F461059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 538 | 307 | 536 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0043292|Ga0495672_0043292_101_1036 |
| Length | 311 |
| Sequence | MVGLLCGQHPYTTGPAAPISRRDEQDFAQDFSQATAPERHPMSDSLYSNYQRLRFDRPHPRVLRVTIDNPGKKNSIDEVMHPEMVRVWHDISYDDSVAAVILTGAGDAFCAGGNFEMVQQMVENHEMRMKNLREARDVVYNMINCTKPIISAVRGPAVGGGLVCALMSDISIVSKTARLIDGHTRLGLAAGDHAAIIWPLLCGMARAKYHLLMCTTITGEEAERIGLVSMAVEDSELDGKAVEIASTLADGPPTAIRLTKYTMNHWLRMAAPIFDASLAFEFHAFTGPELKEGMAAIKERRKPVFPVHSAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 192 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 193 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 200 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 295 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 296 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 298 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 302 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 307 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.42 |
| Nodule | 0 |
| Rhizoplane | 3.72 |
| Rhizosphere | 89.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011937 | 3300001979 | Bacteria | 3290 |
| 2 | JGI24739J22299_10001070 | 3300001989 | Bacteria | 10191 |
| 3 | JGI24737J22298_10029437 | 3300001990 | Bacteria | 1722 |
| 4 | JGI24743J22301_10016923 | 3300001991 | Bacteria | 1364 |
| 5 | JGI24735J21928_10019519 | 3300002067 | Bacteria | 2083 |
| 6 | Ga0065707_10189649 | 3300005295 | Bacteria | 1369 |
| 7 | Ga0070658_10282165 | 3300005327 | Bacteria | 1414 |
| 8 | Ga0070658_10355131 | 3300005327 | Bacteria | 1255 |
| 9 | Ga0070676_10074423 | 3300005328 | Bacteria | 2046 |
| 10 | Ga0070683_100081901 | 3300005329 | Bacteria | 3022 |
| 11 | Ga0070683_100416377 | 3300005329 | Bacteria | 1282 |
| 12 | Ga0070670_100005792 | 3300005331 | Bacteria | 10442 |
| 13 | Ga0070670_100105190 | 3300005331 | Bacteria | 2431 |
| 14 | Ga0070670_100106297 | 3300005331 | Bacteria | 2418 |
| 15 | Ga0070677_10041197 | 3300005333 | Bacteria | 1822 |
| 16 | Ga0068869_100098129 | 3300005334 | Bacteria | 2213 |
| 17 | Ga0070666_10148035 | 3300005335 | Bacteria | 1637 |
| 18 | Ga0070680_100258737 | 3300005336 | Bacteria | 1472 |
| 19 | Ga0070682_100117882 | 3300005337 | Bacteria | 1778 |
| 20 | Ga0070660_100059514 | 3300005339 | Bacteria | 2962 |
| 21 | Ga0070660_100151508 | 3300005339 | Bacteria | 1865 |
| 22 | Ga0070660_100341236 | 3300005339 | Bacteria | 1233 |
| 23 | Ga0070661_100384157 | 3300005344 | Bacteria | 1107 |
| 24 | Ga0070692_10043979 | 3300005345 | Bacteria | 2299 |
| 25 | Ga0070668_100087441 | 3300005347 | Bacteria | 2452 |
| 26 | Ga0070669_100012661 | 3300005353 | Bacteria | 5987 |
| 27 | Ga0070675_100017989 | 3300005354 | Bacteria | 5624 |
| 28 | Ga0070675_100123479 | 3300005354 | Bacteria | 2201 |
| 29 | Ga0070675_100172049 | 3300005354 | Bacteria | 1868 |
| 30 | Ga0070671_100000668 | 3300005355 | Bacteria | 24571 |
| 31 | Ga0070671_100094667 | 3300005355 | Bacteria | 2504 |
| 32 | Ga0070671_100272069 | 3300005355 | Bacteria | 1440 |
| 33 | Ga0070671_100377399 | 3300005355 | Bacteria | 1211 |
| 34 | Ga0070674_100013196 | 3300005356 | Bacteria | 5100 |
| 35 | Ga0070674_100408269 | 3300005356 | Bacteria | 1111 |
| 36 | Ga0070659_100168845 | 3300005366 | Bacteria | 1791 |
| 37 | Ga0070659_100464721 | 3300005366 | Bacteria | 1075 |
| 38 | Ga0070667_100051540 | 3300005367 | Bacteria | 3470 |
| 39 | Ga0070667_100129568 | 3300005367 | Bacteria | 2201 |
| 40 | Ga0070667_100223219 | 3300005367 | Bacteria | 1678 |
| 41 | Ga0070709_10059343 | 3300005434 | Bacteria | 2429 |
| 42 | Ga0070714_100340997 | 3300005435 | Bacteria | 1406 |
| 43 | Ga0070713_100035696 | 3300005436 | Bacteria | 4005 |
| 44 | Ga0070713_100041435 | 3300005436 | Bacteria | 3751 |
| 45 | Ga0070710_10005767 | 3300005437 | Bacteria | 5899 |
| 46 | Ga0070711_100038006 | 3300005439 | Bacteria | 3233 |
| 47 | Ga0070711_100131209 | 3300005439 | Bacteria | 1866 |
| 48 | Ga0070700_100004767 | 3300005441 | Bacteria | 7114 |
| 49 | Ga0070700_100074711 | 3300005441 | Bacteria | 2172 |
| 50 | Ga0070700_100271981 | 3300005441 | Bacteria | 1224 |
| 51 | Ga0070708_100118886 | 3300005445 | Bacteria | 2435 |
| 52 | Ga0070663_100076663 | 3300005455 | Bacteria | 2445 |
| 53 | Ga0070662_100009490 | 3300005457 | Bacteria | 6367 |
| 54 | Ga0070681_10242648 | 3300005458 | Bacteria | 1715 |
| 55 | Ga0068867_100092559 | 3300005459 | Bacteria | 2296 |
| 56 | Ga0068867_100188668 | 3300005459 | Bacteria | 1644 |
| 57 | Ga0070706_100016067 | 3300005467 | Bacteria | 6913 |
| 58 | Ga0070706_100405989 | 3300005467 | Bacteria | 1268 |
| 59 | Ga0070698_100070901 | 3300005471 | Bacteria | 3496 |
| 60 | Ga0070698_100181896 | 3300005471 | Bacteria | 2040 |
| 61 | Ga0070698_100697713 | 3300005471 | Bacteria | 957 |
| 62 | Ga0070699_100054655 | 3300005518 | Bacteria | 3456 |
| 63 | Ga0070679_100110802 | 3300005530 | Bacteria | 2731 |
| 64 | Ga0070684_100029369 | 3300005535 | Bacteria | 4659 |
| 65 | Ga0070697_100024841 | 3300005536 | Bacteria | 4772 |
| 66 | Ga0068853_100023049 | 3300005539 | Bacteria | 5208 |
| 67 | Ga0070686_100063806 | 3300005544 | Bacteria | 2387 |
| 68 | Ga0070696_100469746 | 3300005546 | Bacteria | 996 |
| 69 | Ga0070665_100010270 | 3300005548 | Bacteria | 9473 |
| 70 | Ga0070665_100041262 | 3300005548 | Bacteria | 4638 |
| 71 | Ga0070665_100156180 | 3300005548 | Bacteria | 2283 |
| 72 | Ga0068855_100007104 | 3300005563 | Bacteria | 13588 |
| 73 | Ga0068855_100087012 | 3300005563 | Bacteria | 3612 |
| 74 | Ga0068855_100452001 | 3300005563 | Bacteria | 1402 |
| 75 | Ga0068857_100002731 | 3300005577 | Bacteria | 14479 |
| 76 | Ga0068856_100165585 | 3300005614 | Bacteria | 2222 |
| 77 | Ga0068856_100363491 | 3300005614 | Bacteria | 1466 |
| 78 | Ga0068852_100508354 | 3300005616 | Bacteria | 1201 |
| 79 | Ga0068859_100164123 | 3300005617 | Bacteria | 2300 |
| 80 | Ga0068864_100069037 | 3300005618 | Bacteria | 3072 |
| 81 | Ga0068864_100171841 | 3300005618 | Bacteria | 1976 |
| 82 | Ga0068866_10319939 | 3300005718 | Bacteria | 975 |
| 83 | Ga0068861_100009730 | 3300005719 | Bacteria | 6648 |
| 84 | Ga0068861_100619764 | 3300005719 | Bacteria | 995 |
| 85 | Ga0068851_10002665 | 3300005834 | Bacteria | 7868 |
| 86 | Ga0068870_10112520 | 3300005840 | Bacteria | 1556 |
| 87 | Ga0068863_100007247 | 3300005841 | Bacteria | 10867 |
| 88 | Ga0068858_100001501 | 3300005842 | Bacteria | 24053 |
| 89 | Ga0068860_100000887 | 3300005843 | Bacteria | 33240 |
| 90 | Ga0068862_100021059 | 3300005844 | Bacteria | 5449 |
| 91 | Ga0068862_100021685 | 3300005844 | Bacteria | 5372 |
| 92 | Ga0068862_100153892 | 3300005844 | Bacteria | 2048 |
| 93 | Ga0081455_10000811 | 3300005937 | Bacteria | 40225 |
| 94 | Ga0081455_10005965 | 3300005937 | Bacteria | 13211 |
