAEACGWPQEVRRFKPQRVLQG

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
90 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
271 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
272 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
273 2902582711 Micromonospora sp. AP08 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.92
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 7.58
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10054748 3300014497 Bacteria 1973
2 JGI24737J22298_10011547 3300001990 Bacteria 2893
3 JGI24737J22298_10052631 3300001990 Bacteria 1234
4 JGI24743J22301_10004684 3300001991 Bacteria 2243
5 JGI24735J21928_10031682 3300002067 Bacteria 1567
6 JGI24735J21928_10163628 3300002067 Bacteria 643
7 Ga0006759J45824_1175159 3300003163 Bacteria 623
8 JGI25406J46586_10037408 3300003203 Bacteria 1750
9 JGI25407J50210_10064394 3300003373 Bacteria 918
10 Ga0058859_11257982 3300004798 Bacteria 600
11 Ga0058863_11736278 3300004799 Bacteria 598
12 Ga0070658_11761536 3300005327 Bacteria 536
13 Ga0070683_100064737 3300005329 Bacteria 3403
14 Ga0070683_100081729 3300005329 Bacteria 3025
15 Ga0070683_100250871 3300005329 Bacteria 1683
16 Ga0070683_100338892 3300005329 Bacteria 1432
17 Ga0070683_101041149 3300005329 Bacteria 786
18 Ga0070683_102414378 3300005329 Bacteria 504
19 Ga0070690_101441109 3300005330 Bacteria 555
20 Ga0070670_100388681 3300005331 Bacteria 1230
21 Ga0070677_10894322 3300005333 Bacteria 513
22 Ga0068869_100790893 3300005334 Bacteria 815
23 Ga0068869_101015259 3300005334 Bacteria 723
24 Ga0070680_100134273 3300005336 Bacteria 2072
25 Ga0070682_100023922 3300005337 Bacteria 3631
26 Ga0070682_100057122 3300005337 Bacteria 2457
27 Ga0068868_100039053 3300005338 Bacteria 3686
28 Ga0068868_100355391 3300005338 Bacteria 1256
29 Ga0070660_100161628 3300005339 Bacteria 1805
30 Ga0070689_100755394 3300005340 Bacteria 853
31 Ga0070691_10014312 3300005341 Bacteria 3638
32 Ga0070687_100039746 3300005343 Bacteria 2366
33 Ga0070692_10022319 3300005345 Bacteria 3090
34 Ga0070675_100078745 3300005354 Bacteria 2745
35 Ga0070675_100435746 3300005354 Bacteria 1174
36 Ga0070671_100709759 3300005355 Bacteria 873
37 Ga0070671_101474273 3300005355 Bacteria 602
38 Ga0070674_100844778 3300005356 Bacteria 794
39 Ga0070674_101022888 3300005356 Bacteria 726
40 Ga0070674_101147156 3300005356 Bacteria 688
41 Ga0070659_100206131 3300005366 Bacteria 1619
42 Ga0070667_100112378 3300005367 Bacteria 2363
43 Ga0070667_100116382 3300005367 Bacteria 2322
44 Ga0070709_10945079 3300005434 Bacteria 683
45 Ga0070714_100555315 3300005435 Bacteria 1100
46 Ga0070713_100680460 3300005436 Bacteria 981
47 Ga0070710_10881481 3300005437 Bacteria 645
48 Ga0070700_100071833 3300005441 Bacteria 2211
49 Ga0070700_100792084 3300005441 Bacteria 762
50 Ga0070663_100942241 3300005455 Bacteria 748
51 Ga0070662_100228737 3300005457 Bacteria 1487
52 Ga0070681_10396118 3300005458 Bacteria 1292
53 Ga0068867_100108033 3300005459 Bacteria 2133
54 Ga0068867_101749669 3300005459 Bacteria 584
55 Ga0070685_10039025 3300005466 Bacteria 2696
56 Ga0070698_100691431 3300005471 Bacteria 962
57 Ga0070698_100907711 3300005471 Bacteria 827
58 Ga0070679_100374747 3300005530 Bacteria 1370
59 Ga0070684_100050767 3300005535 Bacteria 3603
60 Ga0070684_100074104 3300005535 Bacteria 3000
61 Ga0070684_100563498 3300005535 Bacteria 1058
62 Ga0070684_100752491 3300005535 Bacteria 910
63 Ga0070684_101583889 3300005535 Bacteria 618
64 Ga0068853_100149160 3300005539 Bacteria 2104
65 Ga0068853_100257828 3300005539 Bacteria 1602
66 Ga0070672_101145909 3300005543 Bacteria 692
67 Ga0070695_101700873 3300005545 Bacteria 528
68 Ga0070696_101518203 3300005546 Bacteria 574
69 Ga0070665_100003935 3300005548 Bacteria 15675
70 Ga0070665_100163678 3300005548 Bacteria 2227
71 Ga0070665_102286071 3300005548 Bacteria 544
72 Ga0068855_100220657 3300005563 Bacteria 2126
73 Ga0070664_100079742 3300005564 Bacteria 2819
74 Ga0070664_100423788 3300005564 Bacteria 1219
75 Ga0070664_100426578 3300005564 Bacteria 1215
76 Ga0068857_100071499 3300005577 Bacteria 3091
77 Ga0068857_100141135 3300005577 Bacteria 2178
78 Ga0068857_100152590 3300005577 Bacteria 2094
79 Ga0068857_101142120 3300005577 Bacteria 753
80 Ga0068857_101249848 3300005577 Bacteria 720
81 Ga0068857_101345934 3300005577 Bacteria 694
82 Ga0068856_100183902 3300005614 Bacteria 2103
83 Ga0068856_101510100 3300005614 Bacteria 686
84 Ga0070702_100011642 3300005615 Bacteria 4381
85 Ga0068852_100228878 3300005616 Bacteria 1771
86 Ga0068859_100056078 3300005617 Bacteria 3965
87 Ga0068864_100086735 3300005618 Bacteria 2754
88 Ga0068864_100965883 3300005618 Bacteria 844
89 Ga0068864_101377300 3300005618 Bacteria 707
90 Ga0068866_10110242 3300005718 Bacteria 1534
91 Ga0068866_10444080 3300005718 Bacteria 847
92 Ga0068866_10625905 3300005718 Bacteria 730
93 Ga0068861_100421069 3300005719 Bacteria 1190
94 Ga0068861_100664873 3300005719 Bacteria 964
95 Ga0068870_10358218 3300005840 Bacteria 938
