F461222

General Info

Members Datasets Scaffolds Average Seq Length
540 244 540 390

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10037185|Ga0075364_100371852
Length 414
Sequence MPTFAFSGRTRAGEAVAGERLAETVEAAVAALRREQILVTKINSIRDKAGSRAAGDAGTAGLKVRGKGVPSKSLAVFTRQFSVMIDAGLPLVQCLDILGKQEPHKHFSATILRTRSDVESGASLADAMRKHPRVFDDLYTNMVAAGEAGGILDTILKRLAIYIEKAVKLKGQVKSAMIYPVAVLSIAAIVVTVIMWKVIPVFAELFRGLDAELPLPTRIVIAISNGVVSYLWIAVLLGVGAVFAIRSYYSTYRGRRVIDGIVLRMPVLGIIMRKIAVARFCRTLSTLLSSGVPILDGLEITSRTAGNAIVEDALKEVRKGIERGETVSAPLAATKVFPSMVTQMINVGETTGALDAMLAKIADFYEEEVDTAVAGLMTLLEPIMISILGVIVGGIVISMYLPLFSLINKLAGGG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
182 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 0
Rhizoplane 4.63
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000349 3300005290 Bacteria 14224
2 Ga0065712_10002429 3300005290 Bacteria 5985
3 Ga0065712_10024397 3300005290 Bacteria 1959
4 Ga0065712_10068107 3300005290 Bacteria 14636
5 Ga0065712_10079037 3300005290 Bacteria 3267
6 Ga0065712_10081126 3300005290 Bacteria 3036
7 Ga0065712_10123309 3300005290 Bacteria 1640
8 Ga0065715_10032747 3300005293 Bacteria 1397
9 Ga0065715_10117232 3300005293 Bacteria 2355
10 Ga0065707_10001170 3300005295 Bacteria 10166
11 Ga0070683_100000203 3300005329 Bacteria 40069
12 Ga0070683_100018553 3300005329 Bacteria 6165
13 Ga0070683_100069411 3300005329 Bacteria 3286
14 Ga0070690_100004757 3300005330 Bacteria 7577
15 Ga0070690_100158570 3300005330 Bacteria 1549
16 Ga0070690_100217898 3300005330 Bacteria 1336
17 Ga0070670_100011412 3300005331 Bacteria 7598
18 Ga0070670_100012632 3300005331 Bacteria 7230
19 Ga0070670_100013495 3300005331 Bacteria 6999
20 Ga0070670_100018188 3300005331 Bacteria 6031
21 Ga0070670_100022465 3300005331 Bacteria 5429
22 Ga0068869_100033456 3300005334 Bacteria 3629
23 Ga0068869_100100072 3300005334 Bacteria 2191
24 Ga0070660_100119893 3300005339 Bacteria 2099
25 Ga0070689_100004907 3300005340 Bacteria 9075
26 Ga0070689_100010355 3300005340 Bacteria 6648
27 Ga0070689_100012551 3300005340 Bacteria 6107
28 Ga0070689_100046186 3300005340 Bacteria 3355
29 Ga0070691_10020225 3300005341 Bacteria 3075
30 Ga0070687_100004479 3300005343 Bacteria 5576
31 Ga0070687_100039923 3300005343 Bacteria 2362
32 Ga0070669_100012347 3300005353 Bacteria 6060
33 Ga0070669_100033354 3300005353 Bacteria 3724
34 Ga0070669_100146683 3300005353 Bacteria 1824
35 Ga0070675_100011211 3300005354 Bacteria 7016
36 Ga0070675_100012322 3300005354 Bacteria 6701
37 Ga0070675_100029575 3300005354 Bacteria 4420
38 Ga0070675_100044386 3300005354 Bacteria 3635
39 Ga0070675_100081447 3300005354 Bacteria 2699
40 Ga0070675_100141271 3300005354 Bacteria 2058
41 Ga0070675_100284041 3300005354 Bacteria 1455
42 Ga0070671_100068866 3300005355 Bacteria 2951
43 Ga0070671_100074366 3300005355 Bacteria 2839
44 Ga0070673_100053642 3300005364 Bacteria 3168
45 Ga0070673_100055283 3300005364 Bacteria 3127
46 Ga0070673_100059201 3300005364 Bacteria 3031
47 Ga0070688_100053996 3300005365 Bacteria 2515
48 Ga0070688_100071797 3300005365 Bacteria 2217
49 Ga0070688_100151224 3300005365 Bacteria 1587
50 Ga0070659_100252510 3300005366 Bacteria 1462
51 Ga0070709_10000004 3300005434 Bacteria 214262
52 Ga0070713_100037331 3300005436 Bacteria 3927
53 Ga0070701_10029700 3300005438 Bacteria 2698
54 Ga0070700_100013397 3300005441 Bacteria 4604
55 Ga0070694_100121000 3300005444 Bacteria 1878
56 Ga0070708_100004515 3300005445 Bacteria 10953
57 Ga0070708_100172852 3300005445 Bacteria 2018
58 Ga0070663_100070786 3300005455 Bacteria 2537
59 Ga0070678_100045347 3300005456 Bacteria 3145
60 Ga0070678_100179795 3300005456 Bacteria 1730
61 Ga0070681_10147812 3300005458 Bacteria 2278
62 Ga0070685_10065742 3300005466 Bacteria 2135
63 Ga0070706_100003147 3300005467 Bacteria 16312
64 Ga0070706_100058775 3300005467 Bacteria 3549
65 Ga0070707_100002125 3300005468 Bacteria 18976
66 Ga0070698_100000322 3300005471 Bacteria 48874
67 Ga0070698_100005125 3300005471 Bacteria 14344
68 Ga0070698_100067927 3300005471 Bacteria 3584
69 Ga0070698_100082568 3300005471 Bacteria 3205
70 Ga0070699_100000410 3300005518 Bacteria 41278
71 Ga0070699_100005960 3300005518 Bacteria 10641
72 Ga0070699_100007545 3300005518 Bacteria 9457
73 Ga0070699_100087180 3300005518 Bacteria 2725
74 Ga0070684_100001546 3300005535 Bacteria 16598
75 Ga0070684_100037279 3300005535 Bacteria 4170
76 Ga0070697_100147332 3300005536 Bacteria 1983
77 Ga0070672_100022846 3300005543 Bacteria 4600
78 Ga0070672_100037301 3300005543 Bacteria 3708
79 Ga0070686_100122928 3300005544 Bacteria 1784
80 Ga0070665_100070301 3300005548 Bacteria 3507
81 Ga0070665_100221844 3300005548 Bacteria 1891
82 Ga0070664_100001490 3300005564 Bacteria 18643
83 Ga0070664_100003698 3300005564 Bacteria 12330
84 Ga0070664_100014767 3300005564 Bacteria 6376
85 Ga0070664_100016160 3300005564 Bacteria 6117
86 Ga0068854_100076893 3300005578 Bacteria 2454
87 Ga0068854_100228147 3300005578 Bacteria 1477
88 Ga0068852_100150804 3300005616 Bacteria 2161
89 Ga0068859_100055705 3300005617 Bacteria 3978
90 Ga0068859_100133272 3300005617 Bacteria 2557
91 Ga0068864_100003915 3300005618 Bacteria 12263
92 Ga0068864_100008235 3300005618 Bacteria 8599
93 Ga0068864_100010959 3300005618 Bacteria 7495
94 Ga0068861_100022923 3300005719 Bacteria 4502
95 Ga0068861_100046899 3300005719 Bacteria 3260
96 Ga0068861_100196673 3300005719 Bacteria 1689
97 Ga0068851_10040669 3300005834 Bacteria 2337
98 Ga0068863_100057807 3300005841 Bacteria 3670
99 Ga0068863_100394513 3300005841 Bacteria 1353
100 Ga0068858_100041065 3300005842 Bacteria 4290
101 Ga0068858_100179646 3300005842 Bacteria 1998
102 Ga0068860_100006066 3300005843 Bacteria 12164
103 Ga0068860_100015009 3300005843 Bacteria 7570
104 Ga0068860_100172797 3300005843 Bacteria 2087
105 Ga0068862_100003829 3300005844 Bacteria 12812
106 Ga0081538_10018514 3300005981 Bacteria 5227
107 Ga0070717_10027169 3300006028 Bacteria 4572
108 Ga0075368_10041179 3300006042 Bacteria 1814
109 Ga0075364_10037185 3300006051 Bacteria 3151
110 Ga0075364_10048406 3300006051 Bacteria 2770
111 Ga0075364_10061741 3300006051 Bacteria 2459
112 Ga0075366_10024198 3300006195 Bacteria 3542
113 Ga0075370_10047451 3300006353 Bacteria 2432
114 Ga0068871_100136422 3300006358 Bacteria 2084
115 Ga0068871_100222792 3300006358 Bacteria 1635
116 Ga0075428_100000009 3300006844 Bacteria 266370
117 Ga0075428_100001308 3300006844 Bacteria 26398
118 Ga0075428_100007578 3300006844 Bacteria 12027
119 Ga0075428_100323847 3300006844 Bacteria 1656
120 Ga0075430_100004652 3300006846 Bacteria 11538
121 Ga0075430_100032145 3300006846 Bacteria 4454
122 Ga0075430_100035849 3300006846 Bacteria 4207
123 Ga0075430_100041836 3300006846 Bacteria 3876
124 Ga0075430_100073036 3300006846 Bacteria 2877
125 Ga0075430_100074030 3300006846 Bacteria 2855
126 Ga0075431_100022794 3300006847 Bacteria 6400
127 Ga0075431_100069933 3300006847 Bacteria 3621
128 Ga0075433_10003803 3300006852 Bacteria 11688
129 Ga0075433_10003815 3300006852 Bacteria 11663
130 Ga0075433_10019040 3300006852 Bacteria 5712
131 Ga0075434_100000793 3300006871 Bacteria 24957
132 Ga0075434_100005293 3300006871 Bacteria 11736
133 Ga0075434_100011292 3300006871 Bacteria 8413
134 Ga0075434_100030856 3300006871 Bacteria 5281
135 Ga0075434_100275483 3300006871 Bacteria 1702
136 Ga0075429_100011412 3300006880 Bacteria 7696
137 Ga0075429_100024700 3300006880 Bacteria 5215
138 Ga0075429_100046131 3300006880 Bacteria 3792
139 Ga0075429_100087113 3300006880 Bacteria 2722
140 Ga0075429_100089882 3300006880 Bacteria 2678
141 Ga0068865_100022119 3300006881 Bacteria 4142
142 Ga0075436_100050511 3300006914 Bacteria 2870
143 Ga0097620_100055705 3300006931 Bacteria 3978
144 Ga0097620_100133276 3300006931 Bacteria 2557