| 95 | Ga0081540_1002187 | 3300005983 | Bacteria | 16167 |
| 96 | Ga0070717_10007579 | 3300006028 | Bacteria | 8064 |
| 97 | Ga0070717_10264506 | 3300006028 | Bacteria | 1522 |
| 98 | Ga0070717_10446103 | 3300006028 | Bacteria | 1166 |
| 99 | Ga0075365_10267011 | 3300006038 | Bacteria | 1203 |
| 100 | Ga0075365_10356144 | 3300006038 | Bacteria | 1032 |
| 101 | Ga0070715_10001047 | 3300006163 | Bacteria | 7809 |
| 102 | Ga0070716_100072554 | 3300006173 | Bacteria | 2027 |
| 103 | Ga0070712_100294553 | 3300006175 | Bacteria | 1311 |
| 104 | Ga0097621_100274829 | 3300006237 | Bacteria | 1481 |
| 105 | Ga0068871_100004129 | 3300006358 | Bacteria | 10043 |
| 106 | Ga0075428_100057649 | 3300006844 | Bacteria | 4252 |
| 107 | Ga0075428_100138237 | 3300006844 | Bacteria | 2649 |
| 108 | Ga0075428_100224136 | 3300006844 | Bacteria | 2030 |
| 109 | Ga0075430_100022060 | 3300006846 | Bacteria | 5412 |
| 110 | Ga0075430_100152968 | 3300006846 | Bacteria | 1921 |
| 111 | Ga0075430_100407287 | 3300006846 | Bacteria | 1122 |
| 112 | Ga0075431_100024205 | 3300006847 | Bacteria | 6218 |
| 113 | Ga0075431_100034351 | 3300006847 | Bacteria | 5224 |
| 114 | Ga0075431_100088529 | 3300006847 | Bacteria | 3195 |
| 115 | Ga0075434_100041044 | 3300006871 | Bacteria | 4583 |
| 116 | Ga0075429_100010864 | 3300006880 | Bacteria | 7874 |
| 117 | Ga0075429_100204237 | 3300006880 | Bacteria | 1731 |
| 118 | Ga0097620_100164122 | 3300006931 | Bacteria | 2300 |
| 119 | Ga0075435_100025640 | 3300007076 | Bacteria | 4591 |
| 120 | Ga0105251_10049031 | 3300009011 | Bacteria | 2023 |
| 121 | Ga0105240_10014186 | 3300009093 | Bacteria | 10883 |
| 122 | Ga0105240_10020530 | 3300009093 | Bacteria | 8807 |
| 123 | Ga0105240_10027626 | 3300009093 | Bacteria | 7428 |
| 124 | Ga0105240_10044218 | 3300009093 | Bacteria | 5662 |
| 125 | Ga0105240_10078202 | 3300009093 | Bacteria | 4074 |
| 126 | Ga0105240_10130864 | 3300009093 | Bacteria | 3010 |
| 127 | Ga0105240_10402485 | 3300009093 | Bacteria | 1541 |
| 128 | Ga0105240_10528113 | 3300009093 | Bacteria | 1309 |
| 129 | Ga0111539_10183863 | 3300009094 | Bacteria | 2441 |
| 130 | Ga0111539_10235839 | 3300009094 | Bacteria | 2130 |
| 131 | Ga0111539_10364783 | 3300009094 | Bacteria | 1681 |
| 132 | Ga0111539_10537157 | 3300009094 | Bacteria | 1362 |
| 133 | Ga0105247_10117351 | 3300009101 | Bacteria | 1720 |
| 134 | Ga0114129_10033312 | 3300009147 | Bacteria | 7280 |
| 135 | Ga0114129_10046783 | 3300009147 | Bacteria | 6079 |
| 136 | Ga0114129_10049896 | 3300009147 | Bacteria | 5879 |
| 137 | Ga0114129_10153397 | 3300009147 | Bacteria | 3152 |
| 138 | Ga0114129_10175480 | 3300009147 | Bacteria | 2919 |
| 139 | Ga0114129_10569614 | 3300009147 | Bacteria | 1471 |
| 140 | Ga0114129_11184753 | 3300009147 | Bacteria | 952 |
| 141 | Ga0105243_10005348 | 3300009148 | Bacteria | 10021 |
| 142 | Ga0105243_10310460 | 3300009148 | Bacteria | 1433 |
| 143 | Ga0105241_10439816 | 3300009174 | Bacteria | 1151 |
| 144 | Ga0105248_10100766 | 3300009177 | Bacteria | 3255 |
| 145 | Ga0105248_10188225 | 3300009177 | Bacteria | 2326 |
| 146 | Ga0105237_10005308 | 3300009545 | Bacteria | 14575 |
| 147 | Ga0105237_10116168 | 3300009545 | Bacteria | 2669 |
| 148 | Ga0105237_10140252 | 3300009545 | Bacteria | 2411 |
| 149 | Ga0105237_10211517 | 3300009545 | Bacteria | 1939 |
| 150 | Ga0105238_10000267 | 3300009551 | Bacteria | 58437 |
| 151 | Ga0105238_10008830 | 3300009551 | Bacteria | 10082 |
| 152 | Ga0105238_10014255 | 3300009551 | Bacteria | 8037 |
| 153 | Ga0105238_10022006 | 3300009551 | Bacteria | 6497 |
| 154 | Ga0105238_10060087 | 3300009551 | Bacteria | 3807 |
| 155 | Ga0105238_10136793 | 3300009551 | Bacteria | 2428 |
| 156 | Ga0105238_10314051 | 3300009551 | Bacteria | 1552 |
| 157 | Ga0105238_10355486 | 3300009551 | Bacteria | 1454 |
| 158 | Ga0105238_10506972 | 3300009551 | Bacteria | 1208 |
| 159 | Ga0105238_10623519 | 3300009551 | Bacteria | 1087 |
| 160 | Ga0105249_10093109 | 3300009553 | Bacteria | 2822 |
| 161 | Ga0105249_10162886 | 3300009553 | Bacteria | 2157 |
| 162 | Ga0105239_10009260 | 3300010375 | Bacteria | 11132 |
| 163 | Ga0105239_10013296 | 3300010375 | Bacteria | 9147 |
| 164 | Ga0105246_10073623 | 3300011119 | Bacteria | 2412 |
| 165 | Ga0157373_10206741 | 3300013100 | Bacteria | 1384 |
| 166 | Ga0157370_10010331 | 3300013104 | Bacteria | 9849 |
| 167 | Ga0157370_10040162 | 3300013104 | Bacteria | 4518 |
| 168 | Ga0157369_10000857 | 3300013105 | Bacteria | 38789 |
| 169 | Ga0157369_10163011 | 3300013105 | Bacteria | 2352 |
| 170 | Ga0157374_10346424 | 3300013296 | Bacteria | 1476 |
| 171 | Ga0157378_10145209 | 3300013297 | Bacteria | 2206 |
| 172 | Ga0163162_10090492 | 3300013306 | Bacteria | 3141 |
| 173 | Ga0163162_10464899 | 3300013306 | Bacteria | 1397 |
| 174 | Ga0157372_10000468 | 3300013307 | Bacteria | 44530 |
| 175 | Ga0157372_10114986 | 3300013307 | Bacteria | 3084 |
| 176 | Ga0157372_10142399 | 3300013307 | Bacteria | 2763 |
| 177 | Ga0157375_10003266 | 3300013308 | Bacteria | 14069 |
| 178 | Ga0157375_10946667 | 3300013308 | Bacteria | 1003 |
| 179 | Ga0157380_10230710 | 3300014326 | Bacteria | 1662 |
| 180 | Ga0157380_10281170 | 3300014326 | Bacteria | 1523 |
| 181 | Ga0157377_10069056 | 3300014745 | Bacteria | 2038 |
| 182 | Ga0157377_10070040 | 3300014745 | Bacteria | 2025 |
| 183 | Ga0157379_10222415 | 3300014968 | Bacteria | 1711 |
| 184 | Ga0157379_10240680 | 3300014968 | Bacteria | 1641 |
| 185 | Ga0157376_10016839 | 3300014969 | Bacteria | 5560 |
| 186 | Ga0157376_10192097 | 3300014969 | Bacteria | 1873 |
| 187 | Ga0163161_10075741 | 3300017792 | Bacteria | 2470 |
| 188 | Ga0163161_10191800 | 3300017792 | Bacteria | 1571 |
| 189 | Ga0213874_10083058 | 3300021377 | Bacteria | 1041 |
| 190 | Ga0213876_10219442 | 3300021384 | Bacteria | 1011 |
| 191 | Ga0207653_10010554 | 3300025885 | Bacteria | 2881 |
| 192 | Ga0207682_10007892 | 3300025893 | Bacteria | 4226 |
| 193 | Ga0207682_10071454 | 3300025893 | Bacteria | 1471 |
| 194 | Ga0207710_10032948 | 3300025900 | Bacteria | 2271 |
| 195 | Ga0207688_10059627 | 3300025901 | Bacteria | 2149 |
| 196 | Ga0207647_10000127 | 3300025904 | Bacteria | 59293 |
| 197 | Ga0207647_10070436 | 3300025904 | Bacteria | 2112 |
| 198 | Ga0207699_10058864 | 3300025906 | Bacteria | 2300 |
| 199 | Ga0207645_10007804 | 3300025907 | Bacteria | 7528 |
| 200 | Ga0207645_10214386 | 3300025907 | Bacteria | 1268 |
| 201 | Ga0207643_10001647 | 3300025908 | Bacteria | 12569 |
| 202 | Ga0207643_10027597 | 3300025908 | Bacteria | 3148 |
| 203 | Ga0207684_10014921 | 3300025910 | Bacteria | 6686 |
| 204 | Ga0207684_10035583 | 3300025910 | Bacteria | 4228 |
| 205 | Ga0207684_10166974 | 3300025910 | Bacteria | 1897 |
| 206 | Ga0207654_10000081 | 3300025911 | Bacteria | 62713 |