96 Ga0068870_10369878 3300005840 Bacteria 925
97 Ga0068870_11076670 3300005840 Bacteria 577
98 Ga0068860_100079454 3300005843 Bacteria 3119
99 Ga0068860_101767536 3300005843 Bacteria 640
100 Ga0068862_100053157 3300005844 Bacteria 3467
101 Ga0081455_10002059 3300005937 Bacteria 24053
102 Ga0081538_10000729 3300005981 Bacteria 35897
103 Ga0081538_10198628 3300005981 Bacteria 828
104 Ga0081538_10225636 3300005981 Bacteria 737
105 Ga0081539_10036873 3300005985 Bacteria 2919
106 Ga0081539_10071818 3300005985 Bacteria 1852
107 Ga0081539_10484646 3300005985 Bacteria 512
108 Ga0070717_10306835 3300006028 Bacteria 1412
109 Ga0075365_10018101 3300006038 Bacteria 4325
110 Ga0075365_10555774 3300006038 Bacteria 812
111 Ga0075365_10780103 3300006038 Bacteria 675
112 Ga0075368_10005655 3300006042 Bacteria 4317
113 Ga0075363_100001067 3300006048 Bacteria 9908
114 Ga0070716_100930653 3300006173 Bacteria 683
115 Ga0070712_100353900 3300006175 Bacteria 1203
116 Ga0075367_10001374 3300006178 Bacteria 10385
117 Ga0097621_100546464 3300006237 Bacteria 1054
118 Ga0097621_100768650 3300006237 Bacteria 891
119 Ga0075370_10212269 3300006353 Bacteria 1143
120 Ga0068871_101915476 3300006358 Bacteria 564
121 Ga0075431_100000225 3300006847 Bacteria 42245
122 Ga0075431_100017643 3300006847 Bacteria 7257
123 Ga0075433_10571769 3300006852 Bacteria 993
124 Ga0075434_100563333 3300006871 Bacteria 1159
125 Ga0075429_100309214 3300006880 Bacteria 1384
126 Ga0068865_100091992 3300006881 Bacteria 2203
127 Ga0068865_100115475 3300006881 Bacteria 1987
128 Ga0068865_100889707 3300006881 Bacteria 774
129 Ga0097620_100056078 3300006931 Bacteria 3965
130 Ga0111539_10731487 3300009094 Bacteria 1152
131 Ga0105245_10003446 3300009098 Bacteria 14178
132 Ga0105245_10094703 3300009098 Bacteria 2753
133 Ga0105245_10095038 3300009098 Bacteria 2749
134 Ga0105245_10126194 3300009098 Bacteria 2396
135 Ga0114129_10556725 3300009147 Bacteria 1490
136 Ga0105243_10010069 3300009148 Bacteria 7189
137 Ga0105243_10045423 3300009148 Bacteria 3452
138 Ga0105243_10898422 3300009148 Bacteria 881
139 Ga0105242_10070226 3300009176 Bacteria 2903
140 Ga0105242_11145433 3300009176 Bacteria 794
141 Ga0105248_10075344 3300009177 Bacteria 3793
142 Ga0105248_10084022 3300009177 Bacteria 3581
143 Ga0105248_10861670 3300009177 Bacteria 1023
144 Ga0105248_11930285 3300009177 Bacteria 670
145 Ga0105238_10070439 3300009551 Bacteria 3496
146 Ga0105238_10715221 3300009551 Bacteria 1014
147 Ga0105238_11361474 3300009551 Bacteria 736
148 Ga0105249_10082081 3300009553 Bacteria 2999
149 Ga0105249_11148710 3300009553 Bacteria 847
150 Ga0105249_12008073 3300009553 Bacteria 651
151 Ga0105249_12417900 3300009553 Bacteria 598
152 Ga0105239_10010810 3300010375 Bacteria 10197
153 Ga0105239_10696426 3300010375 Bacteria 1161
154 Ga0105239_13599951 3300010375 Bacteria 503
155 Ga0105246_10030381 3300011119 Bacteria 3568
156 Ga0105246_10070361 3300011119 Bacteria 2461
157 Ga0105246_11492769 3300011119 Bacteria 634
158 Ga0157320_1022146 3300012481 Bacteria 588
159 Ga0157329_1021591 3300012491 Bacteria 608
160 Ga0157370_11815913 3300013104 Bacteria 547
161 Ga0157369_10044163 3300013105 Bacteria 4852
162 Ga0157369_10190384 3300013105 Bacteria 2156
163 Ga0157369_10202342 3300013105 Bacteria 2084
164 Ga0157374_10719744 3300013296 Bacteria 1012
165 Ga0157374_12212017 3300013296 Bacteria 577
166 Ga0163162_10005430 3300013306 Bacteria 12320
167 Ga0157372_10051212 3300013307 Bacteria 4594
168 Ga0157372_10053388 3300013307 Bacteria 4504
169 Ga0157372_10062084 3300013307 Bacteria 4185
170 Ga0157372_10264729 3300013307 Bacteria 1996
171 Ga0157372_10824303 3300013307 Bacteria 1077
172 Ga0157372_11381916 3300013307 Bacteria 812
173 Ga0157375_10030298 3300013308 Bacteria 5100
174 Ga0157375_10631690 3300013308 Bacteria 1228
175 Ga0157375_11079639 3300013308 Bacteria 939
176 Ga0163163_10040703 3300014325 Bacteria 4539
177 Ga0163163_10196631 3300014325 Bacteria 2064
178 Ga0163163_10487591 3300014325 Bacteria 1294
179 Ga0163163_10980033 3300014325 Bacteria 909
180 Ga0163163_11118736 3300014325 Bacteria 850
181 Ga0163163_11364137 3300014325 Bacteria 771
182 Ga0157380_10040470 3300014326 Bacteria 3630
183 Ga0157380_10823225 3300014326 Bacteria 948
184 Ga0157377_10005915 3300014745 Bacteria 5787
185 Ga0157377_10076099 3300014745 Bacteria 1951
186 Ga0157377_10232046 3300014745 Bacteria 1187
187 Ga0157377_10426018 3300014745 Bacteria 910
188 Ga0157376_10218045 3300014969 Bacteria 1765
189 Ga0163161_10540014 3300017792 Bacteria 954
190 Ga0163161_11043638 3300017792 Bacteria 700
191 Ga0224712_10393306 3300022467 Bacteria 660
192 Ga0224712_10539497 3300022467 Bacteria 566
193 Ga0207697_10060760 3300025315 Bacteria 1572
194 Ga0207656_10582974 3300025321 Bacteria 571
195 Ga0207692_10333575 3300025898 Bacteria 931
196 Ga0207642_10393326 3300025899 Bacteria 828
197 Ga0207688_10039685 3300025901 Bacteria 2615
198 Ga0207688_10298768 3300025901 Bacteria 984
199 Ga0207647_10043341 3300025904 Bacteria 2817