145 Ga0075435_100001996 3300007076 Bacteria 13351
146 Ga0075435_100010659 3300007076 Bacteria 6730
147 Ga0075435_100012001 3300007076 Bacteria 6401
148 Ga0099794_10003993 3300007265 Bacteria 5730
149 Ga0105240_10042488 3300009093 Bacteria 5792
150 Ga0111539_10000010 3300009094 Bacteria 366246
151 Ga0111539_10000614 3300009094 Bacteria 46152
152 Ga0111539_10001273 3300009094 Bacteria 33668
153 Ga0111539_10001499 3300009094 Bacteria 31175
154 Ga0111539_10017253 3300009094 Bacteria 8934
155 Ga0111539_10034374 3300009094 Bacteria 6147
156 Ga0105247_10006922 3300009101 Bacteria 6982
157 Ga0114129_10001071 3300009147 Bacteria 35986
158 Ga0114129_10001896 3300009147 Bacteria 28490
159 Ga0114129_10004157 3300009147 Bacteria 20459
160 Ga0114129_10005721 3300009147 Bacteria 17612
161 Ga0114129_10012189 3300009147 Bacteria 12231
162 Ga0114129_10017174 3300009147 Bacteria 10306
163 Ga0114129_10035687 3300009147 Bacteria 7024
164 Ga0114129_10059468 3300009147 Bacteria 5343
165 Ga0114129_10075190 3300009147 Bacteria 4704
166 Ga0114129_10371664 3300009147 Bacteria 1890
167 Ga0105243_10074138 3300009148 Bacteria 2760
168 Ga0105242_10022195 3300009176 Bacteria 4988
169 Ga0105242_10026787 3300009176 Bacteria 4571
170 Ga0105248_10001908 3300009177 Bacteria 23128
171 Ga0105248_10048907 3300009177 Bacteria 4743
172 Ga0105248_10133698 3300009177 Bacteria 2799
173 Ga0105248_10316677 3300009177 Bacteria 1757
174 Ga0105249_10001364 3300009553 Bacteria 21359
175 Ga0105249_10297588 3300009553 Bacteria 1617
176 Ga0105239_10169986 3300010375 Bacteria 2437
177 Ga0105239_10369795 3300010375 Bacteria 1620
178 Ga0157374_10288975 3300013296 Bacteria 1620
179 Ga0163162_10002588 3300013306 Bacteria 17131
180 Ga0163162_10012854 3300013306 Bacteria 8177
181 Ga0163163_10011765 3300014325 Bacteria 7952
182 Ga0163163_10012777 3300014325 Bacteria 7662
183 Ga0163163_10059247 3300014325 Bacteria 3787
184 Ga0163163_10081695 3300014325 Bacteria 3234
185 Ga0163163_10104915 3300014325 Bacteria 2852
186 Ga0157380_10023242 3300014326 Bacteria 4674
187 Ga0157379_10086672 3300014968 Bacteria 2807
188 Ga0163161_10079782 3300017792 Bacteria 2407
189 Ga0207697_10008193 3300025315 Bacteria 4597
190 Ga0207682_10041702 3300025893 Bacteria 1873
191 Ga0207682_10043846 3300025893 Bacteria 1832
192 Ga0207642_10032953 3300025899 Bacteria 2187
193 Ga0207710_10003834 3300025900 Bacteria 6642
194 Ga0207688_10013595 3300025901 Bacteria 4425
195 Ga0207680_10130654 3300025903 Bacteria 1655
196 Ga0207647_10106068 3300025904 Bacteria 1664
197 Ga0207685_10077819 3300025905 Bacteria 1364
198 Ga0207699_10000033 3300025906 Bacteria 137438
199 Ga0207699_10103991 3300025906 Bacteria 1807
200 Ga0207684_10003471 3300025910 Bacteria 15379
201 Ga0207684_10006680 3300025910 Bacteria 10481
202 Ga0207684_10014927 3300025910 Bacteria 6685
203 Ga0207662_10032297 3300025918 Bacteria 3046
204 Ga0207662_10039473 3300025918 Bacteria 2770
205 Ga0207649_10078636 3300025920 Bacteria 2129
206 Ga0207652_10108300 3300025921 Bacteria 2462
207 Ga0207646_10010197 3300025922 Bacteria 9201
208 Ga0207681_10045148 3300025923 Bacteria 2957
209 Ga0207694_10236881 3300025924 Bacteria 1491
210 Ga0207650_10000718 3300025925 Bacteria 25775
211 Ga0207650_10006674 3300025925 Bacteria 7874
212 Ga0207650_10012107 3300025925 Bacteria 5946
213 Ga0207650_10025684 3300025925 Bacteria 4197
214 Ga0207650_10038127 3300025925 Bacteria 3507
215 Ga0207659_10002655 3300025926 Bacteria 10647
216 Ga0207659_10007467 3300025926 Bacteria 6725
217 Ga0207659_10011579 3300025926 Bacteria 5577
218 Ga0207670_10012943 3300025936 Bacteria 4902
219 Ga0207670_10029105 3300025936 Bacteria 3515
220 Ga0207670_10066107 3300025936 Bacteria 2483
221 Ga0207669_10032390 3300025937 Bacteria 2935
222 Ga0207669_10122880 3300025937 Bacteria 1766
223 Ga0207665_10058035 3300025939 Bacteria 2616
224 Ga0207691_10011635 3300025940 Bacteria 8447
225 Ga0207691_10022964 3300025940 Bacteria 5875
226 Ga0207691_10032030 3300025940 Bacteria 4905
227 Ga0207711_10011562 3300025941 Bacteria 7336
228 Ga0207711_10017948 3300025941 Bacteria 5880
229 Ga0207711_10105099 3300025941 Bacteria 2503
230 Ga0207689_10059047 3300025942 Bacteria 3155
231 Ga0207661_10011385 3300025944 Bacteria 6443
232 Ga0207661_10023551 3300025944 Bacteria 4654
233 Ga0207679_10007637 3300025945 Bacteria 6869
234 Ga0207679_10026902 3300025945 Bacteria 3972
235 Ga0207679_10045123 3300025945 Bacteria 3185
236 Ga0207667_10102464 3300025949 Bacteria 2953
237 Ga0207651_10001198 3300025960 Bacteria 11611
238 Ga0207651_10054779 3300025960 Bacteria 2735
239 Ga0207651_10225586 3300025960 Bacteria 1518
240 Ga0207712_10061270 3300025961 Bacteria 2670
241 Ga0207712_10132664 3300025961 Bacteria 1900
242 Ga0207640_10064445 3300025981 Bacteria 2440
243 Ga0207658_10002202 3300025986 Bacteria 14475
244 Ga0207658_10132144 3300025986 Bacteria 2007
245 Ga0207677_10118053 3300026023 Bacteria 1989
246 Ga0207677_10163702 3300026023 Bacteria 1731
247 Ga0207639_10160267 3300026041 Bacteria 1895
248 Ga0207678_10058979 3300026067 Bacteria 3303
249 Ga0207678_10088527 3300026067 Bacteria 2646
250 Ga0207708_10002731 3300026075 Bacteria 12963
251 Ga0207708_10045450 3300026075 Bacteria 3346
252 Ga0207641_10080502 3300026088 Bacteria 2826
253 Ga0207641_10127587 3300026088 Bacteria 2280
254 Ga0207648_10009126 3300026089 Bacteria 9532
255 Ga0207676_10024593 3300026095 Bacteria 4458
256 Ga0207675_100025235 3300026118 Bacteria 5532
257 Ga0207675_100040153 3300026118 Bacteria 4368
258 Ga0207675_100178891 3300026118 Bacteria 2030
259 Ga0207675_100213581 3300026118 Bacteria 1856
260 Ga0207683_10024371 3300026121 Bacteria 5211
261 Ga0207683_10064552 3300026121 Bacteria 3226
262 Ga0207683_10068439 3300026121 Bacteria 3134
263 Ga0207683_10196645 3300026121 Bacteria 1832
264 Ga0209982_1000263 3300027552 Bacteria 6358
265 Ga0210002_1000304 3300027617 Bacteria 6774
266 Ga0209971_1000518 3300027682 Bacteria 10198
267 Ga0209813_10026648 3300027866 Bacteria 1673
268 Ga0209974_10001190 3300027876 Bacteria 9297
269 Ga0207428_10000034 3300027907 Bacteria 231306
270 Ga0207428_10000570 3300027907 Bacteria 43701
271 Ga0207428_10001339 3300027907 Bacteria 26209
272 Ga0207428_10003549 3300027907 Bacteria 15074
273 Ga0207428_10263849 3300027907 Bacteria 1282
274 Ga0268266_10191277 3300028379 Bacteria 1868
275 Ga0268265_10000290 3300028380 Bacteria 56705
276 Ga0268265_10264729 3300028380 Bacteria 1530
277 Ga0268264_10020274 3300028381 Bacteria 5434
278 Ga0268264_10041826 3300028381 Bacteria 3791
279 Ga0268264_10076532 3300028381 Bacteria 2847
280 Ga0265334_10007738 3300028573 Bacteria 4604
281 Ga0265338_10008655 3300028800 Bacteria 12311
282 Ga0265338_10022525 3300028800 Bacteria 6518
283 Ga0265332_10003471 3300031238 Bacteria 7591
284 Ga0307408_100018424 3300031548 Bacteria 4687
285 Ga0307408_100025455 3300031548 Bacteria 4055
286 Ga0307408_100025995 3300031548 Bacteria 4014
287 Ga0307408_100029643 3300031548 Bacteria 3794
288 Ga0307408_100040604 3300031548 Bacteria 3295
289 Ga0307408_100146285 3300031548 Bacteria 1860
290 Ga0265313_10071102 3300031595 Bacteria 1602
291 Ga0307508_10017770 3300031616 Bacteria 6469
292 Ga0307405_10007822 3300031731 Bacteria 5380
293 Ga0307405_10108016 3300031731 Bacteria 1879
294 Ga0307410_10094477 3300031852 Bacteria 2130
295 Ga0307406_10164403 3300031901 Bacteria 1599
296 Ga0307412_10115793 3300031911 Bacteria 1922
297 Ga0307412_10152489 3300031911 Bacteria 1707
298 Ga0307412_10230731 3300031911 Bacteria 1425
299 Ga0307416_100023912 3300032002 Bacteria 4446
300 Ga0307416_100026377 3300032002 Bacteria 4281
301 Ga0307416_100031522 3300032002 Bacteria 3992
302 Ga0307416_100250702 3300032002 Bacteria 1723
303 Ga0307414_10122182 3300032004 Bacteria 2004
304 Ga0307411_10042108 3300032005 Bacteria 2911
305 Ga0307411_10130261 3300032005 Bacteria 1837