| 207 | Ga0207654_10241861 | 3300025911 | Bacteria | 1206 |
| 208 | Ga0207707_10157633 | 3300025912 | Bacteria | 1985 |
| 209 | Ga0207695_10026298 | 3300025913 | Bacteria | 6496 |
| 210 | Ga0207695_10052319 | 3300025913 | Bacteria | 4279 |
| 211 | Ga0207695_10067580 | 3300025913 | Bacteria | 3666 |
| 212 | Ga0207695_10098495 | 3300025913 | Bacteria | 2923 |
| 213 | Ga0207671_10079363 | 3300025914 | Bacteria | 2459 |
| 214 | Ga0207671_10086181 | 3300025914 | Bacteria | 2361 |
| 215 | Ga0207671_10143048 | 3300025914 | Bacteria | 1844 |
| 216 | Ga0207693_10007308 | 3300025915 | Bacteria | 9088 |
| 217 | Ga0207693_10010808 | 3300025915 | Bacteria | 7410 |
| 218 | Ga0207693_10032535 | 3300025915 | Bacteria | 4115 |
| 219 | Ga0207663_10049382 | 3300025916 | Bacteria | 2609 |
| 220 | Ga0207662_10009149 | 3300025918 | Bacteria | 5445 |
| 221 | Ga0207657_10034284 | 3300025919 | Bacteria | 4567 |
| 222 | Ga0207657_10105333 | 3300025919 | Bacteria | 2335 |
| 223 | Ga0207681_10032058 | 3300025923 | Bacteria | 3438 |
| 224 | Ga0207694_10000134 | 3300025924 | Bacteria | 75759 |
| 225 | Ga0207694_10003702 | 3300025924 | Bacteria | 12107 |
| 226 | Ga0207694_10087160 | 3300025924 | Bacteria | 2459 |
| 227 | Ga0207694_10185401 | 3300025924 | Bacteria | 1689 |
| 228 | Ga0207650_10018120 | 3300025925 | Bacteria | 4937 |
| 229 | Ga0207650_10141920 | 3300025925 | Bacteria | 1889 |
| 230 | Ga0207659_10050777 | 3300025926 | Bacteria | 2948 |
| 231 | Ga0207659_10149501 | 3300025926 | Bacteria | 1822 |
| 232 | Ga0207659_10347444 | 3300025926 | Bacteria | 1230 |
| 233 | Ga0207664_10025639 | 3300025929 | Bacteria | 4445 |
| 234 | Ga0207664_10046362 | 3300025929 | Bacteria | 3411 |
| 235 | Ga0207644_10109716 | 3300025931 | Bacteria | 2085 |
| 236 | Ga0207644_10239768 | 3300025931 | Bacteria | 1443 |
| 237 | Ga0207690_10138594 | 3300025932 | Bacteria | 1790 |
| 238 | Ga0207706_10031576 | 3300025933 | Bacteria | 4719 |
| 239 | Ga0207670_10042092 | 3300025936 | Bacteria | 3008 |
| 240 | Ga0207669_10194765 | 3300025937 | Bacteria | 1465 |
| 241 | Ga0207665_10013924 | 3300025939 | Bacteria | 5290 |
| 242 | Ga0207691_10099308 | 3300025940 | Bacteria | 2599 |
| 243 | Ga0207711_10055387 | 3300025941 | Bacteria | 3405 |
| 244 | Ga0207711_10112491 | 3300025941 | Bacteria | 2423 |
| 245 | Ga0207711_10232344 | 3300025941 | Bacteria | 1689 |
| 246 | Ga0207689_10033977 | 3300025942 | Bacteria | 4236 |
| 247 | Ga0207661_10062077 | 3300025944 | Bacteria | 3022 |
| 248 | Ga0207661_10384259 | 3300025944 | Bacteria | 1271 |
| 249 | Ga0207679_10105418 | 3300025945 | Bacteria | 2214 |
| 250 | Ga0207667_10001417 | 3300025949 | Bacteria | 30024 |
| 251 | Ga0207667_10032615 | 3300025949 | Bacteria | 5610 |
| 252 | Ga0207667_10080556 | 3300025949 | Bacteria | 3373 |
| 253 | Ga0207667_10103762 | 3300025949 | Bacteria | 2932 |
| 254 | Ga0207667_10508443 | 3300025949 | Bacteria | 1221 |
| 255 | Ga0207651_10081004 | 3300025960 | Bacteria | 2339 |
| 256 | Ga0207640_10011101 | 3300025981 | Bacteria | 5091 |
| 257 | Ga0207658_10022826 | 3300025986 | Bacteria | 4359 |
| 258 | Ga0207658_10226656 | 3300025986 | Bacteria | 1575 |
| 259 | Ga0207703_10000318 | 3300026035 | Bacteria | 52249 |
| 260 | Ga0207703_10462271 | 3300026035 | Bacteria | 1187 |
| 261 | Ga0207639_10017795 | 3300026041 | Bacteria | 5039 |
| 262 | Ga0207639_10042634 | 3300026041 | Bacteria | 3401 |
| 263 | Ga0207639_10092850 | 3300026041 | Bacteria | 2419 |
| 264 | Ga0207639_10154118 | 3300026041 | Bacteria | 1928 |
| 265 | Ga0207678_10056749 | 3300026067 | Bacteria | 3371 |
| 266 | Ga0207678_10232509 | 3300026067 | Bacteria | 1578 |
| 267 | Ga0207708_10071299 | 3300026075 | Bacteria | 2661 |
| 268 | Ga0207702_10000180 | 3300026078 | Bacteria | 76230 |
| 269 | Ga0207702_10073499 | 3300026078 | Bacteria | 2948 |
| 270 | Ga0207641_10000721 | 3300026088 | Bacteria | 35497 |
| 271 | Ga0207648_10040011 | 3300026089 | Bacteria | 4120 |
| 272 | Ga0207648_10042704 | 3300026089 | Bacteria | 3980 |
| 273 | Ga0207648_10097754 | 3300026089 | Bacteria | 2569 |
| 274 | Ga0207676_10116646 | 3300026095 | Bacteria | 2244 |
| 275 | Ga0207676_10206255 | 3300026095 | Bacteria | 1740 |
| 276 | Ga0207676_10413179 | 3300026095 | Bacteria | 1264 |
| 277 | Ga0207674_10001278 | 3300026116 | Bacteria | 32880 |
| 278 | Ga0207674_10047208 | 3300026116 | Bacteria | 4416 |
| 279 | Ga0207674_10305456 | 3300026116 | Bacteria | 1540 |
| 280 | Ga0207675_100006871 | 3300026118 | Bacteria | 10774 |
| 281 | Ga0207675_100017479 | 3300026118 | Bacteria | 6693 |
| 282 | Ga0207683_10185011 | 3300026121 | Bacteria | 1890 |
| 283 | Ga0207683_10494082 | 3300026121 | Bacteria | 1130 |
| 284 | Ga0209983_1041983 | 3300027665 | Bacteria | 991 |
| 285 | Ga0209971_1006235 | 3300027682 | Bacteria | 2823 |
| 286 | Ga0207428_10312657 | 3300027907 | Bacteria | 1161 |
| 287 | Ga0268266_10001230 | 3300028379 | Bacteria | 31390 |
| 288 | Ga0268265_10015648 | 3300028380 | Bacteria | 5193 |
| 289 | Ga0268265_10024333 | 3300028380 | Bacteria | 4283 |
| 290 | Ga0268264_10000373 | 3300028381 | Bacteria | 65793 |
| 291 | Ga0307511_10001542 | 3300030521 | Bacteria | 24384 |
| 292 | Ga0307511_10022858 | 3300030521 | Bacteria | 5846 |
| 293 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 294 | Ga0265314_10004840 | 3300031711 | Bacteria | 12316 |
| 295 | Ga0307405_10005061 | 3300031731 | Bacteria | 6307 |
| 296 | Ga0307410_10013156 | 3300031852 | Bacteria | 4816 |
| 297 | Ga0307407_10046811 | 3300031903 | Bacteria | 2451 |
| 298 | Ga0307409_100020544 | 3300031995 | Bacteria | 4504 |
| 299 | Ga0307416_100099944 | 3300032002 | Bacteria | 2521 |
| 300 | Ga0307414_10113758 | 3300032004 | Bacteria | 2066 |
| 301 | Ga0307411_10059859 | 3300032005 | Bacteria | 2526 |
| 302 | Ga0307510_10000015 | 3300033180 | Bacteria | 258937 |
| 303 | Ga0307510_10023531 | 3300033180 | Bacteria | 7139 |
| 304 | Ga0373930_0016234 | 3300034816 | Bacteria | 1406 |
| 305 | Ga0373929_0017199 | 3300035085 | Bacteria | 1425 |
| 306 | Ga0373936_0004685 | 3300035113 | Bacteria | 5170 |
| 307 | Ga0373939_0077250 | 3300035114 | Bacteria | 1098 |
| 308 | Ga0373960_0011725 | 3300035121 | Bacteria | 2164 |
| 309 | Ga0373943_0012079 | 3300035170 | Bacteria | 3889 |
| 310 | Ga0373943_0042609 | 3300035170 | Bacteria | 2200 |
| 311 | Ga0373946_0175705 | 3300035171 | Bacteria | 1014 |
| 312 | Ga0373942_0007700 | 3300035207 | Bacteria | 2504 |
| 313 | Ga0373961_0003399 | 3300035241 | Bacteria | 3947 |
| 314 | Ga0373931_0069935 | 3300035691 | Bacteria | 1913 |
| 315 | Ga0373935_0024433 | 3300035692 | Bacteria | 3719 |
| 316 | Ga0373927_0141211 | 3300035695 | Bacteria | 1575 |
| 317 | Ga0373947_0015100 | 3300035725 | Bacteria | 4433 |
| 318 | Ga0373947_0025699 | 3300035725 | Bacteria | 3434 |