200 Ga0207685_10383254 3300025905 Bacteria 717
201 Ga0207645_11058873 3300025907 Bacteria 548
202 Ga0207643_10990580 3300025908 Bacteria 544
203 Ga0207705_10155197 3300025909 Bacteria 1717
204 Ga0207705_10805015 3300025909 Bacteria 729
205 Ga0207707_11336131 3300025912 Bacteria 574
206 Ga0207671_11376154 3300025914 Bacteria 548
207 Ga0207693_10291473 3300025915 Bacteria 1279
208 Ga0207660_10182033 3300025917 Bacteria 1632
209 Ga0207662_10500645 3300025918 Bacteria 836
210 Ga0207662_10690447 3300025918 Bacteria 715
211 Ga0207657_10145550 3300025919 Bacteria 1933
212 Ga0207657_10176163 3300025919 Bacteria 1731
213 Ga0207652_11247495 3300025921 Bacteria 645
214 Ga0207694_11138717 3300025924 Bacteria 660
215 Ga0207650_10440249 3300025925 Bacteria 1083
216 Ga0207659_10091729 3300025926 Bacteria 2270
217 Ga0207659_10303742 3300025926 Bacteria 1311
218 Ga0207687_10023875 3300025927 Bacteria 4080
219 Ga0207687_10087203 3300025927 Bacteria 2268
220 Ga0207687_11217146 3300025927 Bacteria 647
221 Ga0207700_10006170 3300025928 Bacteria 7218
222 Ga0207664_10082464 3300025929 Bacteria 2619
223 Ga0207664_10186270 3300025929 Bacteria 1785
224 Ga0207690_10248857 3300025932 Bacteria 1372
225 Ga0207706_10677055 3300025933 Bacteria 882
226 Ga0207686_10045660 3300025934 Bacteria 2697
227 Ga0207709_10015958 3300025935 Bacteria 4169
228 Ga0207670_11088053 3300025936 Bacteria 674
229 Ga0207669_10824865 3300025937 Bacteria 770
230 Ga0207704_10084659 3300025938 Bacteria 2061
231 Ga0207704_10227962 3300025938 Bacteria 1383
232 Ga0207704_11625408 3300025938 Bacteria 555
233 Ga0207665_10132741 3300025939 Bacteria 1769
234 Ga0207665_10486361 3300025939 Bacteria 952
235 Ga0207691_10016742 3300025940 Bacteria 6959
236 Ga0207711_10053496 3300025941 Bacteria 3462
237 Ga0207689_10527939 3300025942 Bacteria 990
238 Ga0207661_10012061 3300025944 Bacteria 6279
239 Ga0207661_10025217 3300025944 Bacteria 4518
240 Ga0207661_10161588 3300025944 Bacteria 1944
241 Ga0207661_10332776 3300025944 Bacteria 1367
242 Ga0207661_10508078 3300025944 Bacteria 1101
243 Ga0207661_12181230 3300025944 Bacteria 500
244 Ga0207679_10128977 3300025945 Bacteria 2026
245 Ga0207667_10364985 3300025949 Bacteria 1472
246 Ga0207667_11104986 3300025949 Bacteria 776
247 Ga0207712_10045000 3300025961 Bacteria 3054
248 Ga0207712_10582152 3300025961 Bacteria 966
249 Ga0207658_10090398 3300025986 Bacteria 2373
250 Ga0207658_10160261 3300025986 Bacteria 1843
251 Ga0207677_10855700 3300026023 Bacteria 817
252 Ga0207703_10287523 3300026035 Bacteria 1495
253 Ga0207639_10270560 3300026041 Bacteria 1490
254 Ga0207708_10139801 3300026075 Bacteria 1898
255 Ga0207708_11803578 3300026075 Bacteria 537
256 Ga0207702_10251219 3300026078 Bacteria 1661
257 Ga0207641_10735666 3300026088 Bacteria 973
258 Ga0207648_10035477 3300026089 Bacteria 4393
259 Ga0207676_10170214 3300026095 Bacteria 1897
260 Ga0207676_10556032 3300026095 Bacteria 1097
261 Ga0207676_10814899 3300026095 Bacteria 911
262 Ga0207676_11361117 3300026095 Bacteria 705
263 Ga0207676_11969833 3300026095 Bacteria 583
264 Ga0207674_10087753 3300026116 Bacteria 3104
265 Ga0207674_10930280 3300026116 Bacteria 838
266 Ga0207674_11146772 3300026116 Bacteria 747
267 Ga0207675_100441164 3300026118 Bacteria 1289
268 Ga0207675_100691565 3300026118 Bacteria 1028
269 Ga0207683_10131672 3300026121 Bacteria 2250
270 Ga0207683_10174504 3300026121 Bacteria 1947
271 Ga0207683_10755086 3300026121 Bacteria 902
272 Ga0207698_10101220 3300026142 Bacteria 2389
273 Ga0207698_10413191 3300026142 Bacteria 1293
274 Ga0209813_10000938 3300027866 Bacteria 6551
275 Ga0268266_10013154 3300028379 Bacteria 7136
276 Ga0268266_10901759 3300028379 Bacteria 855
277 Ga0268265_10216774 3300028380 Bacteria 1672
278 Ga0268265_10551609 3300028380 Bacteria 1094
279 Ga0268265_12566157 3300028380 Bacteria 515
280 Ga0268264_10264348 3300028381 Bacteria 1604
281 Ga0268264_11150134 3300028381 Bacteria 785
282 Ga0307515_10056418 3300028794 Bacteria 5709
283 Ga0307513_10965204 3300031456 Bacteria 561
284 Ga0307508_10503308 3300031616 Bacteria 806
285 Ga0307516_10017158 3300031730 Bacteria 7558
286 Ga0307413_11175753 3300031824 Bacteria 666
287 Ga0307413_11333447 3300031824 Bacteria 629
288 Ga0307410_10209779 3300031852 Bacteria 1492
289 Ga0307410_10871140 3300031852 Bacteria 770
290 Ga0307410_11458441 3300031852 Bacteria 602
291 Ga0307406_10642406 3300031901 Bacteria 880
292 Ga0307406_10797134 3300031901 Bacteria 797
293 Ga0307406_11279670 3300031901 Bacteria 639
294 Ga0307407_11162758 3300031903 Bacteria 602
295 Ga0307407_11701010 3300031903 Bacteria 502
296 Ga0307409_100593133 3300031995 Bacteria 1094
297 Ga0307409_101088418 3300031995 Unclassified 820
298 Ga0307416_100120090 3300032002 Bacteria 2340
299 Ga0307416_100412548 3300032002 Bacteria 1392
300 Ga0307416_102582085 3300032002 Bacteria 606
301 Ga0307416_103117038 3300032002 Bacteria 555
302 Ga0307414_10161803 3300032004 Bacteria 1779
303 Ga0307414_11622450 3300032004 Bacteria 603