306 Ga0307415_100018358 3300032126 Bacteria 4222
307 Ga0307415_100060229 3300032126 Bacteria 2622
308 Ga0307415_100083583 3300032126 Bacteria 2288
309 Ga0373929_0000004 3300035085 Bacteria 462745
310 Ga0373942_0010743 3300035207 Bacteria 2159
311 Ga0373961_0000039 3300035241 Bacteria 78101
312 Ga0373933_0018210 3300035724 Bacteria 3948
313 Ga0373937_0002713 3300036401 Bacteria 14778
314 Ga0373937_0111571 3300036401 Bacteria 2544
315 Ga0439431_0019294 3300041997 Bacteria 1620
316 Ga0439441_006446 3300042001 Bacteria 1863
317 Ga0439449_0015590 3300042007 Bacteria 2857
318 Ga0450923_002882 3300042125 Bacteria 2534
319 Ga0450923_012237 3300042125 Bacteria 1558
320 Ga0439446_0014127 3300042156 Bacteria 2200
321 Ga0439446_0015161 3300042156 Bacteria 2135
322 Ga0439435_0007652 3300042436 Bacteria 2481
323 Ga0439435_0011290 3300042436 Bacteria 2141
324 Ga0439464_0003824 3300042439 Bacteria 3829
325 Ga0451577_0032045 3300042876 Bacteria 4736
326 Ga0451577_0074670 3300042876 Bacteria 3023
327 Ga0453683_0002530 3300044673 Bacteria 14113
328 Ga0453684_0041652 3300044712 Bacteria 6206
329 Ga0451576_0002764 3300045051 Bacteria 25371
330 Ga0451576_0007523 3300045051 Bacteria 12995
331 Ga0451576_0007839 3300045051 Bacteria 12653
332 Ga0451576_0041185 3300045051 Bacteria 4885
333 Ga0451576_0177552 3300045051 Bacteria 2224
334 Ga0495638_0012100 3300046460 Bacteria 5928
335 Ga0495580_0070075 3300046472 Bacteria 2450
336 Ga0495643_0007165 3300046522 Bacteria 7234
337 Ga0495598_0009992 3300046537 Bacteria 2259
338 Ga0495633_0025839 3300046558 Bacteria 2888
339 Ga0495670_0018723 3300046691 Bacteria 3411
340 Ga0495674_0117260 3300047319 Bacteria 2252
341 Ga0495680_0127967 3300047322 Bacteria 1869
342 Ga0496100_0005177 3300048903 Bacteria 6995
343 Ga0496101_0000634 3300048904 Bacteria 21327
344 Ga0496102_0011424 3300048905 Bacteria 7655
345 Ga0496104_0012730 3300048907 Bacteria 7577
346 Ga0496104_0013068 3300048907 Bacteria 7478
347 Ga0496104_0015018 3300048907 Bacteria 7006
348 Ga0496104_0083221 3300048907 Bacteria 3052
349 Ga0496105_0014566 3300048908 Bacteria 6262
350 Ga0496106_0005575 3300048909 Bacteria 9319
351 Ga0496106_0067530 3300048909 Bacteria 2726
352 Ga0496106_0083808 3300048909 Bacteria 2452
353 Ga0496106_0105304 3300048909 Bacteria 2192
354 Ga0496107_0027063 3300048910 Bacteria 4071
355 Ga0496107_0040180 3300048910 Bacteria 3357
356 Ga0496108_0004110 3300048911 Bacteria 11690
357 Ga0496109_0002990 3300048912 Bacteria 14124
358 Ga0496109_0071626 3300048912 Bacteria 3183
359 Ga0496110_0002419 3300048913 Bacteria 13970
360 Ga0496110_0057501 3300048913 Bacteria 3424
361 Ga0496111_0011863 3300048914 Bacteria 5885
362 Ga0496112_0000483 3300048915 Bacteria 26742
363 Ga0496112_0002222 3300048915 Bacteria 15485
364 Ga0496112_0050765 3300048915 Bacteria 4068
365 Ga0496114_0000015 3300048917 Bacteria 278139
366 Ga0496114_0001934 3300048917 Bacteria 15771
367 Ga0501292_004641 3300049515 Bacteria 1887
368 Ga0501299_003408 3300049522 Bacteria 2300
369 Ga0501299_013593 3300049522 Bacteria 1406
370 Ga0501031_0000508 3300049568 Bacteria 22747
371 Ga0501031_0131389 3300049568 Bacteria 1636
372 Ga0501031_0203964 3300049568 Bacteria 1290
373 Ga0501032_0015511 3300049569 Bacteria 5373
374 Ga0501032_0019991 3300049569 Bacteria 4672
375 Ga0501033_0024327 3300049570 Bacteria 4569
376 Ga0501033_0026186 3300049570 Bacteria 4390
377 Ga0501033_0032486 3300049570 Bacteria 3920
378 Ga0501033_0048885 3300049570 Bacteria 3141
379 Ga0501034_0005706 3300049571 Bacteria 13529
380 Ga0501034_0006629 3300049571 Bacteria 12427
381 Ga0501034_0011759 3300049571 Bacteria 9058
382 Ga0501036_0001163 3300049572 Bacteria 20000
383 Ga0501036_0002877 3300049572 Bacteria 13649
384 Ga0501036_0005601 3300049572 Bacteria 10189
385 Ga0501036_0293242 3300049572 Bacteria 1361
386 Ga0501038_0000812 3300049574 Bacteria 27742
387 Ga0501038_0037113 3300049574 Bacteria 4275
388 Ga0501038_0104819 3300049574 Bacteria 2349
389 Ga0501039_0005297 3300049575 Bacteria 9757
390 Ga0501039_0125559 3300049575 Bacteria 2013
391 Ga0501039_0183285 3300049575 Bacteria 1646
392 Ga0501040_0155975 3300049576 Bacteria 1612
393 Ga0501041_0005425 3300049577 Bacteria 7469
394 Ga0501041_0082571 3300049577 Bacteria 1980
395 Ga0501042_0011778 3300049578 Bacteria 5909
396 Ga0501042_0017229 3300049578 Bacteria 4980
397 Ga0501042_0039681 3300049578 Bacteria 3347
398 Ga0501043_0007985 3300049579 Bacteria 8358
399 Ga0501043_0020347 3300049579 Bacteria 5205
400 Ga0501043_0028531 3300049579 Bacteria 4381
401 Ga0501046_0026347 3300049580 Bacteria 4749
402 Ga0501046_0028036 3300049580 Bacteria 4589
403 Ga0501046_0032608 3300049580 Bacteria 4217
404 Ga0501046_0040103 3300049580 Bacteria 3744
405 Ga0501046_0361260 3300049580 Bacteria 1053
406 Ga0501047_0224337 3300049581 Bacteria 1734
407 Ga0501048_0002661 3300049582 Bacteria 13635
408 Ga0501048_0050096 3300049582 Bacteria 2974
409 Ga0501048_0071519 3300049582 Bacteria 2449
410 Ga0501048_0094885 3300049582 Bacteria 2104
411 Ga0501067_0000428 3300049583 Bacteria 22958
412 Ga0501068_0004719 3300049584 Bacteria 7411
413 Ga0501068_0083685 3300049584 Bacteria 1961
414 Ga0501069_0001161 3300049585 Bacteria 12750
415 Ga0501069_0082201 3300049585 Bacteria 1815
416 Ga0501069_0093879 3300049585 Bacteria 1698
417 Ga0501069_0154997 3300049585 Bacteria 1317
418 Ga0501070_0028592 3300049586 Bacteria 4675
419 Ga0501071_0016683 3300049587 Bacteria 5053
420 Ga0501071_0036105 3300049587 Bacteria 3524
421 Ga0501072_0024850 3300049588 Bacteria 4664
422 Ga0501072_0075677 3300049588 Bacteria 2663
423 Ga0501073_0012975 3300049589 Bacteria 6073
424 Ga0501073_0069974 3300049589 Bacteria 2445
425 Ga0501074_0010561 3300049590 Bacteria 6701
426 Ga0501075_0008288 3300049591 Bacteria 7245
427 Ga0501075_0121098 3300049591 Bacteria 1991
428 Ga0501075_0165331 3300049591 Bacteria 1688
429 Ga0501076_0000650 3300049592 Bacteria 22256
430 Ga0501076_0011649 3300049592 Bacteria 6562
431 Ga0501076_0066726 3300049592 Bacteria 2872
432 Ga0501076_0071983 3300049592 Bacteria 2766
433 Ga0501077_0238732 3300049593 Bacteria 1155
434 Ga0501216_000372 3300049660 Bacteria 5166
435 Ga0501227_002087 3300049665 Bacteria 4432
436 Ga0501233_005785 3300049668 Bacteria 2301
437 Ga0501235_020337 3300049669 Bacteria 1474
438 Ga0501236_000888 3300049670 Bacteria 3350
439 Ga0501079_0029131 3300049741 Bacteria 4238
440 Ga0501079_0050047 3300049741 Bacteria 3225
441 Ga0501080_0001074 3300049742 Bacteria 22504
442 Ga0501080_0108958 3300049742 Bacteria 2567
443 Ga0501080_0157008 3300049742 Bacteria 2101
444 Ga0501081_0008083 3300049743 Bacteria 6826
445 Ga0501081_0019833 3300049743 Bacteria 4479
446 Ga0501081_0062923 3300049743 Bacteria 2574
447 Ga0501083_0075146 3300049744 Bacteria 2244
448 Ga0501083_0086849 3300049744 Bacteria 2068
449 Ga0501035_0008408 3300049822 Bacteria 9609
450 Ga0501035_0041928 3300049822 Bacteria 4130
451 Ga0501035_0068039 3300049822 Bacteria 3158
452 Ga0501044_0139451 3300049823 Bacteria 2413
453 Ga0501044_0182983 3300049823 Bacteria 2061
454 Ga0501044_0205948 3300049823 Bacteria 1924
455 Ga0501045_0053648 3300049824 Bacteria 2946
456 Ga0501045_0109532 3300049824 Bacteria 2047
457 Ga0501045_0146196 3300049824 Bacteria 1758
458 nmdc:mga00v17_10736_c1 3300050491 Bacteria 5016
459 nmdc:mga00v17_141707_c1 3300050491 Bacteria 1542
460 nmdc:mga00v17_79221_c1 3300050491 Bacteria 2048
461 nmdc:mga0yw44_4508_c1 3300050492 Bacteria 6404
462 nmdc:mga0k408_21200_c1 3300050493 Bacteria 3649
463 nmdc:mga0k408_24263_c1 3300050493 Bacteria 3428
464 nmdc:mga0k408_48493_c1 3300050493 Bacteria 2457
465 nmdc:mga0k408_60724_c1 3300050493 Bacteria 2197
466 nmdc:mga06z11_58517_c1 3300050494 Bacteria 2000
467 nmdc:mga06z11_86134_c1 3300050494 Bacteria 1696
468 nmdc:mga07m45_95806_c1 3300050496 Bacteria 1703