| 319 | Ga0373925_0034944 | 3300037068 | Bacteria | 3706 |
| 320 | Ga0373925_0133081 | 3300037068 | Bacteria | 1940 |
| 321 | Ga0395899_0000083 | 3300037312 | Bacteria | 161878 |
| 322 | Ga0395899_0074988 | 3300037312 | Bacteria | 2471 |
| 323 | Ga0395899_0275151 | 3300037312 | Bacteria | 1147 |
| 324 | Ga0395900_0000004 | 3300037418 | Bacteria | 564908 |
| 325 | Ga0395900_0028376 | 3300037418 | Bacteria | 5732 |
| 326 | Ga0395900_0029736 | 3300037418 | Bacteria | 5606 |
| 327 | Ga0395900_0282554 | 3300037418 | Bacteria | 1651 |
| 328 | Ga0395898_0007994 | 3300037466 | Bacteria | 11221 |
| 329 | Ga0395898_0074387 | 3300037466 | Bacteria | 3281 |
| 330 | Ga0395905_0006577 | 3300037471 | Bacteria | 11677 |
| 331 | Ga0395905_0057360 | 3300037471 | Bacteria | 3643 |
| 332 | Ga0395905_0361950 | 3300037471 | Bacteria | 1343 |
| 333 | Ga0436364_0520633 | 3300037853 | Bacteria | 51124 |
| 334 | Ga0395901_0000005 | 3300038443 | Bacteria | 544998 |
| 335 | Ga0395901_0018973 | 3300038443 | Bacteria | 7032 |
| 336 | Ga0395901_0022989 | 3300038443 | Bacteria | 6390 |
| 337 | Ga0395901_0041390 | 3300038443 | Bacteria | 4775 |
| 338 | Ga0395901_0095446 | 3300038443 | Bacteria | 3116 |
| 339 | Ga0400490_25320 | 3300038726 | Bacteria | 33187 |
| 340 | Ga0400488_15777 | 3300038741 | Bacteria | 3018 |
| 341 | Ga0400487_00056 | 3300039110 | Bacteria | 2592 |
| 342 | Ga0400487_32217 | 3300039110 | Bacteria | 35879 |
| 343 | Ga0400487_56403 | 3300039110 | Unclassified | 2977 |
| 344 | Ga0400487_61000 | 3300039110 | Bacteria | 27948 |
| 345 | Ga0436365_0654630 | 3300039437 | Bacteria | 2832 |
| 346 | Ga0436360_0454558 | 3300039438 | Bacteria | 2288 |
| 347 | Ga0436360_0659314 | 3300039438 | Bacteria | 1023 |
| 348 | Ga0436363_1003312 | 3300039450 | Bacteria | 1207 |
| 349 | Ga0451853_1145584 | 3300041512 | Bacteria | 1540 |
| 350 | Ga0439435_0098916 | 3300042436 | Bacteria | 894 |
| 351 | Ga0439444_0007395 | 3300042437 | Bacteria | 1685 |
| 352 | Ga0450918_018091 | 3300042531 | Bacteria | 1228 |
| 353 | Ga0466969_0097777 | 3300044656 | Bacteria | 1384 |
| 354 | Ga0466970_0028743 | 3300044765 | Bacteria | 2923 |
| 355 | Ga0466959_0001806 | 3300045049 | Bacteria | 13393 |
| 356 | Ga0495603_0087466 | 3300046455 | Bacteria | 1823 |
| 357 | Ga0495603_0164097 | 3300046455 | Bacteria | 1288 |
| 358 | Ga0495603_0321730 | 3300046455 | Bacteria | 888 |
| 359 | Ga0495638_0006033 | 3300046460 | Bacteria | 8870 |
| 360 | Ga0495653_0088300 | 3300046463 | Bacteria | 2275 |
| 361 | Ga0495605_0001268 | 3300046474 | Bacteria | 16725 |
| 362 | Ga0495605_0055179 | 3300046474 | Bacteria | 1921 |
| 363 | Ga0495639_0068584 | 3300046475 | Bacteria | 1635 |
| 364 | Ga0495662_0165298 | 3300046476 | Bacteria | 1090 |
| 365 | Ga0495584_0043813 | 3300046491 | Bacteria | 2259 |
| 366 | Ga0495585_0014506 | 3300046492 | Bacteria | 4588 |
| 367 | Ga0495594_0081541 | 3300046499 | Bacteria | 1806 |
| 368 | Ga0495594_0214263 | 3300046499 | Bacteria | 1098 |
| 369 | Ga0495596_0063233 | 3300046500 | Bacteria | 1440 |
| 370 | Ga0495606_0054069 | 3300046507 | Bacteria | 2602 |
| 371 | Ga0495606_0216746 | 3300046507 | Bacteria | 1081 |
| 372 | Ga0495606_0231206 | 3300046507 | Bacteria | 1036 |
| 373 | Ga0495616_0077305 | 3300046513 | Bacteria | 1598 |
| 374 | Ga0495628_0162302 | 3300046516 | Bacteria | 1698 |
| 375 | Ga0495644_0008346 | 3300046523 | Bacteria | 3990 |
| 376 | Ga0495644_0022053 | 3300046523 | Bacteria | 2428 |
| 377 | Ga0495663_0068550 | 3300046525 | Bacteria | 1126 |
| 378 | Ga0495642_0054211 | 3300046528 | Bacteria | 1653 |
| 379 | Ga0495642_0092324 | 3300046528 | Bacteria | 1282 |
| 380 | Ga0495654_0153970 | 3300046530 | Bacteria | 1014 |
| 381 | Ga0495665_0081285 | 3300046531 | Bacteria | 1704 |
| 382 | Ga0495621_0028363 | 3300046539 | Bacteria | 1903 |
| 383 | Ga0495621_0070331 | 3300046539 | Bacteria | 1288 |
| 384 | Ga0495621_0071339 | 3300046539 | Bacteria | 1280 |
| 385 | Ga0495597_0044494 | 3300046542 | Bacteria | 1974 |
| 386 | Ga0495656_0004258 | 3300046615 | Bacteria | 4888 |
| 387 | Ga0495656_0022509 | 3300046615 | Bacteria | 2469 |
| 388 | Ga0495656_0160274 | 3300046615 | Bacteria | 1093 |
| 389 | Ga0495588_0006437 | 3300046674 | Bacteria | 5288 |
| 390 | Ga0495669_0042113 | 3300046684 | Bacteria | 2029 |
| 391 | Ga0495669_0066751 | 3300046684 | Bacteria | 1634 |
| 392 | Ga0495624_0022066 | 3300046690 | Bacteria | 4214 |
| 393 | Ga0495670_0073480 | 3300046691 | Bacteria | 1733 |
| 394 | Ga0495670_0115798 | 3300046691 | Bacteria | 1390 |
| 395 | Ga0495589_0013321 | 3300046794 | Bacteria | 4244 |
| 396 | Ga0495660_0117851 | 3300046810 | Bacteria | 1347 |
| 397 | Ga0495581_0071680 | 3300047315 | Bacteria | 2005 |
| 398 | Ga0495672_0043292 | 3300047320 | Bacteria | 2708 |
| 399 | Ga0495676_0026477 | 3300047321 | Bacteria | 4991 |
| 400 | Ga0495680_0083319 | 3300047322 | Bacteria | 2412 |
| 401 | Ga0495687_015021 | 3300047443 | Bacteria | 3954 |
| 402 | Ga0495679_049837 | 3300047446 | Bacteria | 1262 |
| 403 | Ga0495684_0133945 | 3300047471 | Bacteria | 1860 |
| 404 | Ga0496100_0155798 | 3300048903 | Bacteria | 1633 |
| 405 | Ga0496101_0038952 | 3300048904 | Bacteria | 3377 |
| 406 | Ga0496101_0072781 | 3300048904 | Bacteria | 2523 |
| 407 | Ga0496103_0001026 | 3300048906 | Bacteria | 19554 |
| 408 | Ga0496104_0016013 | 3300048907 | Bacteria | 6807 |
| 409 | Ga0496104_0103414 | 3300048907 | Bacteria | 2728 |
| 410 | Ga0496104_0195548 | 3300048907 | Bacteria | 1934 |
| 411 | Ga0496105_0004542 | 3300048908 | Bacteria | 10457 |
| 412 | Ga0496106_0132751 | 3300048909 | Bacteria | 1953 |
| 413 | Ga0496107_0299478 | 3300048910 | Bacteria | 1197 |
| 414 | Ga0496107_0333108 | 3300048910 | Bacteria | 1129 |
| 415 | Ga0496108_0000552 | 3300048911 | Bacteria | 29320 |
| 416 | Ga0496108_0248410 | 3300048911 | Bacteria | 1547 |
| 417 | Ga0496108_0424053 | 3300048911 | Bacteria | 1162 |
| 418 | Ga0496109_0002241 | 3300048912 | Bacteria | 16058 |
| 419 | Ga0496110_0018928 | 3300048913 | Bacteria | 5786 |
| 420 | Ga0496111_0008382 | 3300048914 | Bacteria | 6836 |
| 421 | Ga0496111_0086659 | 3300048914 | Bacteria | 2291 |
| 422 | Ga0496113_0001551 | 3300048916 | Bacteria | 12887 |
| 423 | Ga0496114_0056970 | 3300048917 | Bacteria | 3262 |
| 424 | Ga0496119_0000983 | 3300048922 | Bacteria | 36653 |
| 425 | Ga0496119_0278714 | 3300048922 | Bacteria | 832 |
| 426 | Ga0496120_0000199 | 3300048923 | Bacteria | 103142 |
| 427 | Ga0496125_0000854 | 3300048928 | Bacteria | 48916 |
| 428 | Ga0496126_0136978 | 3300048929 | Bacteria | 2111 |
| 429 | Ga0501033_0110850 | 3300049570 | Bacteria | 1997 |
| 430 | Ga0501034_0220457 | 3300049571 | Bacteria | 1849 |
| 431 | Ga0501036_0032503 | 3300049572 | Bacteria | 4409 |
| 432 | Ga0501036_0036210 | 3300049572 | Bacteria | 4176 |