304 Ga0307411_10431950 3300032005 Bacteria 1097
305 Ga0307411_11467616 3300032005 Bacteria 626
306 Ga0307415_101259947 3300032126 Bacteria 699
307 Ga0307415_101592947 3300032126 Bacteria 627
308 Ga0307415_101896956 3300032126 Bacteria 578
309 Ga0307415_102190562 3300032126 Bacteria 541
310 Ga0307415_102497646 3300032126 Bacteria 509
311 Ga0307510_10394025 3300033180 Bacteria 828
312 Ga0373958_0107874 3300034819 Bacteria 661
313 Ga0373959_0218664 3300034820 Bacteria 510
314 Ga0373938_0141449 3300034957 Bacteria 635
315 Ga0373952_0210941 3300035092 Bacteria 573
316 Ga0373960_0413122 3300035121 Bacteria 523
317 Ga0373946_0547348 3300035171 Bacteria 597
318 Ga0373931_0375799 3300035691 Bacteria 895
319 Ga0373947_1144272 3300035725 Bacteria 530
320 Ga0373925_0093204 3300037068 Bacteria 2305
321 Ga0395898_0016608 3300037466 Bacteria 7525
322 Ga0395901_0138272 3300038443 Bacteria 2560
323 Ga0395901_0455555 3300038443 Bacteria 1308
324 Ga0395901_1407235 3300038443 Bacteria 656
325 Ga0395901_1423434 3300038443 Bacteria 651
326 Ga0242420_053705 3300038996 Bacteria 792
327 Ga0451793_0391358 3300041452 Bacteria 656
328 Ga0451793_0602186 3300041452 Bacteria 1039
329 Ga0451795_1436482 3300041456 Bacteria 569
330 Ga0451800_0576408 3300041459 Bacteria 541
331 Ga0451837_1541608 3300041494 Bacteria 574
332 Ga0451843_0353371 3300041509 Bacteria 534
333 Ga0451853_3007839 3300041512 Bacteria 703
334 Ga0466972_0120020 3300044658 Bacteria 1240
335 Ga0466972_0269821 3300044658 Bacteria 795
336 Ga0466965_0168295 3300044683 Bacteria 1152
337 Ga0466961_0265439 3300044693 Bacteria 1052
338 Ga0466963_1339229 3300044694 Bacteria 502
339 Ga0466964_0062275 3300044706 Bacteria 1555
340 Ga0466970_0714271 3300044765 Bacteria 585
341 Ga0451576_0615427 3300045051 Bacteria 1141
342 Ga0466967_0021503 3300045976 Bacteria 5243
343 Ga0466967_0478435 3300045976 Bacteria 1220
344 Ga0466967_0799310 3300045976 Bacteria 936
345 Ga0466967_0914607 3300045976 Bacteria 873
346 Ga0466967_1017200 3300045976 Bacteria 825
347 Ga0495603_0022968 3300046455 Bacteria 3775
348 Ga0495603_0633914 3300046455 Bacteria 612
349 Ga0495629_0466717 3300046459 Bacteria 854
350 Ga0495582_0410558 3300046473 Bacteria 781
351 Ga0495582_0657475 3300046473 Bacteria 606
352 Ga0495639_0248948 3300046475 Bacteria 878
353 Ga0495664_0947146 3300046477 Bacteria 502
354 Ga0495652_0831988 3300046529 Bacteria 613
355 Ga0495658_0013335 3300046683 Bacteria 4182
356 Ga0495658_0138629 3300046683 Bacteria 1486
357 Ga0495658_0833146 3300046683 Bacteria 590
358 Ga0495581_0487633 3300047315 Bacteria 717
359 Ga0495676_0054976 3300047321 Bacteria 3160
360 Ga0495593_0724516 3300047673 Bacteria 500
361 Ga0496101_0157445 3300048904 Bacteria 1741
362 Ga0496101_0988551 3300048904 Bacteria 662
363 Ga0496102_0004694 3300048905 Bacteria 11560
364 Ga0496102_0422291 3300048905 Bacteria 1252
365 Ga0496102_0515812 3300048905 Bacteria 1118
366 Ga0496103_0144830 3300048906 Bacteria 1520
367 Ga0496103_0476424 3300048906 Bacteria 800
368 Ga0496104_0232007 3300048907 Bacteria 1757
369 Ga0496105_0081237 3300048908 Bacteria 2677
370 Ga0496105_0479458 3300048908 Bacteria 979
371 Ga0496106_0104302 3300048909 Bacteria 2202
372 Ga0496106_0540139 3300048909 Bacteria 935
373 Ga0496106_0940581 3300048909 Bacteria 681
374 Ga0496107_0414660 3300048910 Bacteria 1001
375 Ga0496107_0829935 3300048910 Bacteria 676
376 Ga0496108_0066909 3300048911 Bacteria 3030
377 Ga0496108_0081412 3300048911 Bacteria 2744
378 Ga0496108_0589092 3300048911 Bacteria 969
379 Ga0496109_0121683 3300048912 Bacteria 2432
380 Ga0496109_0138673 3300048912 Bacteria 2274
381 Ga0496109_0177452 3300048912 Bacteria 2000
382 Ga0496109_1018803 3300048912 Bacteria 765
383 Ga0496110_0028648 3300048913 Bacteria 4785
384 Ga0496110_0274599 3300048913 Bacteria 1535
385 Ga0496110_0384594 3300048913 Bacteria 1279
386 Ga0496110_0515904 3300048913 Bacteria 1087
387 Ga0496110_0804428 3300048913 Bacteria 844
388 Ga0496111_0012336 3300048914 Bacteria 5781
389 Ga0496111_0622515 3300048914 Bacteria 789
390 Ga0496112_1146610 3300048915 Bacteria 695
391 Ga0496113_0204549 3300048916 Bacteria 1570
392 Ga0496114_0185340 3300048917 Bacteria 1819
393 Ga0496114_0623666 3300048917 Bacteria 950
394 Ga0496114_0659500 3300048917 Bacteria 920
395 Ga0496114_0771484 3300048917 Bacteria 839
396 Ga0496114_0816907 3300048917 Bacteria 811
397 Ga0496114_1365872 3300048917 Bacteria 596
398 Ga0501031_0024726 3300049568 Bacteria 3915
399 Ga0501031_0024760 3300049568 Bacteria 3913
400 Ga0501031_0058622 3300049568 Bacteria 2509
401 Ga0501031_0800651 3300049568 Bacteria 604
402 Ga0501032_0020900 3300049569 Bacteria 4555
403 Ga0501032_0154679 3300049569 Bacteria 1507
404 Ga0501032_0884174 3300049569 Bacteria 563
405 Ga0501033_0480973 3300049570 Bacteria 860
406 Ga0501034_0016668 3300049571 Bacteria 7531
407 Ga0501034_0034348 3300049571 Bacteria 5140
408 Ga0501036_0020226 3300049572 Bacteria 5590
409 Ga0501036_0090042 3300049572 Bacteria 2592
410 Ga0501036_0527757 3300049572 Bacteria 981