469 nmdc:mga05p37_10462_c1 3300050507 Bacteria 11008
470 nmdc:mga05p37_114885_c1 3300050507 Bacteria 3309
471 nmdc:mga05p37_151524_c1 3300050507 Bacteria 2836
472 nmdc:mga05p37_2147_c1 3300050507 Bacteria 23015
473 nmdc:mga05p37_32807_c1 3300050507 Bacteria 6353
474 nmdc:mga05p37_3316_c1 3300050507 Bacteria 18781
475 nmdc:mga05p37_33698_c1 3300050507 Bacteria 6273
476 nmdc:mga05p37_77511_c1 3300050507 Bacteria 4092
477 nmdc:mga09592_120423_c1 3300050508 Bacteria 2254
478 nmdc:mga09592_78909_c1 3300050508 Bacteria 2802
479 nmdc:mga0qj67_13657_c1 3300050509 Bacteria 6129
480 nmdc:mga0qj67_255561_c1 3300050509 Bacteria 1421
481 nmdc:mga0qj67_52275_c1 3300050509 Bacteria 3233
482 nmdc:mga0qj67_69406_c1 3300050509 Bacteria 2811
483 nmdc:mga0qj67_72884_c1 3300050509 Bacteria 2743
484 nmdc:mga06r32_13714_c1 3300050510 Bacteria 7350
485 nmdc:mga06r32_318545_c1 3300050510 Bacteria 1541
486 nmdc:mga06r32_39236_c1 3300050510 Bacteria 4492
487 nmdc:mga06r32_8229_c1 3300050510 Bacteria 9389
488 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
489 nmdc:mga08y16_155_c2 3300050511 Bacteria 27910
490 nmdc:mga08y16_186538_c1 3300050511 Bacteria 2152
491 nmdc:mga08y16_2034_c1 3300050511 Bacteria 20719
492 nmdc:mga08y16_24858_c1 3300050511 Bacteria 6319
493 nmdc:mga08y16_31434_c1 3300050511 Bacteria 5583
494 nmdc:mga08y16_350825_c1 3300050511 Bacteria 1516
495 nmdc:mga08y16_69414_c1 3300050511 Bacteria 3674
496 nmdc:mga08y16_920_c1 3300050511 Bacteria 28551
497 nmdc:mga0n895_1036_c1 3300050512 Bacteria 20226
498 nmdc:mga0n895_1103_c1 3300050512 Bacteria 19752
499 nmdc:mga0n895_167915_c1 3300050512 Bacteria 2226
500 nmdc:mga0n895_284953_c1 3300050512 Unclassified 1675
501 nmdc:mga0n895_39282_c1 3300050512 Bacteria 4591
502 nmdc:mga0n895_44657_c1 3300050512 Bacteria 4321
503 nmdc:mga0n895_7600_c1 3300050512 Bacteria 9319
504 nmdc:mga0n895_86258_c1 3300050512 Bacteria 3135
505 nmdc:mga0rr50_155870_c1 3300050513 Bacteria 1850
506 nmdc:mga0rr50_1590_c1 3300050513 Bacteria 12523
507 nmdc:mga0rr50_23379_c1 3300050513 Bacteria 4261
508 nmdc:mga0rr50_84927_c1 3300050513 Bacteria 2452
509 nmdc:mga08x19_11786_c1 3300050514 Bacteria 5263
510 nmdc:mga08x19_136927_c1 3300050514 Bacteria 1652
511 nmdc:mga08x19_177666_c1 3300050514 Bacteria 1452
512 nmdc:mga08x19_46212_c1 3300050514 Bacteria 2784
513 nmdc:mga0a205_173549_c1 3300050515 Bacteria 2052
514 nmdc:mga0a205_2131_c1 3300050515 Bacteria 17373
515 nmdc:mga0a205_29587_c1 3300050515 Bacteria 5242
516 nmdc:mga0a205_4375_c1 3300050515 Bacteria 12667
517 nmdc:mga0a205_5851_c1 3300050515 Bacteria 11073
518 nmdc:mga0a205_6238_c1 3300050515 Bacteria 10760
519 Ga0500641_0000969 3300053096 Bacteria 10205
520 Ga0500555_000371 3300053103 Bacteria 19033
521 Ga0500568_0001537 3300053139 Bacteria 14676
522 Ga0500645_000077 3300053730 Bacteria 77326
523 Ga0501084_0011148 3300054114 Bacteria 7446
524 Ga0501084_0056870 3300054114 Bacteria 3273
525 Ga0501084_0097801 3300054114 Bacteria 2464
526 Ga0590071_000176 3300059421 Bacteria 18488
527 Ga0590071_003126 3300059421 Bacteria 4097
528 Ga0590074_001881 3300059423 Bacteria 3422
529 Ga0590075_003385 3300059424 Bacteria 3797
530 Ga0590075_007681 3300059424 Bacteria 2567
531 Ga0590077_000578 3300059426 Bacteria 10145
532 Ga0501082_0003440 3300060353 Bacteria 13815
533 Ga0501082_0003446 3300060353 Bacteria 13807
534 Ga0501082_0051481 3300060353 Bacteria 3549
535 Ga0501082_0081622 3300060353 Bacteria 2790
536 Ga0501082_0139806 3300060353 Bacteria 2101
537 Ga0530510_0000180 3300061734 Bacteria 38581
538 Ga0530510_0004323 3300061734 Bacteria 9832
539 Ga0530510_0017455 3300061734 Bacteria 5088
540 Ga0530510_0029591 3300061734 Bacteria 3932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100178891 Ga0207675_1001788912 308
2 3300049576 Ga0501040_0155975 Ga0501040_0155975_190_1176 311
3 3300049580 Ga0501046_0361260 Ga0501046_0361260_11_1042 332
4 3300049593 Ga0501077_0238732 Ga0501077_0238732_24_1133 343
5 3300026041 Ga0207639_10160267 Ga0207639_101602671 346
6 3300031548 Ga0307408_100025995 Ga0307408_1000259953 347
7 3300031901 Ga0307406_10164403 Ga0307406_101644032 347
8 3300032002 Ga0307416_100031522 Ga0307416_1000315223 347
9 3300048909 Ga0496106_0105304 Ga0496106_0105304_1004_2149 350
10 3300005471 Ga0070698_100005125 Ga0070698_1000051253 352
11 3300005518 Ga0070699_100000410 Ga0070699_1000004105 352
12 3300025920 Ga0207649_10078636 Ga0207649_100786362 352
13 3300009147 Ga0114129_10005721 Ga0114129_1000572111 353
14 3300025925 Ga0207650_10038127 Ga0207650_100381272 353
15 3300042436 Ga0439435_0011290 Ga0439435_0011290_43_1203 354
16 3300049568 Ga0501031_0203964 Ga0501031_0203964_13_1152 356
17 3300049577 Ga0501041_0082571 Ga0501041_0082571_112_1248 356
18 3300049587 Ga0501071_0016683 Ga0501071_0016683_3234_4370 356
19 3300049588 Ga0501072_0024850 Ga0501072_0024850_3424_4560 356
20 3300049591 Ga0501075_0121098 Ga0501075_0121098_417_1553 356
21 3300049824 Ga0501045_0109532 Ga0501045_0109532_807_1943 356
22 3300050512 nmdc:mga0n895_284953_c1 nmdc:mga0n895_284953_c1_28_1179 356
23 3300049585 Ga0501069_0093879 Ga0501069_0093879_121_1284 357
24 3300049741 Ga0501079_0029131 Ga0501079_0029131_2722_3885 357
25 3300050493 nmdc:mga0k408_48493_c1 nmdc:mga0k408_48493_c1_1270_2409 357
26 3300054114 Ga0501084_0056870 Ga0501084_0056870_393_1556 357
27 3300060353 Ga0501082_0081622 Ga0501082_0081622_373_1536 357
28 3300009147 Ga0114129_10004157 Ga0114129_1000415717 358
29 3300042156 Ga0439446_0014127 Ga0439446_0014127_693_1910 358
30 3300050509 nmdc:mga0qj67_72884_c1 nmdc:mga0qj67_72884_c1_1021_2145 358
31 3300009177 Ga0105248_10048907 Ga0105248_100489072 359
32 3300010375 Ga0105239_10369795 Ga0105239_103697951 359
33 3300035207 Ga0373942_0010743 Ga0373942_0010743_920_2089 359
34 3300035724 Ga0373933_0018210 Ga0373933_0018210_1004_2176 359
35 3300036401 Ga0373937_0002713 Ga0373937_0002713_632_1804 359
36 3300047319 Ga0495674_0117260 Ga0495674_0117260_551_1723 359
37 3300050512 nmdc:mga0n895_167915_c1 nmdc:mga0n895_167915_c1_993_2162 359
38 3300050513 nmdc:mga0rr50_1590_c1 nmdc:mga0rr50_1590_c1_8909_10078 359
39 3300005841 Ga0068863_100394513 Ga0068863_1003945132 360
40 3300031911 Ga0307412_10115793 Ga0307412_101157932 360
41 3300049571 Ga0501034_0005706 Ga0501034_0005706_6767_7984 360
42 3300049743 Ga0501081_0062923 Ga0501081_0062923_1345_2562 360
43 3300005331 Ga0070670_100018188 Ga0070670_1000181884 361
44 3300005458 Ga0070681_10147812 Ga0070681_101478121 361
45 3300009093 Ga0105240_10042488 Ga0105240_100424885 361
46 3300014325 Ga0163163_10104915 Ga0163163_101049152 361
47 3300025893 Ga0207682_10043846 Ga0207682_100438461 361
48 3300025925 Ga0207650_10012107 Ga0207650_100121074 361
49 3300025949 Ga0207667_10102464 Ga0207667_101024641 361
50 3300044712 Ga0453684_0041652 Ga0453684_0041652_2379_3593 361
51 3300049515 Ga0501292_004641 Ga0501292_004641_615_1769 361
52 3300049522 Ga0501299_003408 Ga0501299_003408_214_1368 361
53 3300049660 Ga0501216_000372 Ga0501216_000372_1531_2685 361
54 3300049665 Ga0501227_002087 Ga0501227_002087_729_1883 361
55 3300049668 Ga0501233_005785 Ga0501233_005785_298_1452 361
56 3300049669 Ga0501235_020337 Ga0501235_020337_119_1273 361
57 3300049670 Ga0501236_000888 Ga0501236_000888_1446_2600 361
58 3300047322 Ga0495680_0127967 Ga0495680_0127967_604_1824 362
59 3300050511 nmdc:mga08y16_186538_c1 nmdc:mga08y16_186538_c1_78_1229 362
60 3300005330 Ga0070690_100217898 Ga0070690_1002178981 363
61 3300009147 Ga0114129_10012189 Ga0114129_100121893 363
62 3300036401 Ga0373937_0111571 Ga0373937_0111571_263_1399 363
63 3300049742 Ga0501080_0157008 Ga0501080_0157008_78_1298 363
64 3300050494 nmdc:mga06z11_86134_c1 nmdc:mga06z11_86134_c1_142_1356 363
65 3300050507 nmdc:mga05p37_32807_c1 nmdc:mga05p37_32807_c1_3392_4543 363