| 433 | Ga0501038_0016306 | 3300049574 | Bacteria | 6736 |
| 434 | Ga0501039_0043830 | 3300049575 | Bacteria | 3456 |
| 435 | Ga0501039_0055148 | 3300049575 | Bacteria | 3077 |
| 436 | Ga0501039_0672021 | 3300049575 | Bacteria | 811 |
| 437 | Ga0501040_0010553 | 3300049576 | Bacteria | 6041 |
| 438 | Ga0501040_0011884 | 3300049576 | Bacteria | 5696 |
| 439 | Ga0501041_0003027 | 3300049577 | Bacteria | 9633 |
| 440 | Ga0501041_0015002 | 3300049577 | Bacteria | 4601 |
| 441 | Ga0501041_0248011 | 3300049577 | Bacteria | 1119 |
| 442 | Ga0501042_0049988 | 3300049578 | Bacteria | 2983 |
| 443 | Ga0501042_0183908 | 3300049578 | Bacteria | 1508 |
| 444 | Ga0501042_0204544 | 3300049578 | Bacteria | 1424 |
| 445 | Ga0501042_0204946 | 3300049578 | Bacteria | 1422 |
| 446 | Ga0501043_0000053 | 3300049579 | Bacteria | 106085 |
| 447 | Ga0501043_0025445 | 3300049579 | Bacteria | 4645 |
| 448 | Ga0501046_0000018 | 3300049580 | Bacteria | 220589 |
| 449 | Ga0501046_0013541 | 3300049580 | Bacteria | 6901 |
| 450 | Ga0501046_0073254 | 3300049580 | Bacteria | 2658 |
| 451 | Ga0501046_0173405 | 3300049580 | Bacteria | 1617 |
| 452 | Ga0501046_0247090 | 3300049580 | Bacteria | 1314 |
| 453 | Ga0501047_0000020 | 3300049581 | Bacteria | 259377 |
| 454 | Ga0501048_0000795 | 3300049582 | Bacteria | 23148 |
| 455 | Ga0501048_0014265 | 3300049582 | Bacteria | 5886 |
| 456 | Ga0501048_0025604 | 3300049582 | Bacteria | 4300 |
| 457 | Ga0501068_0006209 | 3300049584 | Bacteria | 6572 |
| 458 | Ga0501069_0168010 | 3300049585 | Bacteria | 1265 |
| 459 | Ga0501070_0018463 | 3300049586 | Bacteria | 5851 |
| 460 | Ga0501071_0023087 | 3300049587 | Bacteria | 4341 |
| 461 | Ga0501071_0046233 | 3300049587 | Bacteria | 3126 |
| 462 | Ga0501072_0003680 | 3300049588 | Bacteria | 11564 |
| 463 | Ga0501072_0010859 | 3300049588 | Bacteria | 6944 |
| 464 | Ga0501072_0312518 | 3300049588 | Bacteria | 1249 |
| 465 | Ga0501073_0001765 | 3300049589 | Bacteria | 16078 |
| 466 | Ga0501073_0050762 | 3300049589 | Bacteria | 2906 |
| 467 | Ga0501074_0088320 | 3300049590 | Bacteria | 2220 |
| 468 | Ga0501074_0303760 | 3300049590 | Bacteria | 1133 |
| 469 | Ga0501075_0005348 | 3300049591 | Bacteria | 8781 |
| 470 | Ga0501075_0218527 | 3300049591 | Bacteria | 1454 |
| 471 | Ga0501076_0001848 | 3300049592 | Bacteria | 14404 |
| 472 | Ga0501076_0005337 | 3300049592 | Bacteria | 9229 |
| 473 | Ga0501076_0100568 | 3300049592 | Bacteria | 2330 |
| 474 | Ga0501076_0219193 | 3300049592 | Bacteria | 1555 |
| 475 | Ga0501076_0277529 | 3300049592 | Bacteria | 1373 |
| 476 | Ga0501077_0048602 | 3300049593 | Bacteria | 2695 |
| 477 | Ga0501079_0002227 | 3300049741 | Bacteria | 13980 |
| 478 | Ga0501079_0019505 | 3300049741 | Bacteria | 5180 |
| 479 | Ga0501079_0080697 | 3300049741 | Bacteria | 2515 |
| 480 | Ga0501079_0268004 | 3300049741 | Bacteria | 1335 |
| 481 | Ga0501080_0013466 | 3300049742 | Bacteria | 7524 |
| 482 | Ga0501080_0016847 | 3300049742 | Bacteria | 6749 |
| 483 | Ga0501080_0042873 | 3300049742 | Bacteria | 4212 |
| 484 | Ga0501081_0001203 | 3300049743 | Bacteria | 15719 |
| 485 | Ga0501081_0007381 | 3300049743 | Bacteria | 7135 |
| 486 | Ga0501035_0042097 | 3300049822 | Bacteria | 4121 |
| 487 | Ga0501044_0076161 | 3300049823 | Bacteria | 3406 |
| 488 | Ga0501045_0002006 | 3300049824 | Bacteria | 13757 |
| 489 | Ga0501045_0006612 | 3300049824 | Bacteria | 8032 |
| 490 | Ga0501045_0187247 | 3300049824 | Bacteria | 1542 |
| 491 | nmdc:mga0yw44_342574_c1 | 3300050492 | Bacteria | 1006 |
| 492 | nmdc:mga0yw44_6236_c1 | 3300050492 | Bacteria | 5739 |
| 493 | nmdc:mga05p37_115151_c1 | 3300050507 | Bacteria | 3305 |
| 494 | nmdc:mga05p37_313130_c1 | 3300050507 | Bacteria | 1860 |
| 495 | nmdc:mga05p37_434958_c1 | 3300050507 | Bacteria | 1523 |
| 496 | nmdc:mga05p37_631204_c1 | 3300050507 | Bacteria | 1204 |
| 497 | nmdc:mga09592_179312_c1 | 3300050508 | Bacteria | 1832 |
| 498 | nmdc:mga09592_97792_c1 | 3300050508 | Bacteria | 2512 |
| 499 | nmdc:mga0qj67_134974_c1 | 3300050509 | Bacteria | 1999 |
| 500 | nmdc:mga0qj67_47653_c1 | 3300050509 | Bacteria | 3386 |
| 501 | nmdc:mga06r32_35869_c1 | 3300050510 | Bacteria | 4680 |
| 502 | nmdc:mga06r32_82669_c1 | 3300050510 | Bacteria | 3129 |
| 503 | nmdc:mga08y16_154078_c1 | 3300050511 | Bacteria | 2388 |
| 504 | nmdc:mga08y16_216192_c1 | 3300050511 | Bacteria | 1985 |
| 505 | nmdc:mga08y16_554417_c1 | 3300050511 | Bacteria | 1163 |
| 506 | nmdc:mga0n895_100469_c1 | 3300050512 | Bacteria | 2902 |
| 507 | nmdc:mga0n895_363667_c1 | 3300050512 | Bacteria | 1465 |
| 508 | nmdc:mga0rr50_211446_c1 | 3300050513 | Bacteria | 1598 |
| 509 | nmdc:mga08x19_253433_c1 | 3300050514 | Bacteria | 1215 |
| 510 | nmdc:mga0a205_117897_c1 | 3300050515 | Bacteria | 2553 |
| 511 | nmdc:mga0a205_189465_c1 | 3300050515 | Bacteria | 1949 |
| 512 | Ga0495619_0069625 | 3300053085 | Bacteria | 2352 |
| 513 | Ga0495619_0143378 | 3300053085 | Bacteria | 1646 |
| 514 | Ga0500647_0047266 | 3300053091 | Bacteria | 2068 |
| 515 | Ga0500641_0000126 | 3300053096 | Bacteria | 28650 |
| 516 | Ga0500556_0002015 | 3300053104 | Bacteria | 7103 |
| 517 | Ga0500591_058576 | 3300053115 | Bacteria | 1784 |
| 518 | Ga0500590_231977 | 3300053148 | Bacteria | 751 |
| 519 | Ga0500616_0014688 | 3300053153 | Bacteria | 4492 |
| 520 | Ga0500630_095126 | 3300053159 | Bacteria | 1368 |
| 521 | Ga0500639_124255 | 3300053163 | Bacteria | 1234 |
| 522 | Ga0500645_004890 | 3300053730 | Bacteria | 5042 |
| 523 | Ga0501084_0035527 | 3300054114 | Bacteria | 4166 |
| 524 | Ga0501084_0256898 | 3300054114 | Bacteria | 1475 |
| 525 | Ga0501084_0271580 | 3300054114 | Bacteria | 1432 |
| 526 | Ga0501084_0286014 | 3300054114 | Bacteria | 1392 |
| 527 | Ga0501082_0005387 | 3300060353 | Bacteria | 11102 |
| 528 | Ga0501082_0009378 | 3300060353 | Bacteria | 8429 |
| 529 | Ga0501082_0195109 | 3300060353 | Bacteria | 1761 |
| 530 | Ga0501082_0367805 | 3300060353 | Bacteria | 1254 |
| 531 | Ga0466962_0002588 | 3300061719 | Bacteria | 8594 |
| 532 | Ga0530510_0002356 | 3300061734 | Bacteria | 12971 |
| 533 | Ga0530510_0042674 | 3300061734 | Bacteria | 3277 |
| 534 | Ga0530510_0107872 | 3300061734 | Bacteria | 2038 |
| 535 | Ga0530510_0264567 | 3300061734 | Bacteria | 1283 |
| 536 | Ga0530510_0426278 | 3300061734 | Bacteria | 1002 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053148 | Ga0500590_231977 | Ga0500590_231977_49_729 | 226 |
| 2 | 3300042531 | Ga0450918_018091 | Ga0450918_018091_524_1210 | 228 |
| 3 | 3300049588 | Ga0501072_0312518 | Ga0501072_0312518_31_717 | 228 |
| 4 | 3300049592 | Ga0501076_0219193 | Ga0501076_0219193_839_1525 | 228 |
| 5 | 3300049741 | Ga0501079_0268004 | Ga0501079_0268004_15_713 | 231 |
| 6 | 3300049575 | Ga0501039_0672021 | Ga0501039_0672021_29_727 | 232 |