411 Ga0501037_0053731 3300049573 Bacteria 2947
412 Ga0501037_1106932 3300049573 Bacteria 513
413 Ga0501038_0077282 3300049574 Bacteria 2810
414 Ga0501038_0103598 3300049574 Bacteria 2366
415 Ga0501038_0246701 3300049574 Bacteria 1416
416 Ga0501039_0026451 3300049575 Bacteria 4458
417 Ga0501039_0067384 3300049575 Bacteria 2779
418 Ga0501039_1061879 3300049575 Bacteria 628
419 Ga0501040_0036784 3300049576 Bacteria 3324
420 Ga0501040_0049698 3300049576 Bacteria 2867
421 Ga0501040_0439071 3300049576 Bacteria 939
422 Ga0501040_1314849 3300049576 Bacteria 525
423 Ga0501041_0001801 3300049577 Bacteria 12006
424 Ga0501041_0038382 3300049577 Bacteria 2904
425 Ga0501041_0909797 3300049577 Bacteria 565
426 Ga0501042_0047546 3300049578 Bacteria 3059
427 Ga0501042_0057911 3300049578 Bacteria 2765
428 Ga0501042_0319828 3300049578 Bacteria 1121
429 Ga0501042_0444114 3300049578 Bacteria 941
430 Ga0501042_0662841 3300049578 Bacteria 759
431 Ga0501043_0102508 3300049579 Bacteria 2249
432 Ga0501043_0237742 3300049579 Bacteria 1406
433 Ga0501043_0623912 3300049579 Bacteria 794
434 Ga0501043_0821408 3300049579 Bacteria 671
435 Ga0501046_0015827 3300049580 Bacteria 6329
436 Ga0501046_0027678 3300049580 Bacteria 4624
437 Ga0501046_0389674 3300049580 Bacteria 1007
438 Ga0501047_0173029 3300049581 Bacteria 2028
439 Ga0501048_0019738 3300049582 Bacteria 4943
440 Ga0501048_0034424 3300049582 Bacteria 3654
441 Ga0501067_0003635 3300049583 Bacteria 8495
442 Ga0501067_0003985 3300049583 Bacteria 8151
443 Ga0501068_0005338 3300049584 Bacteria 7021
444 Ga0501068_0042106 3300049584 Bacteria 2746
445 Ga0501068_0173292 3300049584 Bacteria 1362
446 Ga0501068_1118733 3300049584 Bacteria 521
447 Ga0501069_0138112 3300049585 Bacteria 1397
448 Ga0501069_0192162 3300049585 Bacteria 1181
449 Ga0501069_0327205 3300049585 Bacteria 901
450 Ga0501070_0020334 3300049586 Bacteria 5569
451 Ga0501070_0037105 3300049586 Bacteria 4068
452 Ga0501070_1110980 3300049586 Bacteria 609
453 Ga0501071_0000248 3300049587 Bacteria 25026
454 Ga0501071_0435726 3300049587 Bacteria 1003
455 Ga0501071_0514654 3300049587 Bacteria 918
456 Ga0501071_0850635 3300049587 Bacteria 703
457 Ga0501072_0000230 3300049588 Bacteria 41301
458 Ga0501072_0020527 3300049588 Bacteria 5120
459 Ga0501072_0023752 3300049588 Bacteria 4762
460 Ga0501072_0028195 3300049588 Bacteria 4383
461 Ga0501072_0118246 3300049588 Bacteria 2112
462 Ga0501072_0793671 3300049588 Bacteria 742
463 Ga0501073_0020429 3300049589 Bacteria 4776
464 Ga0501074_0000759 3300049590 Bacteria 20306
465 Ga0501074_0005288 3300049590 Bacteria 9294
466 Ga0501074_0029159 3300049590 Bacteria 3997
467 Ga0501074_0039182 3300049590 Bacteria 3432
468 Ga0501074_0294614 3300049590 Bacteria 1153
469 Ga0501074_0469096 3300049590 Bacteria 892
470 Ga0501075_0011410 3300049591 Bacteria 6288
471 Ga0501075_0035548 3300049591 Bacteria 3716
472 Ga0501075_0295106 3300049591 Bacteria 1235
473 Ga0501075_1308841 3300049591 Bacteria 549
474 Ga0501076_0004033 3300049592 Bacteria 10372
475 Ga0501076_0061021 3300049592 Bacteria 3000
476 Ga0501076_0262296 3300049592 Bacteria 1415
477 Ga0501076_0368852 3300049592 Bacteria 1180
478 Ga0501076_0466505 3300049592 Bacteria 1040
479 Ga0501077_0002181 3300049593 Bacteria 11828
480 Ga0501077_0013436 3300049593 Bacteria 5135
481 Ga0501077_0014164 3300049593 Bacteria 5005
482 Ga0501079_0003596 3300049741 Bacteria 11401
483 Ga0501079_0006074 3300049741 Bacteria 9050
484 Ga0501079_0062867 3300049741 Bacteria 2863
485 Ga0501079_0646622 3300049741 Bacteria 833
486 Ga0501080_0013706 3300049742 Bacteria 7465
487 Ga0501080_0014324 3300049742 Bacteria 7302
488 Ga0501080_0031099 3300049742 Bacteria 4974
489 Ga0501080_0246309 3300049742 Bacteria 1630
490 Ga0501081_0123831 3300049743 Bacteria 1843
491 Ga0501081_0189623 3300049743 Bacteria 1489
492 Ga0501081_0262290 3300049743 Bacteria 1263
493 Ga0501081_0262783 3300049743 Bacteria 1261
494 Ga0501081_0938644 3300049743 Bacteria 653
495 Ga0501083_0006595 3300049744 Bacteria 8238
496 Ga0501083_0026152 3300049744 Bacteria 4037
497 Ga0501083_0157400 3300049744 Bacteria 1487
498 Ga0501035_0175755 3300049822 Bacteria 1847
499 Ga0501035_0482057 3300049822 Bacteria 1023
500 Ga0501044_0115491 3300049823 Bacteria 2690
501 Ga0501044_0166541 3300049823 Bacteria 2178
502 Ga0501044_0246031 3300049823 Bacteria 1731
503 Ga0501045_0013539 3300049824 Bacteria 5762
504 Ga0501045_0023371 3300049824 Bacteria 4430
505 Ga0501045_0200707 3300049824 Bacteria 1486
506 Ga0501045_0330486 3300049824 Bacteria 1134
507 nmdc:mga03n38_430912_c1 3300050490 Bacteria 731
508 nmdc:mga0yw44_1141902_c1 3300050492 Bacteria 526
509 nmdc:mga0yw44_116441_c1 3300050492 Bacteria 1717
510 nmdc:mga0yw44_215706_c1 3300050492 Bacteria 1270
511 nmdc:mga0yw44_2207_c1 3300050492 Bacteria 8203
512 nmdc:mga0yw44_456382_c1 3300050492 Bacteria 866
513 nmdc:mga06z11_350600_c1 3300050494 Bacteria 884
514 nmdc:mga04h51_10232_c1 3300050495 Bacteria 2571
515 nmdc:mga05p37_166641_c1 3300050507 Bacteria 2688