66 3300050508 nmdc:mga09592_120423_c1 nmdc:mga09592_120423_c1_863_2014 363
67 3300050509 nmdc:mga0qj67_69406_c1 nmdc:mga0qj67_69406_c1_106_1260 363
68 3300050510 nmdc:mga06r32_13714_c1 nmdc:mga06r32_13714_c1_4473_5624 363
69 3300005290 Ga0065712_10024397 Ga0065712_100243971 364
70 3300005290 Ga0065712_10079037 Ga0065712_100790372 364
71 3300005290 Ga0065712_10081126 Ga0065712_100811262 364
72 3300005293 Ga0065715_10032747 Ga0065715_100327471 364
73 3300005329 Ga0070683_100018553 Ga0070683_1000185532 364
74 3300005331 Ga0070670_100013495 Ga0070670_1000134953 364
75 3300005354 Ga0070675_100284041 Ga0070675_1002840412 364
76 3300005518 Ga0070699_100087180 Ga0070699_1000871802 364
77 3300025925 Ga0207650_10006674 Ga0207650_100066744 364
78 3300025944 Ga0207661_10011385 Ga0207661_100113853 364
79 3300026075 Ga0207708_10045450 Ga0207708_100454502 364
80 3300045051 Ga0451576_0002764 Ga0451576_0002764_11734_12948 364
81 3300045051 Ga0451576_0007839 Ga0451576_0007839_9894_11108 364
82 3300049585 Ga0501069_0082201 Ga0501069_0082201_496_1710 364
83 3300005295 Ga0065707_10001170 Ga0065707_100011708 365
84 3300005334 Ga0068869_100033456 Ga0068869_1000334561 365
85 3300005354 Ga0070675_100044386 Ga0070675_1000443862 365
86 3300005355 Ga0070671_100068866 Ga0070671_1000688661 365
87 3300005441 Ga0070700_100013397 Ga0070700_1000133972 365
88 3300005578 Ga0068854_100076893 Ga0068854_1000768932 365
89 3300005719 Ga0068861_100196673 Ga0068861_1001966732 365
90 3300005842 Ga0068858_100179646 Ga0068858_1001796462 365
91 3300005843 Ga0068860_100172797 Ga0068860_1001727971 365
92 3300006881 Ga0068865_100022119 Ga0068865_1000221191 365
93 3300009148 Ga0105243_10074138 Ga0105243_100741382 365
94 3300009176 Ga0105242_10026787 Ga0105242_100267872 365
95 3300046460 Ga0495638_0012100 Ga0495638_0012100_859_2079 365
96 3300005334 Ga0068869_100100072 Ga0068869_1001000722 366
97 3300025899 Ga0207642_10032953 Ga0207642_100329532 366
98 3300025903 Ga0207680_10130654 Ga0207680_101306541 366
99 3300025926 Ga0207659_10002655 Ga0207659_100026553 366
100 3300025936 Ga0207670_10066107 Ga0207670_100661072 366
101 3300025937 Ga0207669_10122880 Ga0207669_101228801 366
102 3300025940 Ga0207691_10032030 Ga0207691_100320303 366
103 3300025981 Ga0207640_10064445 Ga0207640_100644451 366
104 3300026023 Ga0207677_10118053 Ga0207677_101180532 366
105 3300026075 Ga0207708_10002731 Ga0207708_100027312 366
106 3300026089 Ga0207648_10009126 Ga0207648_100091269 366
107 3300050492 nmdc:mga0yw44_4508_c1 nmdc:mga0yw44_4508_c1_656_1870 366
108 3300013296 Ga0157374_10288975 Ga0157374_102889752 367
109 3300014325 Ga0163163_10081695 Ga0163163_100816952 367
110 3300049522 Ga0501299_013593 Ga0501299_013593_91_1251 367
111 3300006852 Ga0075433_10003803 Ga0075433_100038037 368
112 3300006852 Ga0075433_10003815 Ga0075433_100038155 368
113 3300006871 Ga0075434_100000793 Ga0075434_10000079310 368
114 3300006871 Ga0075434_100011292 Ga0075434_1000112923 368
115 3300007076 Ga0075435_100010659 Ga0075435_1000106592 368
116 3300049588 Ga0501072_0075677 Ga0501072_0075677_1172_2401 368
117 3300050512 nmdc:mga0n895_1036_c1 nmdc:mga0n895_1036_c1_7922_9142 368
118 3300050512 nmdc:mga0n895_7600_c1 nmdc:mga0n895_7600_c1_6002_7222 368
119 3300050513 nmdc:mga0rr50_84927_c1 nmdc:mga0rr50_84927_c1_911_2131 368
120 3300050515 nmdc:mga0a205_2131_c1 nmdc:mga0a205_2131_c1_9276_10496 368
121 3300050515 nmdc:mga0a205_5851_c1 nmdc:mga0a205_5851_c1_4710_5930 368
122 3300005445 Ga0070708_100004515 Ga0070708_1000045153 369
123 3300005467 Ga0070706_100058775 Ga0070706_1000587752 369
124 3300005471 Ga0070698_100000322 Ga0070698_10000032215 369
125 3300006844 Ga0075428_100000009 Ga0075428_100000009229 369
126 3300009094 Ga0111539_10000010 Ga0111539_100000109 369
127 3300009147 Ga0114129_10371664 Ga0114129_103716642 369
128 3300010375 Ga0105239_10169986 Ga0105239_101699861 369
129 3300025910 Ga0207684_10003471 Ga0207684_1000347110 369
130 3300027907 Ga0207428_10000034 Ga0207428_10000034211 369
131 3300046472 Ga0495580_0070075 Ga0495580_0070075_951_2153 369
132 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_459780_461003 369
133 3300005331 Ga0070670_100012632 Ga0070670_1000126323 370
134 3300005354 Ga0070675_100011211 Ga0070675_1000112114 370
135 3300005364 Ga0070673_100059201 Ga0070673_1000592012 370
136 3300005365 Ga0070688_100071797 Ga0070688_1000717972 370
137 3300005456 Ga0070678_100045347 Ga0070678_1000453472 370
138 3300005468 Ga0070707_100002125 Ga0070707_10000212515 370
139 3300005548 Ga0070665_100221844 Ga0070665_1002218442 370
140 3300005618 Ga0068864_100003915 Ga0068864_10000391510 370
141 3300005841 Ga0068863_100057807 Ga0068863_1000578072 370
142 3300009147 Ga0114129_10059468 Ga0114129_100594683 370
143 3300025910 Ga0207684_10006680 Ga0207684_100066809 370
144 3300025921 Ga0207652_10108300 Ga0207652_101083002 370
145 3300025922 Ga0207646_10010197 Ga0207646_100101975 370
146 3300025940 Ga0207691_10011635 Ga0207691_100116353 370
147 3300026023 Ga0207677_10163702 Ga0207677_101637021 370
148 3300026121 Ga0207683_10024371 Ga0207683_100243714 370
149 3300027552 Ga0209982_1000263 Ga0209982_10002635 370
150 3300027617 Ga0210002_1000304 Ga0210002_10003042 370
151 3300027682 Ga0209971_1000518 Ga0209971_10005187 370
152 3300027876 Ga0209974_10001190 Ga0209974_100011909 370
153 3300031238 Ga0265332_10003471 Ga0265332_100034715 370
154 3300050507 nmdc:mga05p37_77511_c1 nmdc:mga05p37_77511_c1_593_1795 370
155 3300050512 nmdc:mga0n895_39282_c1 nmdc:mga0n895_39282_c1_1678_2880 370
156 3300050515 nmdc:mga0a205_29587_c1 nmdc:mga0a205_29587_c1_2538_3740 370
157 3300005353 Ga0070669_100033354 Ga0070669_1000333542 371
158 3300005438 Ga0070701_10029700 Ga0070701_100297002 371
159 3300005471 Ga0070698_100082568 Ga0070698_1000825682 371
160 3300005518 Ga0070699_100005960 Ga0070699_1000059602 371
161 3300005536 Ga0070697_100147332 Ga0070697_1001473322 371
162 3300005543 Ga0070672_100037301 Ga0070672_1000373012 371
163 3300005578 Ga0068854_100228147 Ga0068854_1002281472 371
164 3300005719 Ga0068861_100022923 Ga0068861_1000229233 371
165 3300005843 Ga0068860_100006066 Ga0068860_1000060665 371
166 3300009094 Ga0111539_10034374 Ga0111539_100343742 371
167 3300009553 Ga0105249_10001364 Ga0105249_100013649 371
168 3300013306 Ga0163162_10002588 Ga0163162_100025887 371
169 3300014968 Ga0157379_10086672 Ga0157379_100866722 371
170 3300025893 Ga0207682_10041702 Ga0207682_100417022 371
171 3300025961 Ga0207712_10061270 Ga0207712_100612702 371
172 3300026088 Ga0207641_10080502 Ga0207641_100805022 371
173 3300026118 Ga0207675_100025235 Ga0207675_1000252352 371
174 3300028381 Ga0268264_10076532 Ga0268264_100765322 371
175 3300042876 Ga0451577_0074670 Ga0451577_0074670_317_1519 371
176 3300045051 Ga0451576_0041185 Ga0451576_0041185_327_1529 371
177 3300048905 Ga0496102_0011424 Ga0496102_0011424_4988_6190 371
178 3300048909 Ga0496106_0005575 Ga0496106_0005575_4916_6118 371
179 3300048910 Ga0496107_0040180 Ga0496107_0040180_1421_2623 371
180 3300048913 Ga0496110_0057501 Ga0496110_0057501_477_1679 371
181 3300049571 Ga0501034_0011759 Ga0501034_0011759_4908_6137 371
182 3300049824 Ga0501045_0053648 Ga0501045_0053648_1546_2766 371
183 3300050507 nmdc:mga05p37_33698_c1 nmdc:mga05p37_33698_c1_622_1824 371
184 3300050511 nmdc:mga08y16_31434_c1 nmdc:mga08y16_31434_c1_679_1872 371
185 3300050513 nmdc:mga0rr50_155870_c1 nmdc:mga0rr50_155870_c1_285_1487 371
186 3300050514 nmdc:mga08x19_177666_c1 nmdc:mga08x19_177666_c1_183_1385 371
187 3300009094 Ga0111539_10001273 Ga0111539_1000127324 372
188 3300046522 Ga0495643_0007165 Ga0495643_0007165_4150_5364 372
189 3300050507 nmdc:mga05p37_114885_c1 nmdc:mga05p37_114885_c1_1689_2906 372
190 3300050511 nmdc:mga08y16_155_c2 nmdc:mga08y16_155_c2_3121_4293 372