| 7 | 3300039438 | Ga0436360_0659314 | Ga0436360_0659314_287_1009 | 239 |
| 8 | 3300049580 | Ga0501046_0247090 | Ga0501046_0247090_567_1304 | 244 |
| 9 | 3300046507 | Ga0495606_0216746 | Ga0495606_0216746_319_1068 | 249 |
| 10 | 3300046455 | Ga0495603_0321730 | Ga0495603_0321730_18_770 | 250 |
| 11 | 3300046528 | Ga0495642_0092324 | Ga0495642_0092324_82_834 | 250 |
| 12 | 3300005983 | Ga0081540_1002187 | Ga0081540_10021879 | 252 |
| 13 | 3300037312 | Ga0395899_0275151 | Ga0395899_0275151_203_1009 | 252 |
| 14 | 3300037471 | Ga0395905_0361950 | Ga0395905_0361950_261_1067 | 252 |
| 15 | 3300038443 | Ga0395901_0095446 | Ga0395901_0095446_864_1670 | 252 |
| 16 | 3300005436 | Ga0070713_100041435 | Ga0070713_1000414353 | 253 |
| 17 | 3300005437 | Ga0070710_10005767 | Ga0070710_100057674 | 253 |
| 18 | 3300005439 | Ga0070711_100131209 | Ga0070711_1001312091 | 253 |
| 19 | 3300005546 | Ga0070696_100469746 | Ga0070696_1004697461 | 253 |
| 20 | 3300006028 | Ga0070717_10007579 | Ga0070717_100075797 | 253 |
| 21 | 3300006163 | Ga0070715_10001047 | Ga0070715_100010473 | 253 |
| 22 | 3300006173 | Ga0070716_100072554 | Ga0070716_1000725543 | 253 |
| 23 | 3300007076 | Ga0075435_100025640 | Ga0075435_1000256405 | 253 |
| 24 | 3300021377 | Ga0213874_10083058 | Ga0213874_100830581 | 253 |
| 25 | 3300025915 | Ga0207693_10007308 | Ga0207693_100073082 | 253 |
| 26 | 3300025929 | Ga0207664_10025639 | Ga0207664_100256393 | 253 |
| 27 | 3300025939 | Ga0207665_10013924 | Ga0207665_100139242 | 253 |
| 28 | 3300039450 | Ga0436363_1003312 | Ga0436363_1003312_65_871 | 253 |
| 29 | 3300048910 | Ga0496107_0299478 | Ga0496107_0299478_310_1116 | 253 |
| 30 | 3300050512 | nmdc:mga0n895_100469_c1 | nmdc:mga0n895_100469_c1_97_903 | 253 |
| 31 | 3300050512 | nmdc:mga0n895_363667_c1 | nmdc:mga0n895_363667_c1_457_1263 | 253 |
| 32 | 3300050513 | nmdc:mga0rr50_211446_c1 | nmdc:mga0rr50_211446_c1_412_1218 | 253 |
| 33 | 3300050515 | nmdc:mga0a205_189465_c1 | nmdc:mga0a205_189465_c1_268_1074 | 253 |
| 34 | 3300009094 | Ga0111539_10537157 | Ga0111539_105371572 | 254 |
| 35 | 3300050514 | nmdc:mga08x19_253433_c1 | nmdc:mga08x19_253433_c1_110_916 | 254 |
| 36 | 3300009147 | Ga0114129_10175480 | Ga0114129_101754803 | 255 |
| 37 | 3300049571 | Ga0501034_0220457 | Ga0501034_0220457_373_1161 | 259 |
| 38 | 3300049586 | Ga0501070_0018463 | Ga0501070_0018463_2844_3632 | 259 |
| 39 | 3300049589 | Ga0501073_0050762 | Ga0501073_0050762_627_1415 | 259 |
| 40 | 3300049742 | Ga0501080_0013466 | Ga0501080_0013466_2705_3493 | 259 |
| 41 | 3300021384 | Ga0213876_10219442 | Ga0213876_102194422 | 260 |
| 42 | 3300039437 | Ga0436365_0654630 | Ga0436365_0654630_1953_2798 | 260 |
| 43 | 3300046499 | Ga0495594_0214263 | Ga0495594_0214263_150_935 | 260 |
| 44 | 3300030521 | Ga0307511_10001542 | Ga0307511_1000154222 | 261 |
| 45 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001508 | 261 |
| 46 | 3300046528 | Ga0495642_0054211 | Ga0495642_0054211_339_1127 | 261 |
| 47 | 3300046539 | Ga0495621_0071339 | Ga0495621_0071339_237_1025 | 261 |
| 48 | 3300053096 | Ga0500641_0000126 | Ga0500641_0000126_23078_23881 | 261 |
| 49 | 3300053104 | Ga0500556_0002015 | Ga0500556_0002015_933_1736 | 261 |
| 50 | 3300053153 | Ga0500616_0014688 | Ga0500616_0014688_1283_2086 | 261 |
| 51 | 3300053730 | Ga0500645_004890 | Ga0500645_004890_742_1545 | 261 |
| 52 | 3300005329 | Ga0070683_100416377 | Ga0070683_1004163772 | 262 |
| 53 | 3300005331 | Ga0070670_100105190 | Ga0070670_1001051902 | 262 |
| 54 | 3300005335 | Ga0070666_10148035 | Ga0070666_101480352 | 262 |
| 55 | 3300005336 | Ga0070680_100258737 | Ga0070680_1002587372 | 262 |
| 56 | 3300005339 | Ga0070660_100059514 | Ga0070660_1000595143 | 262 |
| 57 | 3300005339 | Ga0070660_100151508 | Ga0070660_1001515082 | 262 |
| 58 | 3300005344 | Ga0070661_100384157 | Ga0070661_1003841572 | 262 |
| 59 | 3300005355 | Ga0070671_100000668 | Ga0070671_10000066819 | 262 |
| 60 | 3300005355 | Ga0070671_100377399 | Ga0070671_1003773992 | 262 |
| 61 | 3300005366 | Ga0070659_100168845 | Ga0070659_1001688452 | 262 |
| 62 | 3300005367 | Ga0070667_100051540 | Ga0070667_1000515401 | 262 |
| 63 | 3300005434 | Ga0070709_10059343 | Ga0070709_100593432 | 262 |
| 64 | 3300005439 | Ga0070711_100038006 | Ga0070711_1000380063 | 262 |
| 65 | 3300005458 | Ga0070681_10242648 | Ga0070681_102426482 | 262 |
| 66 | 3300005530 | Ga0070679_100110802 | Ga0070679_1001108023 | 262 |
| 67 | 3300005548 | Ga0070665_100010270 | Ga0070665_1000102702 | 262 |
| 68 | 3300005548 | Ga0070665_100041262 | Ga0070665_1000412625 | 262 |
| 69 | 3300005563 | Ga0068855_100087012 | Ga0068855_1000870123 | 262 |
| 70 | 3300005563 | Ga0068855_100452001 | Ga0068855_1004520012 | 262 |
| 71 | 3300005614 | Ga0068856_100165585 | Ga0068856_1001655852 | 262 |
| 72 | 3300005616 | Ga0068852_100508354 | Ga0068852_1005083542 | 262 |
| 73 | 3300005841 | Ga0068863_100007247 | Ga0068863_1000072476 | 262 |
| 74 | 3300005842 | Ga0068858_100001501 | Ga0068858_1000015015 | 262 |
| 75 | 3300005843 | Ga0068860_100000887 | Ga0068860_10000088713 | 262 |
| 76 | 3300005844 | Ga0068862_100021059 | Ga0068862_1000210593 | 262 |
| 77 | 3300009093 | Ga0105240_10027626 | Ga0105240_100276263 | 262 |
| 78 | 3300009093 | Ga0105240_10044218 | Ga0105240_100442183 | 262 |
| 79 | 3300009093 | Ga0105240_10078202 | Ga0105240_100782026 | 262 |
| 80 | 3300009093 | Ga0105240_10402485 | Ga0105240_104024852 | 262 |
| 81 | 3300009101 | Ga0105247_10117351 | Ga0105247_101173512 | 262 |
| 82 | 3300009174 | Ga0105241_10439816 | Ga0105241_104398161 | 262 |
| 83 | 3300009545 | Ga0105237_10116168 | Ga0105237_101161683 | 262 |
| 84 | 3300009545 | Ga0105237_10140252 | Ga0105237_101402522 | 262 |
| 85 | 3300009551 | Ga0105238_10022006 | Ga0105238_100220064 | 262 |
| 86 | 3300009551 | Ga0105238_10136793 | Ga0105238_101367933 | 262 |
| 87 | 3300009551 | Ga0105238_10314051 | Ga0105238_103140512 | 262 |
| 88 | 3300009551 | Ga0105238_10355486 | Ga0105238_103554861 | 262 |
| 89 | 3300009551 | Ga0105238_10506972 | Ga0105238_105069722 | 262 |
| 90 | 3300013100 | Ga0157373_10206741 | Ga0157373_102067412 | 262 |
| 91 | 3300013104 | Ga0157370_10010331 | Ga0157370_1001033111 | 262 |
| 92 | 3300013104 | Ga0157370_10040162 | Ga0157370_100401622 | 262 |
| 93 | 3300013105 | Ga0157369_10000857 | Ga0157369_1000085731 | 262 |
| 94 | 3300013105 | Ga0157369_10163011 | Ga0157369_101630112 | 262 |
| 95 | 3300013296 | Ga0157374_10346424 | Ga0157374_103464241 | 262 |
| 96 | 3300013306 | Ga0163162_10090492 | Ga0163162_100904922 | 262 |
| 97 | 3300013307 | Ga0157372_10000468 | Ga0157372_1000046840 | 262 |
| 98 | 3300013307 | Ga0157372_10114986 | Ga0157372_101149862 | 262 |
| 99 | 3300013307 | Ga0157372_10142399 | Ga0157372_101423992 | 262 |
| 100 | 3300014968 | Ga0157379_10222415 | Ga0157379_102224152 | 262 |