516 nmdc:mga09592_475047_c1 3300050508 Bacteria 1077
517 nmdc:mga0qj67_514671_c1 3300050509 Bacteria 961
518 nmdc:mga06r32_54098_c1 3300050510 Bacteria 3849
519 nmdc:mga06r32_589_c1 3300050510 Bacteria 31615
520 nmdc:mga08y16_2020884_c1 3300050511 Bacteria 525
521 nmdc:mga08y16_445454_c1 3300050511 Bacteria 1321
522 nmdc:mga0n895_559091_c1 3300050512 Bacteria 1149
523 Ga0500556_0000337 3300053104 Bacteria 34999
524 Ga0500568_0134235 3300053139 Bacteria 919
525 Ga0501084_0023220 3300054114 Bacteria 5178
526 Ga0501084_0069923 3300054114 Bacteria 2939
527 Ga0501084_0073947 3300054114 Bacteria 2853
528 Ga0501084_0116463 3300054114 Bacteria 2246
529 Ga0501084_0556647 3300054114 Bacteria 969
530 Ga0501084_1008250 3300054114 Bacteria 700
531 Ga0501082_0013245 3300060353 Bacteria 7092
532 Ga0501082_0023310 3300060353 Bacteria 5340
533 Ga0501082_0034345 3300060353 Bacteria 4373
534 Ga0501082_0081224 3300060353 Bacteria 2797
535 Ga0530510_0012635 3300061734 Bacteria 5936
536 Ga0530510_0032376 3300061734 Bacteria 3761
537 Ga0530510_0654639 3300061734 Bacteria 800
538 2623586677 2622736626 Bacteria 7181580
539 2816420652 2816332119 Bacteria 8120218
540 2861524143 2861520306 Bacteria 8348283
541 2902585139 2902582711 Bacteria 6187705
542 Ga0182008_10054748
543 JGI24737J22298_10011547
544 JGI24737J22298_10052631
545 JGI24743J22301_10004684
546 JGI24735J21928_10031682
547 JGI24735J21928_10163628
548 Ga0006759J45824_1175159
549 JGI25406J46586_10037408
550 JGI25407J50210_10064394
551 Ga0058859_11257982
552 Ga0058863_11736278
553 Ga0070658_11761536
554 Ga0070683_100064737
555 Ga0070683_100081729
556 Ga0070683_100250871
557 Ga0070683_100338892
558 Ga0070683_101041149
559 Ga0070683_102414378
560 Ga0070690_101441109
561 Ga0070670_100388681
562 Ga0070677_10894322
563 Ga0068869_100790893
564 Ga0068869_101015259
565 Ga0070680_100134273
566 Ga0070682_100023922
567 Ga0070682_100057122
568 Ga0068868_100039053
569 Ga0068868_100355391
570 Ga0070660_100161628
571 Ga0070689_100755394
572 Ga0070691_10014312
573 Ga0070687_100039746
574 Ga0070692_10022319
575 Ga0070675_100078745
576 Ga0070675_100435746
577 Ga0070671_100709759
578 Ga0070671_101474273
579 Ga0070674_100844778
580 Ga0070674_101022888
581 Ga0070674_101147156
582 Ga0070659_100206131
583 Ga0070667_100112378
584 Ga0070667_100116382
585 Ga0070709_10945079
586 Ga0070714_100555315
587 Ga0070713_100680460
588 Ga0070710_10881481
589 Ga0070700_100071833
590 Ga0070700_100792084
591 Ga0070663_100942241
592 Ga0070662_100228737
593 Ga0070681_10396118
594 Ga0068867_100108033
595 Ga0068867_101749669
596 Ga0070685_10039025
597 Ga0070698_100691431
598 Ga0070698_100907711
599 Ga0070679_100374747
600 Ga0070684_100050767
601 Ga0070684_100074104
602 Ga0070684_100563498
603 Ga0070684_100752491
604 Ga0070684_101583889
605 Ga0068853_100149160
606 Ga0068853_100257828
607 Ga0070672_101145909
608 Ga0070695_101700873
609 Ga0070696_101518203
610 Ga0070665_100003935
611 Ga0070665_100163678
612 Ga0070665_102286071
613 Ga0068855_100220657
614 Ga0070664_100079742
615 Ga0070664_100423788
616 Ga0070664_100426578
617 Ga0068857_100071499
618 Ga0068857_100141135
619 Ga0068857_100152590
620 Ga0068857_101142120
621 Ga0068857_101249848
622 Ga0068857_101345934
623 Ga0068856_100183902
624 Ga0068856_101510100
625 Ga0070702_100011642
626 Ga0068852_100228878
627 Ga0068859_100056078
628 Ga0068864_100086735
629 Ga0068864_100965883
630 Ga0068864_101377300
631 Ga0068866_10110242
632 Ga0068866_10444080
633 Ga0068866_10625905
634 Ga0068861_100421069
635 Ga0068861_100664873
636 Ga0068870_10358218
637 Ga0068870_10369878
638 Ga0068870_11076670
639 Ga0068860_100079454
640 Ga0068860_101767536
641 Ga0068862_100053157
642 Ga0081455_10002059
643 Ga0081538_10000729
644 Ga0081538_10198628
645 Ga0081538_10225636
646 Ga0081539_10036873
647 Ga0081539_10071818
648 Ga0081539_10484646
649 Ga0070717_10306835
650 Ga0075365_10018101
651 Ga0075365_10555774
652 Ga0075365_10780103
653 Ga0075368_10005655
654 Ga0075363_100001067
655 Ga0070716_100930653
656 Ga0070712_100353900
657 Ga0075367_10001374
658 Ga0097621_100546464
659 Ga0097621_100768650
660 Ga0075370_10212269
661 Ga0068871_101915476
662 Ga0075431_100000225
663 Ga0075431_100017643
664 Ga0075433_10571769
665 Ga0075434_100563333
666 Ga0075429_100309214
667 Ga0068865_100091992
668 Ga0068865_100115475
669 Ga0068865_100889707
670 Ga0097620_100056078
671 Ga0111539_10731487
672 Ga0105245_10003446
673 Ga0105245_10094703
674 Ga0105245_10095038
675 Ga0105245_10126194
676 Ga0114129_10556725
677 Ga0105243_10010069
678 Ga0105243_10045423
679 Ga0105243_10898422
680 Ga0105242_10070226
681 Ga0105242_11145433
682 Ga0105248_10075344
683 Ga0105248_10084022
684 Ga0105248_10861670
685 Ga0105248_11930285
686 Ga0105238_10070439
687 Ga0105238_10715221
688 Ga0105238_11361474
689 Ga0105249_10082081
690 Ga0105249_11148710
691 Ga0105249_12008073
692 Ga0105249_12417900
693 Ga0105239_10010810
694 Ga0105239_10696426
695 Ga0105239_13599951
696 Ga0105246_10030381
697 Ga0105246_10070361