191 3300005339 Ga0070660_100119893 Ga0070660_1001198932 373
192 3300005445 Ga0070708_100172852 Ga0070708_1001728522 373
193 3300005467 Ga0070706_100003147 Ga0070706_1000031478 373
194 3300005471 Ga0070698_100067927 Ga0070698_1000679272 373
195 3300005548 Ga0070665_100070301 Ga0070665_1000703012 373
196 3300006852 Ga0075433_10019040 Ga0075433_100190405 373
197 3300006871 Ga0075434_100005293 Ga0075434_1000052933 373
198 3300006914 Ga0075436_100050511 Ga0075436_1000505112 373
199 3300007076 Ga0075435_100012001 Ga0075435_1000120013 373
200 3300009147 Ga0114129_10001071 Ga0114129_1000107129 373
201 3300025910 Ga0207684_10014927 Ga0207684_100149276 373
202 3300026118 Ga0207675_100213581 Ga0207675_1002135812 373
203 3300031616 Ga0307508_10017770 Ga0307508_100177702 373
204 3300032002 Ga0307416_100250702 Ga0307416_1002507022 373
205 3300032005 Ga0307411_10042108 Ga0307411_100421081 373
206 3300048917 Ga0496114_0000015 Ga0496114_0000015_214276_215481 373
207 3300050507 nmdc:mga05p37_3316_c1 nmdc:mga05p37_3316_c1_14490_15692 373
208 3300050512 nmdc:mga0n895_1103_c1 nmdc:mga0n895_1103_c1_17219_18421 373
209 3300050513 nmdc:mga0rr50_23379_c1 nmdc:mga0rr50_23379_c1_1334_2536 373
210 3300050514 nmdc:mga08x19_11786_c1 nmdc:mga08x19_11786_c1_1929_3131 373
211 3300050514 nmdc:mga08x19_46212_c1 nmdc:mga08x19_46212_c1_534_1736 373
212 3300050515 nmdc:mga0a205_4375_c1 nmdc:mga0a205_4375_c1_7734_8936 373
213 3300005340 Ga0070689_100010355 Ga0070689_1000103553 374
214 3300005341 Ga0070691_10020225 Ga0070691_100202252 374
215 3300005343 Ga0070687_100004479 Ga0070687_1000044792 374
216 3300005353 Ga0070669_100012347 Ga0070669_1000123473 374
217 3300005355 Ga0070671_100074366 Ga0070671_1000743661 374
218 3300005364 Ga0070673_100055283 Ga0070673_1000552832 374
219 3300005436 Ga0070713_100037331 Ga0070713_1000373313 374
220 3300005456 Ga0070678_100179795 Ga0070678_1001797952 374
221 3300005544 Ga0070686_100122928 Ga0070686_1001229282 374
222 3300005616 Ga0068852_100150804 Ga0068852_1001508042 374
223 3300005842 Ga0068858_100041065 Ga0068858_1000410652 374
224 3300005843 Ga0068860_100015009 Ga0068860_1000150093 374
225 3300006871 Ga0075434_100275483 Ga0075434_1002754832 374
226 3300007076 Ga0075435_100001996 Ga0075435_1000019968 374
227 3300025904 Ga0207647_10106068 Ga0207647_101060681 374
228 3300025918 Ga0207662_10039473 Ga0207662_100394732 374
229 3300025941 Ga0207711_10011562 Ga0207711_100115623 374
230 3300025942 Ga0207689_10059047 Ga0207689_100590472 374
231 3300025960 Ga0207651_10001198 Ga0207651_100011983 374
232 3300025986 Ga0207658_10002202 Ga0207658_100022022 374
233 3300026121 Ga0207683_10196645 Ga0207683_101966452 374
234 3300028380 Ga0268265_10264729 Ga0268265_102647291 374
235 3300028381 Ga0268264_10020274 Ga0268264_100202745 374
236 3300028381 Ga0268264_10041826 Ga0268264_100418262 374
237 3300031731 Ga0307405_10108016 Ga0307405_101080162 374
238 3300031852 Ga0307410_10094477 Ga0307410_100944772 374
239 3300032126 Ga0307415_100083583 Ga0307415_1000835832 374
240 3300042007 Ga0439449_0015590 Ga0439449_0015590_346_1575 374
241 3300048909 Ga0496106_0083808 Ga0496106_0083808_241_1455 374
242 3300049589 Ga0501073_0069974 Ga0501073_0069974_466_1659 375
243 3300042001 Ga0439441_006446 Ga0439441_006446_571_1794 376
244 3300042125 Ga0450923_002882 Ga0450923_002882_1288_2511 376
245 3300045051 Ga0451576_0007523 Ga0451576_0007523_4184_5419 376
246 3300049582 Ga0501048_0071519 Ga0501048_0071519_559_1779 376
247 3300049592 Ga0501076_0071983 Ga0501076_0071983_1470_2690 376
248 3300005543 Ga0070672_100022846 Ga0070672_1000228464 377
249 3300005617 Ga0068859_100055705 Ga0068859_1000557052 377
250 3300006871 Ga0075434_100030856 Ga0075434_1000308563 377
251 3300006931 Ga0097620_100055705 Ga0097620_1000557053 377
252 3300025923 Ga0207681_10045148 Ga0207681_100451482 377
253 3300049569 Ga0501032_0015511 Ga0501032_0015511_912_2105 377
254 3300049570 Ga0501033_0024327 Ga0501033_0024327_339_1532 377
255 3300049570 Ga0501033_0026186 Ga0501033_0026186_213_1406 377
256 3300049571 Ga0501034_0006629 Ga0501034_0006629_9530_10723 377
257 3300049572 Ga0501036_0002877 Ga0501036_0002877_11201_12394 377
258 3300049572 Ga0501036_0005601 Ga0501036_0005601_1391_2584 377
259 3300049574 Ga0501038_0037113 Ga0501038_0037113_97_1290 377
260 3300049574 Ga0501038_0104819 Ga0501038_0104819_166_1359 377
261 3300049579 Ga0501043_0007985 Ga0501043_0007985_3739_4932 377
262 3300049579 Ga0501043_0028531 Ga0501043_0028531_3057_4250 377
263 3300049580 Ga0501046_0028036 Ga0501046_0028036_1262_2455 377
264 3300049580 Ga0501046_0032608 Ga0501046_0032608_836_2029 377
265 3300049581 Ga0501047_0224337 Ga0501047_0224337_390_1583 377
266 3300049582 Ga0501048_0050096 Ga0501048_0050096_416_1609 377
267 3300049584 Ga0501068_0083685 Ga0501068_0083685_284_1477 377
268 3300049585 Ga0501069_0154997 Ga0501069_0154997_93_1286 377
269 3300049586 Ga0501070_0028592 Ga0501070_0028592_2977_4170 377
270 3300049589 Ga0501073_0012975 Ga0501073_0012975_2036_3229 377
271 3300049741 Ga0501079_0050047 Ga0501079_0050047_240_1433 377
272 3300049742 Ga0501080_0001074 Ga0501080_0001074_15454_16647 377
273 3300049742 Ga0501080_0108958 Ga0501080_0108958_76_1269 377
274 3300049743 Ga0501081_0019833 Ga0501081_0019833_2466_3659 377
275 3300049744 Ga0501083_0075146 Ga0501083_0075146_725_1918 377
276 3300049744 Ga0501083_0086849 Ga0501083_0086849_285_1478 377
277 3300049822 Ga0501035_0008408 Ga0501035_0008408_3872_5065 377
278 3300049822 Ga0501035_0068039 Ga0501035_0068039_416_1609 377
279 3300049823 Ga0501044_0139451 Ga0501044_0139451_435_1628 377
280 3300049823 Ga0501044_0205948 Ga0501044_0205948_405_1598 377
281 3300049824 Ga0501045_0146196 Ga0501045_0146196_379_1572 377
282 3300050512 nmdc:mga0n895_44657_c1 nmdc:mga0n895_44657_c1_760_1974 377
283 3300054114 Ga0501084_0011148 Ga0501084_0011148_3403_4596 377
284 3300060353 Ga0501082_0051481 Ga0501082_0051481_1339_2532 377
285 3300060353 Ga0501082_0139806 Ga0501082_0139806_115_1308 377
286 3300061734 Ga0530510_0029591 Ga0530510_0029591_567_1760 377
287 3300005330 Ga0070690_100004757 Ga0070690_1000047572 378
288 3300005330 Ga0070690_100158570 Ga0070690_1001585702 378
289 3300005618 Ga0068864_100008235 Ga0068864_1000082353 378
290 3300005844 Ga0068862_100003829 Ga0068862_10000382910 378
291 3300007265 Ga0099794_10003993 Ga0099794_100039934 378
292 3300009101 Ga0105247_10006922 Ga0105247_100069224 378
293 3300009147 Ga0114129_10017174 Ga0114129_100171748 378
294 3300009147 Ga0114129_10075190 Ga0114129_100751903 378
295 3300009177 Ga0105248_10001908 Ga0105248_1000190823 378
296 3300009553 Ga0105249_10297588 Ga0105249_102975882 378
297 3300014325 Ga0163163_10012777 Ga0163163_100127774 378
298 3300025900 Ga0207710_10003834 Ga0207710_100038343 378
299 3300025941 Ga0207711_10017948 Ga0207711_100179482 378
300 3300026095 Ga0207676_10024593 Ga0207676_100245932 378
301 3300028380 Ga0268265_10000290 Ga0268265_1000029037 378
302 3300035085 Ga0373929_0000004 Ga0373929_0000004_112323_113528 378
303 3300042876 Ga0451577_0032045 Ga0451577_0032045_1666_2880 378
304 3300048907 Ga0496104_0015018 Ga0496104_0015018_302_1525 378
305 3300048915 Ga0496112_0000483 Ga0496112_0000483_14151_15374 378
306 3300049575 Ga0501039_0125559 Ga0501039_0125559_465_1685 378
307 3300049578 Ga0501042_0017229 Ga0501042_0017229_1893_3113 378
308 3300049591 Ga0501075_0165331 Ga0501075_0165331_245_1465 378
309 3300049592 Ga0501076_0011649 Ga0501076_0011649_959_2179 378
310 3300050507 nmdc:mga05p37_10462_c1 nmdc:mga05p37_10462_c1_7647_8861 378
311 3300006847 Ga0075431_100069933 Ga0075431_1000699333 379
312 3300042436 Ga0439435_0007652 Ga0439435_0007652_58_1278 379
313 3300050510 nmdc:mga06r32_8229_c1 nmdc:mga06r32_8229_c1_1520_2740 379
314 3300005340 Ga0070689_100004907 Ga0070689_1000049076 380