| 101 | 3300025900 | Ga0207710_10032948 | Ga0207710_100329482 | 262 |
| 102 | 3300025906 | Ga0207699_10058864 | Ga0207699_100588643 | 262 |
| 103 | 3300025911 | Ga0207654_10241861 | Ga0207654_102418611 | 262 |
| 104 | 3300025912 | Ga0207707_10157633 | Ga0207707_101576332 | 262 |
| 105 | 3300025913 | Ga0207695_10026298 | Ga0207695_100262985 | 262 |
| 106 | 3300025914 | Ga0207671_10079363 | Ga0207671_100793632 | 262 |
| 107 | 3300025916 | Ga0207663_10049382 | Ga0207663_100493822 | 262 |
| 108 | 3300025919 | Ga0207657_10105333 | Ga0207657_101053332 | 262 |
| 109 | 3300025924 | Ga0207694_10087160 | Ga0207694_100871602 | 262 |
| 110 | 3300025924 | Ga0207694_10185401 | Ga0207694_101854012 | 262 |
| 111 | 3300025929 | Ga0207664_10046362 | Ga0207664_100463622 | 262 |
| 112 | 3300025932 | Ga0207690_10138594 | Ga0207690_101385942 | 262 |
| 113 | 3300025944 | Ga0207661_10384259 | Ga0207661_103842592 | 262 |
| 114 | 3300025949 | Ga0207667_10080556 | Ga0207667_100805563 | 262 |
| 115 | 3300025949 | Ga0207667_10103762 | Ga0207667_101037622 | 262 |
| 116 | 3300025949 | Ga0207667_10508443 | Ga0207667_105084431 | 262 |
| 117 | 3300025986 | Ga0207658_10022826 | Ga0207658_100228265 | 262 |
| 118 | 3300026035 | Ga0207703_10000318 | Ga0207703_1000031811 | 262 |
| 119 | 3300026041 | Ga0207639_10092850 | Ga0207639_100928502 | 262 |
| 120 | 3300026088 | Ga0207641_10000721 | Ga0207641_100007215 | 262 |
| 121 | 3300026095 | Ga0207676_10413179 | Ga0207676_104131792 | 262 |
| 122 | 3300028379 | Ga0268266_10001230 | Ga0268266_100012305 | 262 |
| 123 | 3300028380 | Ga0268265_10024333 | Ga0268265_100243334 | 262 |
| 124 | 3300028381 | Ga0268264_10000373 | Ga0268264_1000037318 | 262 |
| 125 | 3300030521 | Ga0307511_10022858 | Ga0307511_100228582 | 262 |
| 126 | 3300033180 | Ga0307510_10000015 | Ga0307510_10000015167 | 262 |
| 127 | 3300033180 | Ga0307510_10023531 | Ga0307510_100235315 | 262 |
| 128 | 3300035113 | Ga0373936_0004685 | Ga0373936_0004685_254_1075 | 262 |
| 129 | 3300037312 | Ga0395899_0074988 | Ga0395899_0074988_1060_1863 | 262 |
| 130 | 3300037418 | Ga0395900_0028376 | Ga0395900_0028376_3886_4692 | 262 |
| 131 | 3300037418 | Ga0395900_0029736 | Ga0395900_0029736_2218_3021 | 262 |
| 132 | 3300037466 | Ga0395898_0074387 | Ga0395898_0074387_1421_2224 | 262 |
| 133 | 3300037471 | Ga0395905_0057360 | Ga0395905_0057360_1555_2361 | 262 |
| 134 | 3300038443 | Ga0395901_0022989 | Ga0395901_0022989_5465_6268 | 262 |
| 135 | 3300038443 | Ga0395901_0041390 | Ga0395901_0041390_715_1521 | 262 |
| 136 | 3300046507 | Ga0495606_0054069 | Ga0495606_0054069_438_1244 | 262 |
| 137 | 3300046507 | Ga0495606_0231206 | Ga0495606_0231206_57_863 | 262 |
| 138 | 3300047443 | Ga0495687_015021 | Ga0495687_015021_2467_3273 | 262 |
| 139 | 3300048911 | Ga0496108_0424053 | Ga0496108_0424053_64_870 | 262 |
| 140 | 3300048922 | Ga0496119_0000983 | Ga0496119_0000983_11250_12056 | 262 |
| 141 | 3300048922 | Ga0496119_0278714 | Ga0496119_0278714_15_812 | 262 |
| 142 | 3300048923 | Ga0496120_0000199 | Ga0496120_0000199_32517_33323 | 262 |
| 143 | 3300048928 | Ga0496125_0000854 | Ga0496125_0000854_20567_21373 | 262 |
| 144 | 3300048929 | Ga0496126_0136978 | Ga0496126_0136978_20_826 | 262 |
| 145 | 3300049585 | Ga0501069_0168010 | Ga0501069_0168010_363_1154 | 262 |
| 146 | 3300053115 | Ga0500591_058576 | Ga0500591_058576_355_1176 | 262 |
| 147 | 3300053159 | Ga0500630_095126 | Ga0500630_095126_126_947 | 262 |
| 148 | 3300053163 | Ga0500639_124255 | Ga0500639_124255_355_1176 | 262 |
| 149 | 3300025941 | Ga0207711_10112491 | Ga0207711_101124912 | 263 |
| 150 | 3300046539 | Ga0495621_0070331 | Ga0495621_0070331_125_934 | 263 |
| 151 | 3300049570 | Ga0501033_0110850 | Ga0501033_0110850_685_1491 | 263 |
| 152 | 3300049572 | Ga0501036_0032503 | Ga0501036_0032503_1877_2683 | 263 |
| 153 | 3300049574 | Ga0501038_0016306 | Ga0501038_0016306_1013_1819 | 263 |
| 154 | 3300049575 | Ga0501039_0043830 | Ga0501039_0043830_1239_2045 | 263 |
| 155 | 3300049576 | Ga0501040_0010553 | Ga0501040_0010553_1236_2042 | 263 |
| 156 | 3300049577 | Ga0501041_0003027 | Ga0501041_0003027_6376_7182 | 263 |
| 157 | 3300049577 | Ga0501041_0248011 | Ga0501041_0248011_77_883 | 263 |
| 158 | 3300049578 | Ga0501042_0049988 | Ga0501042_0049988_1472_2278 | 263 |
| 159 | 3300049579 | Ga0501043_0025445 | Ga0501043_0025445_2944_3750 | 263 |
| 160 | 3300049580 | Ga0501046_0013541 | Ga0501046_0013541_3953_4759 | 263 |
| 161 | 3300049582 | Ga0501048_0025604 | Ga0501048_0025604_2772_3578 | 263 |
| 162 | 3300049584 | Ga0501068_0006209 | Ga0501068_0006209_1831_2637 | 263 |
| 163 | 3300049587 | Ga0501071_0023087 | Ga0501071_0023087_1110_1916 | 263 |
| 164 | 3300049588 | Ga0501072_0003680 | Ga0501072_0003680_3446_4252 | 263 |
| 165 | 3300049589 | Ga0501073_0001765 | Ga0501073_0001765_1712_2524 | 263 |
| 166 | 3300049590 | Ga0501074_0088320 | Ga0501074_0088320_625_1437 | 263 |
| 167 | 3300049590 | Ga0501074_0303760 | Ga0501074_0303760_235_1041 | 263 |
| 168 | 3300049591 | Ga0501075_0005348 | Ga0501075_0005348_832_1638 | 263 |
| 169 | 3300049592 | Ga0501076_0001848 | Ga0501076_0001848_8177_8983 | 263 |
| 170 | 3300049592 | Ga0501076_0100568 | Ga0501076_0100568_1225_2037 | 263 |
| 171 | 3300049593 | Ga0501077_0048602 | Ga0501077_0048602_505_1311 | 263 |
| 172 | 3300049741 | Ga0501079_0002227 | Ga0501079_0002227_8317_9123 | 263 |
| 173 | 3300049742 | Ga0501080_0016847 | Ga0501080_0016847_5605_6417 | 263 |
| 174 | 3300049742 | Ga0501080_0042873 | Ga0501080_0042873_951_1757 | 263 |
| 175 | 3300049743 | Ga0501081_0001203 | Ga0501081_0001203_7217_8023 | 263 |
| 176 | 3300049822 | Ga0501035_0042097 | Ga0501035_0042097_2776_3582 | 263 |
| 177 | 3300049824 | Ga0501045_0002006 | Ga0501045_0002006_7663_8469 | 263 |
| 178 | 3300054114 | Ga0501084_0035527 | Ga0501084_0035527_2399_3205 | 263 |
| 179 | 3300054114 | Ga0501084_0271580 | Ga0501084_0271580_513_1325 | 263 |
| 180 | 3300060353 | Ga0501082_0005387 | Ga0501082_0005387_3318_4130 | 263 |
| 181 | 3300060353 | Ga0501082_0009378 | Ga0501082_0009378_315_1121 | 263 |
| 182 | 3300061734 | Ga0530510_0002356 | Ga0530510_0002356_4231_5037 | 263 |
| 183 | iso_pu_bacteria | 2574179768 | 2574430386 | 263 |
| 184 | iso_pu_bacteria | 639633007 | 639788199 | 263 |
| 185 | 3300005327 | Ga0070658_10355131 | Ga0070658_103551311 | 264 |
| 186 | 3300037312 | Ga0395899_0000083 | Ga0395899_0000083_69621_70415 | 264 |
| 187 | 3300037418 | Ga0395900_0000004 | Ga0395900_0000004_91227_92021 | 264 |
| 188 | 3300037466 | Ga0395898_0007994 | Ga0395898_0007994_6498_7292 | 264 |
| 189 | 3300037471 | Ga0395905_0006577 | Ga0395905_0006577_4055_4849 | 264 |
| 190 | 3300038443 | Ga0395901_0000005 | Ga0395901_0000005_473557_474351 | 264 |
| 191 | 3300049578 | Ga0501042_0204544 | Ga0501042_0204544_245_1054 | 264 |