698 Ga0105246_11492769
699 Ga0157320_1022146
700 Ga0157329_1021591
701 Ga0157370_11815913
702 Ga0157369_10044163
703 Ga0157369_10190384
704 Ga0157369_10202342
705 Ga0157374_10719744
706 Ga0157374_12212017
707 Ga0163162_10005430
708 Ga0157372_10051212
709 Ga0157372_10053388
710 Ga0157372_10062084
711 Ga0157372_10264729
712 Ga0157372_10824303
713 Ga0157372_11381916
714 Ga0157375_10030298
715 Ga0157375_10631690
716 Ga0157375_11079639
717 Ga0163163_10040703
718 Ga0163163_10196631
719 Ga0163163_10487591
720 Ga0163163_10980033
721 Ga0163163_11118736
722 Ga0163163_11364137
723 Ga0157380_10040470
724 Ga0157380_10823225
725 Ga0157377_10005915
726 Ga0157377_10076099
727 Ga0157377_10232046
728 Ga0157377_10426018
729 Ga0157376_10218045
730 Ga0163161_10540014
731 Ga0163161_11043638
732 Ga0224712_10393306
733 Ga0224712_10539497
734 Ga0207697_10060760
735 Ga0207656_10582974
736 Ga0207692_10333575
737 Ga0207642_10393326
738 Ga0207688_10039685
739 Ga0207688_10298768
740 Ga0207647_10043341
741 Ga0207685_10383254
742 Ga0207645_11058873
743 Ga0207643_10990580
744 Ga0207705_10155197
745 Ga0207705_10805015
746 Ga0207707_11336131
747 Ga0207671_11376154
748 Ga0207693_10291473
749 Ga0207660_10182033
750 Ga0207662_10500645
751 Ga0207662_10690447
752 Ga0207657_10145550
753 Ga0207657_10176163
754 Ga0207652_11247495
755 Ga0207694_11138717
756 Ga0207650_10440249
757 Ga0207659_10091729
758 Ga0207659_10303742
759 Ga0207687_10023875
760 Ga0207687_10087203
761 Ga0207687_11217146
762 Ga0207700_10006170
763 Ga0207664_10082464
764 Ga0207664_10186270
765 Ga0207690_10248857
766 Ga0207706_10677055
767 Ga0207686_10045660
768 Ga0207709_10015958
769 Ga0207670_11088053
770 Ga0207669_10824865
771 Ga0207704_10084659
772 Ga0207704_10227962
773 Ga0207704_11625408
774 Ga0207665_10132741
775 Ga0207665_10486361
776 Ga0207691_10016742
777 Ga0207711_10053496
778 Ga0207689_10527939
779 Ga0207661_10012061
780 Ga0207661_10025217
781 Ga0207661_10161588
782 Ga0207661_10332776
783 Ga0207661_10508078
784 Ga0207661_12181230
785 Ga0207679_10128977
786 Ga0207667_10364985
787 Ga0207667_11104986
788 Ga0207712_10045000
789 Ga0207712_10582152
790 Ga0207658_10090398
791 Ga0207658_10160261
792 Ga0207677_10855700
793 Ga0207703_10287523
794 Ga0207639_10270560
795 Ga0207708_10139801
796 Ga0207708_11803578
797 Ga0207702_10251219
798 Ga0207641_10735666
799 Ga0207648_10035477
800 Ga0207676_10170214
801 Ga0207676_10556032
802 Ga0207676_10814899
803 Ga0207676_11361117
804 Ga0207676_11969833
805 Ga0207674_10087753
806 Ga0207674_10930280
807 Ga0207674_11146772
808 Ga0207675_100441164
809 Ga0207675_100691565
810 Ga0207683_10131672
811 Ga0207683_10174504
812 Ga0207683_10755086
813 Ga0207698_10101220
814 Ga0207698_10413191
815 Ga0209813_10000938
816 Ga0268266_10013154
817 Ga0268266_10901759
818 Ga0268265_10216774
819 Ga0268265_10551609
820 Ga0268265_12566157
821 Ga0268264_10264348
822 Ga0268264_11150134
823 Ga0307515_10056418
824 Ga0307513_10965204
825 Ga0307508_10503308
826 Ga0307516_10017158
827 Ga0307413_11175753
828 Ga0307413_11333447
829 Ga0307410_10209779
830 Ga0307410_10871140
831 Ga0307410_11458441
832 Ga0307406_10642406
833 Ga0307406_10797134
834 Ga0307406_11279670
835 Ga0307407_11162758
836 Ga0307407_11701010
837 Ga0307409_100593133
838 Ga0307409_101088418
839 Ga0307416_100120090
840 Ga0307416_100412548
841 Ga0307416_102582085
842 Ga0307416_103117038
843 Ga0307414_10161803
844 Ga0307414_11622450
845 Ga0307411_10431950
846 Ga0307411_11467616
847 Ga0307415_101259947
848 Ga0307415_101592947
849 Ga0307415_101896956
850 Ga0307415_102190562
851 Ga0307415_102497646
852 Ga0307510_10394025
853 Ga0373958_0107874
854 Ga0373959_0218664
855 Ga0373938_0141449
856 Ga0373952_0210941
857 Ga0373960_0413122
858 Ga0373946_0547348
859 Ga0373931_0375799
860 Ga0373947_1144272
861 Ga0373925_0093204
862 Ga0395898_0016608
863 Ga0395901_0138272
864 Ga0395901_0455555
865 Ga0395901_1407235
866 Ga0395901_1423434
867 Ga0242420_053705
868 Ga0451793_0391358
869 Ga0451793_0602186
870 Ga0451795_1436482
871 Ga0451800_0576408
872 Ga0451837_1541608
873 Ga0451843_0353371
874 Ga0451853_3007839
875 Ga0466972_0120020
876 Ga0466972_0269821
877 Ga0466965_0168295
878 Ga0466961_0265439
879 Ga0466963_1339229
880 Ga0466964_0062275
881 Ga0466970_0714271
882 Ga0451576_0615427
883 Ga0466967_0021503
884 Ga0466967_0478435
885 Ga0466967_0799310
886 Ga0466967_0914607
887 Ga0466967_1017200
888 Ga0495603_0022968
889 Ga0495603_0633914
890 Ga0495629_0466717
891 Ga0495582_0410558
892 Ga0495582_0657475
893 Ga0495639_0248948
894 Ga0495664_0947146
895 Ga0495652_0831988
896 Ga0495658_0013335
897 Ga0495658_0138629
898 Ga0495658_0833146
899 Ga0495581_0487633
900 Ga0495676_0054976
901 Ga0495593_0724516
902 Ga0496101_0157445
903 Ga0496101_0988551
904 Ga0496102_0004694
905 Ga0496102_0422291
906 Ga0496102_0515812
907 Ga0496103_0144830
908 Ga0496103_0476424
909 Ga0496104_0232007
910 Ga0496105_0081237
911 Ga0496105_0479458
912 Ga0496106_0104302
913 Ga0496106_0540139
914 Ga0496106_0940581
915 Ga0496107_0414660