315 3300005518 Ga0070699_100007545 Ga0070699_1000075453 380
316 3300005981 Ga0081538_10018514 Ga0081538_100185142 380
317 3300025905 Ga0207685_10077819 Ga0207685_100778191 380
318 3300035241 Ga0373961_0000039 Ga0373961_0000039_11091_12290 380
319 3300049568 Ga0501031_0000508 Ga0501031_0000508_6149_7342 380
320 3300049569 Ga0501032_0019991 Ga0501032_0019991_2455_3648 380
321 3300049570 Ga0501033_0032486 Ga0501033_0032486_1191_2384 380
322 3300049572 Ga0501036_0001163 Ga0501036_0001163_7796_8989 380
323 3300049574 Ga0501038_0000812 Ga0501038_0000812_19765_20958 380
324 3300049575 Ga0501039_0005297 Ga0501039_0005297_7774_8967 380
325 3300049575 Ga0501039_0183285 Ga0501039_0183285_244_1452 380
326 3300049578 Ga0501042_0011778 Ga0501042_0011778_2054_3247 380
327 3300049579 Ga0501043_0020347 Ga0501043_0020347_1739_2932 380
328 3300049580 Ga0501046_0026347 Ga0501046_0026347_3167_4360 380
329 3300049582 Ga0501048_0002661 Ga0501048_0002661_11070_12263 380
330 3300049583 Ga0501067_0000428 Ga0501067_0000428_20233_21426 380
331 3300049584 Ga0501068_0004719 Ga0501068_0004719_1207_2400 380
332 3300049585 Ga0501069_0001161 Ga0501069_0001161_9980_11173 380
333 3300049587 Ga0501071_0036105 Ga0501071_0036105_966_2159 380
334 3300049590 Ga0501074_0010561 Ga0501074_0010561_4514_5707 380
335 3300049822 Ga0501035_0041928 Ga0501035_0041928_792_1985 380
336 3300049823 Ga0501044_0182983 Ga0501044_0182983_840_2033 380
337 3300054114 Ga0501084_0097801 Ga0501084_0097801_311_1504 380
338 3300060353 Ga0501082_0003446 Ga0501082_0003446_4795_5988 380
339 3300005329 Ga0070683_100069411 Ga0070683_1000694112 381
340 3300005354 Ga0070675_100081447 Ga0070675_1000814472 381
341 3300005364 Ga0070673_100053642 Ga0070673_1000536421 381
342 3300005535 Ga0070684_100037279 Ga0070684_1000372793 381
343 3300005564 Ga0070664_100003698 Ga0070664_1000036987 381
344 3300006846 Ga0075430_100041836 Ga0075430_1000418362 381
345 3300006880 Ga0075429_100024700 Ga0075429_1000247002 381
346 3300009094 Ga0111539_10000614 Ga0111539_1000061438 381
347 3300025944 Ga0207661_10023551 Ga0207661_100235513 381
348 3300025945 Ga0207679_10026902 Ga0207679_100269022 381
349 3300027907 Ga0207428_10000570 Ga0207428_1000057044 381
350 3300050509 nmdc:mga0qj67_52275_c1 nmdc:mga0qj67_52275_c1_1767_2984 381
351 3300050510 nmdc:mga06r32_318545_c1 nmdc:mga06r32_318545_c1_114_1331 381
352 3300050511 nmdc:mga08y16_920_c1 nmdc:mga08y16_920_c1_478_1695 381
353 3300006846 Ga0075430_100032145 Ga0075430_1000321453 382
354 3300009176 Ga0105242_10022195 Ga0105242_100221953 382
355 3300045051 Ga0451576_0177552 Ga0451576_0177552_985_2199 382
356 3300048903 Ga0496100_0005177 Ga0496100_0005177_3806_5038 382
357 3300048904 Ga0496101_0000634 Ga0496101_0000634_16919_18151 382
358 3300048907 Ga0496104_0013068 Ga0496104_0013068_2069_3301 382
359 3300048909 Ga0496106_0067530 Ga0496106_0067530_126_1358 382
360 3300048917 Ga0496114_0001934 Ga0496114_0001934_13046_14278 382
361 3300049582 Ga0501048_0094885 Ga0501048_0094885_675_1889 382
362 3300050510 nmdc:mga06r32_39236_c1 nmdc:mga06r32_39236_c1_3177_4397 382
363 3300053103 Ga0500555_000371 Ga0500555_000371_3550_4779 384
364 3300053730 Ga0500645_000077 Ga0500645_000077_54187_55416 384
365 3300025315 Ga0207697_10008193 Ga0207697_100081933 385
366 3300025901 Ga0207688_10013595 Ga0207688_100135952 385
367 3300005366 Ga0070659_100252510 Ga0070659_1002525101 386
368 3300005834 Ga0068851_10040669 Ga0068851_100406692 386
369 3300006844 Ga0075428_100001308 Ga0075428_1000013089 386
370 3300006847 Ga0075431_100022794 Ga0075431_1000227944 386
371 3300006880 Ga0075429_100089882 Ga0075429_1000898822 386
372 3300028573 Ga0265334_10007738 Ga0265334_100077383 386
373 3300028800 Ga0265338_10008655 Ga0265338_100086553 386
374 3300028800 Ga0265338_10022525 Ga0265338_100225253 386
375 3300031595 Ga0265313_10071102 Ga0265313_100711022 386
376 3300048910 Ga0496107_0027063 Ga0496107_0027063_2270_3484 386
377 3300049568 Ga0501031_0131389 Ga0501031_0131389_325_1533 386
378 3300049570 Ga0501033_0048885 Ga0501033_0048885_1740_2948 386
379 3300049572 Ga0501036_0293242 Ga0501036_0293242_62_1270 386
380 3300049577 Ga0501041_0005425 Ga0501041_0005425_4514_5722 386
381 3300049580 Ga0501046_0040103 Ga0501046_0040103_2449_3657 386
382 3300049591 Ga0501075_0008288 Ga0501075_0008288_849_2057 386
383 3300049592 Ga0501076_0000650 Ga0501076_0000650_16035_17243 386
384 3300049743 Ga0501081_0008083 Ga0501081_0008083_500_1708 386
385 3300060353 Ga0501082_0003440 Ga0501082_0003440_6541_7749 386
386 3300061734 Ga0530510_0000180 Ga0530510_0000180_14308_15516 386
387 3300061734 Ga0530510_0004323 Ga0530510_0004323_4056_5264 386
388 3300061734 Ga0530510_0017455 Ga0530510_0017455_2717_3925 386
389 3300005290 Ga0065712_10000349 Ga0065712_100003493 387
390 3300005290 Ga0065712_10002429 Ga0065712_100024294 387
391 3300005290 Ga0065712_10068107 Ga0065712_100681073 387
392 3300005290 Ga0065712_10123309 Ga0065712_101233091 387
393 3300005293 Ga0065715_10117232 Ga0065715_101172322 387
394 3300005329 Ga0070683_100000203 Ga0070683_10000020311 387
395 3300005331 Ga0070670_100011412 Ga0070670_1000114125 387
396 3300005331 Ga0070670_100022465 Ga0070670_1000224653 387
397 3300005340 Ga0070689_100012551 Ga0070689_1000125512 387
398 3300005340 Ga0070689_100046186 Ga0070689_1000461863 387
399 3300005343 Ga0070687_100039923 Ga0070687_1000399232 387
400 3300005353 Ga0070669_100146683 Ga0070669_1001466832 387
401 3300005354 Ga0070675_100012322 Ga0070675_1000123225 387
402 3300005354 Ga0070675_100029575 Ga0070675_1000295752 387
403 3300005354 Ga0070675_100141271 Ga0070675_1001412712 387
404 3300005365 Ga0070688_100053996 Ga0070688_1000539962 387
405 3300005365 Ga0070688_100151224 Ga0070688_1001512242 387
406 3300005434 Ga0070709_10000004 Ga0070709_1000000437 387
407 3300005444 Ga0070694_100121000 Ga0070694_1001210001 387
408 3300005455 Ga0070663_100070786 Ga0070663_1000707862 387
409 3300005466 Ga0070685_10065742 Ga0070685_100657422 387
410 3300005535 Ga0070684_100001546 Ga0070684_10000154611 387
411 3300005564 Ga0070664_100001490 Ga0070664_1000014903 387
412 3300005564 Ga0070664_100014767 Ga0070664_1000147673 387
413 3300005564 Ga0070664_100016160 Ga0070664_1000161606 387
414 3300005617 Ga0068859_100133272 Ga0068859_1001332722 387
415 3300005618 Ga0068864_100010959 Ga0068864_1000109593 387
416 3300005719 Ga0068861_100046899 Ga0068861_1000468992 387
417 3300006028 Ga0070717_10027169 Ga0070717_100271693 387
418 3300006042 Ga0075368_10041179 Ga0075368_100411792 387
419 3300006051 Ga0075364_10037185 Ga0075364_100371852 387
420 3300006051 Ga0075364_10048406 Ga0075364_100484062 387
421 3300006051 Ga0075364_10061741 Ga0075364_100617412 387
422 3300006195 Ga0075366_10024198 Ga0075366_100241983 387
423 3300006353 Ga0075370_10047451 Ga0075370_100474512 387
424 3300006358 Ga0068871_100136422 Ga0068871_1001364222 387
425 3300006358 Ga0068871_100222792 Ga0068871_1002227922 387
426 3300006844 Ga0075428_100007578 Ga0075428_1000075789 387
427 3300006844 Ga0075428_100323847 Ga0075428_1003238472 387
428 3300006846 Ga0075430_100004652 Ga0075430_1000046525 387
429 3300006846 Ga0075430_100035849 Ga0075430_1000358493 387
430 3300006846 Ga0075430_100073036 Ga0075430_1000730362 387
431 3300006846 Ga0075430_100074030 Ga0075430_1000740302 387
432 3300006880 Ga0075429_100011412 Ga0075429_1000114127 387
433 3300006880 Ga0075429_100046131 Ga0075429_1000461312 387
434 3300006880 Ga0075429_100087113 Ga0075429_1000871132 387
435 3300006931 Ga0097620_100133276 Ga0097620_1001332762 387
436 3300009094 Ga0111539_10001499 Ga0111539_1000149914 387
437 3300009094 Ga0111539_10017253 Ga0111539_100172537 387
438 3300009147 Ga0114129_10001896 Ga0114129_1000189611 387
439 3300009147 Ga0114129_10035687 Ga0114129_100356875 387
440 3300009177 Ga0105248_10133698 Ga0105248_101336983 387
441 3300009177 Ga0105248_10316677 Ga0105248_103166771 387
442 3300013306 Ga0163162_10012854 Ga0163162_100128547 387
443 3300014325 Ga0163163_10011765 Ga0163163_100117653 387
444 3300014325 Ga0163163_10059247 Ga0163163_100592472 387
445 3300014326 Ga0157380_10023242 Ga0157380_100232423 387
446 3300017792 Ga0163161_10079782 Ga0163161_100797822 387
447 3300025906 Ga0207699_10000033 Ga0207699_100000338 387
448 3300025906 Ga0207699_10103991 Ga0207699_101039912 387
449 3300025918 Ga0207662_10032297 Ga0207662_100322972 387
450 3300025924 Ga0207694_10236881 Ga0207694_102368812 387
451 3300025925 Ga0207650_10000718 Ga0207650_1000071826 387
452 3300025925 Ga0207650_10025684 Ga0207650_100256842 387
453 3300025926 Ga0207659_10007467 Ga0207659_100074675 387
454 3300025926 Ga0207659_10011579 Ga0207659_100115794 387
455 3300025936 Ga0207670_10012943 Ga0207670_100129433 387
456 3300025936 Ga0207670_10029105 Ga0207670_100291053 387
457 3300025937 Ga0207669_10032390 Ga0207669_100323901 387
458 3300025939 Ga0207665_10058035 Ga0207665_100580352 387
459 3300025940 Ga0207691_10022964 Ga0207691_100229643 387
460 3300025941 Ga0207711_10105099 Ga0207711_101050992 387
461 3300025945 Ga0207679_10007637 Ga0207679_100076374 387
462 3300025945 Ga0207679_10045123 Ga0207679_100451232 387
463 3300025960 Ga0207651_10054779 Ga0207651_100547792 387
464 3300025960 Ga0207651_10225586 Ga0207651_102255862 387
465 3300025961 Ga0207712_10132664 Ga0207712_101326641 387
466 3300025986 Ga0207658_10132144 Ga0207658_101321442 387
467 3300026067 Ga0207678_10058979 Ga0207678_100589793 387
468 3300026067 Ga0207678_10088527 Ga0207678_100885272 387
469 3300026088 Ga0207641_10127587 Ga0207641_101275872 387
470 3300026118 Ga0207675_100040153 Ga0207675_1000401533 387
471 3300026121 Ga0207683_10064552 Ga0207683_100645522 387
472 3300026121 Ga0207683_10068439 Ga0207683_100684391 387
473 3300027866 Ga0209813_10026648 Ga0209813_100266482 387
474 3300027907 Ga0207428_10001339 Ga0207428_1000133917 387
475 3300027907 Ga0207428_10003549 Ga0207428_100035492 387
476 3300027907 Ga0207428_10263849 Ga0207428_102638491 387
477 3300028379 Ga0268266_10191277 Ga0268266_101912771 387
478 3300031548 Ga0307408_100018424 Ga0307408_1000184241 387
479 3300031548 Ga0307408_100025455 Ga0307408_1000254553 387
480 3300031548 Ga0307408_100029643 Ga0307408_1000296432 387
481 3300031548 Ga0307408_100040604 Ga0307408_1000406042 387
482 3300031548 Ga0307408_100146285 Ga0307408_1001462851 387
483 3300031731 Ga0307405_10007822 Ga0307405_100078222 387
484 3300031911 Ga0307412_10152489 Ga0307412_101524892 387
485 3300031911 Ga0307412_10230731 Ga0307412_102307312 387
486 3300032002 Ga0307416_100023912 Ga0307416_1000239123 387
487 3300032002 Ga0307416_100026377 Ga0307416_1000263773 387
488 3300032004 Ga0307414_10122182 Ga0307414_101221821 387
489 3300032005 Ga0307411_10130261 Ga0307411_101302611 387
490 3300032126 Ga0307415_100018358 Ga0307415_1000183583 387
491 3300032126 Ga0307415_100060229 Ga0307415_1000602292 387
492 3300041997 Ga0439431_0019294 Ga0439431_0019294_315_1541 387
493 3300042125 Ga0450923_012237 Ga0450923_012237_317_1534 387
494 3300042156 Ga0439446_0015161 Ga0439446_0015161_149_1360 387
495 3300042439 Ga0439464_0003824 Ga0439464_0003824_1509_2729 387
496 3300044673 Ga0453683_0002530 Ga0453683_0002530_8362_9573 387
497 3300046537 Ga0495598_0009992 Ga0495598_0009992_491_1705 387
498 3300046558 Ga0495633_0025839 Ga0495633_0025839_30_1244 387
499 3300046691 Ga0495670_0018723 Ga0495670_0018723_28_1230 387
500 3300048907 Ga0496104_0012730 Ga0496104_0012730_1730_2953 387
501 3300048907 Ga0496104_0083221 Ga0496104_0083221_1780_2991 387
502 3300048908 Ga0496105_0014566 Ga0496105_0014566_3021_4244 387
503 3300048911 Ga0496108_0004110 Ga0496108_0004110_10194_11417 387
504 3300048912 Ga0496109_0002990 Ga0496109_0002990_10885_12108 387
505 3300048912 Ga0496109_0071626 Ga0496109_0071626_360_1574 387
506 3300048913 Ga0496110_0002419 Ga0496110_0002419_1596_2819 387
507 3300048914 Ga0496111_0011863 Ga0496111_0011863_1584_2807 387
508 3300048915 Ga0496112_0002222 Ga0496112_0002222_522_1745 387
509 3300048915 Ga0496112_0050765 Ga0496112_0050765_25_1236 387
510 3300049578 Ga0501042_0039681 Ga0501042_0039681_1880_3106 387
511 3300049592 Ga0501076_0066726 Ga0501076_0066726_1476_2696 387
512 3300050491 nmdc:mga00v17_10736_c1 nmdc:mga00v17_10736_c1_1827_3044 387
513 3300050491 nmdc:mga00v17_141707_c1 nmdc:mga00v17_141707_c1_190_1407 387
514 3300050491 nmdc:mga00v17_79221_c1 nmdc:mga00v17_79221_c1_409_1626 387
515 3300050493 nmdc:mga0k408_21200_c1 nmdc:mga0k408_21200_c1_1692_2909 387
516 3300050493 nmdc:mga0k408_24263_c1 nmdc:mga0k408_24263_c1_125_1342 387
517 3300050493 nmdc:mga0k408_60724_c1 nmdc:mga0k408_60724_c1_188_1405 387
518 3300050494 nmdc:mga06z11_58517_c1 nmdc:mga06z11_58517_c1_555_1772 387
519 3300050496 nmdc:mga07m45_95806_c1 nmdc:mga07m45_95806_c1_187_1404 387
520 3300050507 nmdc:mga05p37_151524_c1 nmdc:mga05p37_151524_c1_256_1476 387
521 3300050507 nmdc:mga05p37_2147_c1 nmdc:mga05p37_2147_c1_9423_10643 387
522 3300050508 nmdc:mga09592_78909_c1 nmdc:mga09592_78909_c1_1369_2583 387
523 3300050509 nmdc:mga0qj67_13657_c1 nmdc:mga0qj67_13657_c1_2690_3910 387
524 3300050509 nmdc:mga0qj67_255561_c1 nmdc:mga0qj67_255561_c1_159_1364 387
525 3300050511 nmdc:mga08y16_2034_c1 nmdc:mga08y16_2034_c1_3760_4968 387
526 3300050511 nmdc:mga08y16_24858_c1 nmdc:mga08y16_24858_c1_1181_2401 387
527 3300050511 nmdc:mga08y16_350825_c1 nmdc:mga08y16_350825_c1_240_1454 387
528 3300050511 nmdc:mga08y16_69414_c1 nmdc:mga08y16_69414_c1_1030_2238 387
529 3300050512 nmdc:mga0n895_86258_c1 nmdc:mga0n895_86258_c1_15_1229 387
530 3300050514 nmdc:mga08x19_136927_c1 nmdc:mga08x19_136927_c1_139_1344 387
531 3300050515 nmdc:mga0a205_173549_c1 nmdc:mga0a205_173549_c1_314_1528 387
532 3300050515 nmdc:mga0a205_6238_c1 nmdc:mga0a205_6238_c1_1173_2393 387
533 3300053096 Ga0500641_0000969 Ga0500641_0000969_2849_4084 387
534 3300053139 Ga0500568_0001537 Ga0500568_0001537_13178_14407 387
535 3300059421 Ga0590071_000176 Ga0590071_000176_14967_16184 387
536 3300059421 Ga0590071_003126 Ga0590071_003126_1193_2410 387
537 3300059423 Ga0590074_001881 Ga0590074_001881_1116_2333 387
538 3300059424 Ga0590075_003385 Ga0590075_003385_1616_2833 387
539 3300059424 Ga0590075_007681 Ga0590075_007681_95_1318 387
540 3300059426 Ga0590077_000578 Ga0590077_000578_7736_8953 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

280

402

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

77

200

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9708 45 145
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9606 45 152
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.96 46 145
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.9585 45 150
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9448 40 149
ID Description Score Start End Superfamily
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9708 45 145 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9565 251 353 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9413 242 348 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9411 47 153 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9344 45 145 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A2H0FJC4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.932 212 331 GO:0005886
AF-X1H9D7-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9205 69 291 GO:0005886
GO:0015628
AF-A0A136KH02-F1-model_v4 Type II secretion system protein F 0.9168 60 318 GO:0005886
AF-A0A4V1T455-F1-model_v4 deleted 0.9135 173 355
AF-A0A1C5QWV3-F1-model_v4 Cholera toxin secretion protein epsF 0.9068 101 386 GO:0005886

Feature Viewer

pLDDT pTM Quality
80.38 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map