916 Ga0496107_0829935
917 Ga0496108_0066909
918 Ga0496108_0081412
919 Ga0496108_0589092
920 Ga0496109_0121683
921 Ga0496109_0138673
922 Ga0496109_0177452
923 Ga0496109_1018803
924 Ga0496110_0028648
925 Ga0496110_0274599
926 Ga0496110_0384594
927 Ga0496110_0515904
928 Ga0496110_0804428
929 Ga0496111_0012336
930 Ga0496111_0622515
931 Ga0496112_1146610
932 Ga0496113_0204549
933 Ga0496114_0185340
934 Ga0496114_0623666
935 Ga0496114_0659500
936 Ga0496114_0771484
937 Ga0496114_0816907
938 Ga0496114_1365872
939 Ga0501031_0024726
940 Ga0501031_0024760
941 Ga0501031_0058622
942 Ga0501031_0800651
943 Ga0501032_0020900
944 Ga0501032_0154679
945 Ga0501032_0884174
946 Ga0501033_0480973
947 Ga0501034_0016668
948 Ga0501034_0034348
949 Ga0501036_0020226
950 Ga0501036_0090042
951 Ga0501036_0527757
952 Ga0501037_0053731
953 Ga0501037_1106932
954 Ga0501038_0077282
955 Ga0501038_0103598
956 Ga0501038_0246701
957 Ga0501039_0026451
958 Ga0501039_0067384
959 Ga0501039_1061879
960 Ga0501040_0036784
961 Ga0501040_0049698
962 Ga0501040_0439071
963 Ga0501040_1314849
964 Ga0501041_0001801
965 Ga0501041_0038382
966 Ga0501041_0909797
967 Ga0501042_0047546
968 Ga0501042_0057911
969 Ga0501042_0319828
970 Ga0501042_0444114
971 Ga0501042_0662841
972 Ga0501043_0102508
973 Ga0501043_0237742
974 Ga0501043_0623912
975 Ga0501043_0821408
976 Ga0501046_0015827
977 Ga0501046_0027678
978 Ga0501046_0389674
979 Ga0501047_0173029
980 Ga0501048_0019738
981 Ga0501048_0034424
982 Ga0501067_0003635
983 Ga0501067_0003985
984 Ga0501068_0005338
985 Ga0501068_0042106
986 Ga0501068_0173292
987 Ga0501068_1118733
988 Ga0501069_0138112
989 Ga0501069_0192162
990 Ga0501069_0327205
991 Ga0501070_0020334
992 Ga0501070_0037105
993 Ga0501070_1110980
994 Ga0501071_0000248
995 Ga0501071_0435726
996 Ga0501071_0514654
997 Ga0501071_0850635
998 Ga0501072_0000230
999 Ga0501072_0020527
1000 Ga0501072_0023752
1001 Ga0501072_0028195
1002 Ga0501072_0118246
1003 Ga0501072_0793671
1004 Ga0501073_0020429
1005 Ga0501074_0000759
1006 Ga0501074_0005288
1007 Ga0501074_0029159
1008 Ga0501074_0039182
1009 Ga0501074_0294614
1010 Ga0501074_0469096
1011 Ga0501075_0011410
1012 Ga0501075_0035548
1013 Ga0501075_0295106
1014 Ga0501075_1308841
1015 Ga0501076_0004033
1016 Ga0501076_0061021
1017 Ga0501076_0262296
1018 Ga0501076_0368852
1019 Ga0501076_0466505
1020 Ga0501077_0002181
1021 Ga0501077_0013436
1022 Ga0501077_0014164
1023 Ga0501079_0003596
1024 Ga0501079_0006074
1025 Ga0501079_0062867
1026 Ga0501079_0646622
1027 Ga0501080_0013706
1028 Ga0501080_0014324
1029 Ga0501080_0031099
1030 Ga0501080_0246309
1031 Ga0501081_0123831
1032 Ga0501081_0189623
1033 Ga0501081_0262290
1034 Ga0501081_0262783
1035 Ga0501081_0938644
1036 Ga0501083_0006595
1037 Ga0501083_0026152
1038 Ga0501083_0157400
1039 Ga0501035_0175755
1040 Ga0501035_0482057
1041 Ga0501044_0115491
1042 Ga0501044_0166541
1043 Ga0501044_0246031
1044 Ga0501045_0013539
1045 Ga0501045_0023371
1046 Ga0501045_0200707
1047 Ga0501045_0330486
1048 nmdc:mga03n38_430912_c1
1049 nmdc:mga0yw44_1141902_c1
1050 nmdc:mga0yw44_116441_c1
1051 nmdc:mga0yw44_215706_c1
1052 nmdc:mga0yw44_2207_c1
1053 nmdc:mga0yw44_456382_c1
1054 nmdc:mga06z11_350600_c1
1055 nmdc:mga04h51_10232_c1
1056 nmdc:mga05p37_166641_c1
1057 nmdc:mga09592_475047_c1
1058 nmdc:mga0qj67_514671_c1
1059 nmdc:mga06r32_54098_c1
1060 nmdc:mga06r32_589_c1
1061 nmdc:mga08y16_2020884_c1
1062 nmdc:mga08y16_445454_c1
1063 nmdc:mga0n895_559091_c1
1064 Ga0500556_0000337
1065 Ga0500568_0134235
1066 Ga0501084_0023220
1067 Ga0501084_0069923
1068 Ga0501084_0073947
1069 Ga0501084_0116463
1070 Ga0501084_0556647
1071 Ga0501084_1008250
1072 Ga0501082_0013245
1073 Ga0501082_0023310
1074 Ga0501082_0034345
1075 Ga0501082_0081224
1076 Ga0530510_0012635
1077 Ga0530510_0032376
1078 Ga0530510_0654639
1079 2623586677
1080 2816420652
1081 2861524143
1082 2902585139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

45

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7838 2 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7441 2 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.724 1 119
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.7191 2 115
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7108 1 119
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7838 2 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7567 1 119 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7441 2 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7309 1 119 3.30.70.1060
af_P0ACJ5_55_139_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7029 2 112 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A4Q7XAP5-F1-model_v4 YCII-related domain-containing protein 0.9399 1 116
AF-A0A4Y4DVF4-F1-model_v4 YCII-related domain-containing protein 0.929 1 113
AF-A0A4U2YMV1-F1-model_v4 YCII-related domain-containing protein 0.9276 1 113
AF-A0A0Q9TCH7-F1-model_v4 YCII-related domain-containing protein 0.9252 1 113
AF-A0A4Y4DVF4-F1-model_v4 YCII-related domain-containing protein 0.9213 1 113

Map