| 192 | 3300049591 | Ga0501075_0218527 | Ga0501075_0218527_150_959 | 264 |
| 193 | 3300005471 | Ga0070698_100697713 | Ga0070698_1006977131 | 265 |
| 194 | 3300025915 | Ga0207693_10010808 | Ga0207693_100108087 | 265 |
| 195 | 3300037853 | Ga0436364_0520633 | Ga0436364_0520633_33709_34515 | 265 |
| 196 | 3300005295 | Ga0065707_10189649 | Ga0065707_101896491 | 266 |
| 197 | 3300005328 | Ga0070676_10074423 | Ga0070676_100744232 | 266 |
| 198 | 3300005329 | Ga0070683_100081901 | Ga0070683_1000819015 | 266 |
| 199 | 3300005353 | Ga0070669_100012661 | Ga0070669_1000126616 | 266 |
| 200 | 3300005354 | Ga0070675_100017989 | Ga0070675_1000179893 | 266 |
| 201 | 3300005441 | Ga0070700_100004767 | Ga0070700_10000476710 | 266 |
| 202 | 3300005441 | Ga0070700_100074711 | Ga0070700_1000747113 | 266 |
| 203 | 3300005441 | Ga0070700_100271981 | Ga0070700_1002719812 | 266 |
| 204 | 3300005459 | Ga0068867_100092559 | Ga0068867_1000925593 | 266 |
| 205 | 3300005535 | Ga0070684_100029369 | Ga0070684_1000293695 | 266 |
| 206 | 3300005544 | Ga0070686_100063806 | Ga0070686_1000638064 | 266 |
| 207 | 3300005844 | Ga0068862_100021685 | Ga0068862_1000216852 | 266 |
| 208 | 3300006358 | Ga0068871_100004129 | Ga0068871_10000412914 | 266 |
| 209 | 3300006846 | Ga0075430_100407287 | Ga0075430_1004072872 | 266 |
| 210 | 3300006880 | Ga0075429_100204237 | Ga0075429_1002042371 | 266 |
| 211 | 3300009094 | Ga0111539_10183863 | Ga0111539_101838633 | 266 |
| 212 | 3300009094 | Ga0111539_10235839 | Ga0111539_102358391 | 266 |
| 213 | 3300009147 | Ga0114129_10569614 | Ga0114129_105696143 | 266 |
| 214 | 3300009147 | Ga0114129_11184753 | Ga0114129_111847531 | 266 |
| 215 | 3300009148 | Ga0105243_10005348 | Ga0105243_1000534813 | 266 |
| 216 | 3300009553 | Ga0105249_10093109 | Ga0105249_100931093 | 266 |
| 217 | 3300014326 | Ga0157380_10281170 | Ga0157380_102811702 | 266 |
| 218 | 3300014745 | Ga0157377_10070040 | Ga0157377_100700403 | 266 |
| 219 | 3300014969 | Ga0157376_10016839 | Ga0157376_100168396 | 266 |
| 220 | 3300017792 | Ga0163161_10191800 | Ga0163161_101918002 | 266 |
| 221 | 3300025901 | Ga0207688_10059627 | Ga0207688_100596272 | 266 |
| 222 | 3300025908 | Ga0207643_10027597 | Ga0207643_100275974 | 266 |
| 223 | 3300025926 | Ga0207659_10050777 | Ga0207659_100507773 | 266 |
| 224 | 3300025936 | Ga0207670_10042092 | Ga0207670_100420923 | 266 |
| 225 | 3300025944 | Ga0207661_10062077 | Ga0207661_100620771 | 266 |
| 226 | 3300026089 | Ga0207648_10040011 | Ga0207648_100400113 | 266 |
| 227 | 3300026116 | Ga0207674_10305456 | Ga0207674_103054562 | 266 |
| 228 | 3300027665 | Ga0209983_1041983 | Ga0209983_10419831 | 266 |
| 229 | 3300027682 | Ga0209971_1006235 | Ga0209971_10062353 | 266 |
| 230 | 3300027907 | Ga0207428_10312657 | Ga0207428_103126572 | 266 |
| 231 | 3300028380 | Ga0268265_10015648 | Ga0268265_100156485 | 266 |
| 232 | 3300034816 | Ga0373930_0016234 | Ga0373930_0016234_317_1123 | 266 |
| 233 | 3300035085 | Ga0373929_0017199 | Ga0373929_0017199_359_1165 | 266 |
| 234 | 3300035114 | Ga0373939_0077250 | Ga0373939_0077250_29_835 | 266 |
| 235 | 3300035121 | Ga0373960_0011725 | Ga0373960_0011725_986_1792 | 266 |
| 236 | 3300035207 | Ga0373942_0007700 | Ga0373942_0007700_993_1799 | 266 |
| 237 | 3300035241 | Ga0373961_0003399 | Ga0373961_0003399_2756_3562 | 266 |
| 238 | 3300035691 | Ga0373931_0069935 | Ga0373931_0069935_65_871 | 266 |
| 239 | 3300038726 | Ga0400490_25320 | Ga0400490_25320_22634_23446 | 266 |
| 240 | 3300038741 | Ga0400488_15777 | Ga0400488_15777_173_988 | 266 |
| 241 | 3300039110 | Ga0400487_00056 | Ga0400487_00056_310_1125 | 266 |
| 242 | 3300039110 | Ga0400487_32217 | Ga0400487_32217_19040_19852 | 266 |
| 243 | 3300039110 | Ga0400487_56403 | Ga0400487_56403_1666_2481 | 266 |
| 244 | 3300039110 | Ga0400487_61000 | Ga0400487_61000_6401_7216 | 266 |
| 245 | 3300042436 | Ga0439435_0098916 | Ga0439435_0098916_57_863 | 266 |
| 246 | 3300042437 | Ga0439444_0007395 | Ga0439444_0007395_241_1047 | 266 |
| 247 | 3300046684 | Ga0495669_0066751 | Ga0495669_0066751_358_1164 | 266 |
| 248 | 3300049572 | Ga0501036_0036210 | Ga0501036_0036210_1458_2288 | 266 |
| 249 | 3300049575 | Ga0501039_0055148 | Ga0501039_0055148_1316_2146 | 266 |
| 250 | 3300049576 | Ga0501040_0011884 | Ga0501040_0011884_931_1761 | 266 |
| 251 | 3300049577 | Ga0501041_0015002 | Ga0501041_0015002_3446_4276 | 266 |
| 252 | 3300049578 | Ga0501042_0183908 | Ga0501042_0183908_130_936 | 266 |
| 253 | 3300049578 | Ga0501042_0204946 | Ga0501042_0204946_579_1409 | 266 |
| 254 | 3300049580 | Ga0501046_0073254 | Ga0501046_0073254_1049_1879 | 266 |
| 255 | 3300049580 | Ga0501046_0173405 | Ga0501046_0173405_577_1383 | 266 |
| 256 | 3300049582 | Ga0501048_0014265 | Ga0501048_0014265_4571_5401 | 266 |
| 257 | 3300049587 | Ga0501071_0046233 | Ga0501071_0046233_1385_2215 | 266 |
| 258 | 3300049588 | Ga0501072_0010859 | Ga0501072_0010859_1366_2196 | 266 |
| 259 | 3300049592 | Ga0501076_0005337 | Ga0501076_0005337_7401_8231 | 266 |
| 260 | 3300049741 | Ga0501079_0019505 | Ga0501079_0019505_1829_2659 | 266 |
| 261 | 3300049743 | Ga0501081_0007381 | Ga0501081_0007381_63_893 | 266 |
| 262 | 3300049824 | Ga0501045_0187247 | Ga0501045_0187247_675_1481 | 266 |
| 263 | 3300050508 | nmdc:mga09592_179312_c1 | nmdc:mga09592_179312_c1_712_1518 | 266 |
| 264 | 3300050511 | nmdc:mga08y16_216192_c1 | nmdc:mga08y16_216192_c1_1130_1936 | 266 |
| 265 | 3300050511 | nmdc:mga08y16_554417_c1 | nmdc:mga08y16_554417_c1_28_834 | 266 |
| 266 | 3300054114 | Ga0501084_0286014 | Ga0501084_0286014_528_1334 | 266 |
| 267 | 3300060353 | Ga0501082_0195109 | Ga0501082_0195109_99_929 | 266 |
| 268 | 3300061734 | Ga0530510_0107872 | Ga0530510_0107872_1192_2022 | 266 |
| 269 | 3300061734 | Ga0530510_0426278 | Ga0530510_0426278_67_873 | 266 |
| 270 | 3300001991 | JGI24743J22301_10016923 | JGI24743J22301_100169232 | 267 |
| 271 | 3300005331 | Ga0070670_100005792 | Ga0070670_1000057929 | 267 |
| 272 | 3300005331 | Ga0070670_100106297 | Ga0070670_1001062972 | 267 |
| 273 | 3300005334 | Ga0068869_100098129 | Ga0068869_1000981292 | 267 |
| 274 | 3300005337 | Ga0070682_100117882 | Ga0070682_1001178822 | 267 |
| 275 | 3300005339 | Ga0070660_100341236 | Ga0070660_1003412362 | 267 |
| 276 | 3300005345 | Ga0070692_10043979 | Ga0070692_100439792 | 267 |
| 277 | 3300005347 | Ga0070668_100087441 | Ga0070668_1000874412 | 267 |
| 278 | 3300005354 | Ga0070675_100123479 | Ga0070675_1001234792 | 267 |
| 279 | 3300005355 | Ga0070671_100272069 | Ga0070671_1002720692 | 267 |
| 280 | 3300005356 | Ga0070674_100408269 | Ga0070674_1004082691 | 267 |
| 281 | 3300005366 | Ga0070659_100464721 | Ga0070659_1004647212 | 267 |
| 282 | 3300005367 | Ga0070667_100223219 | Ga0070667_1002232192 | 267 |
| 283 | 3300005435 | Ga0070714_100340997 | Ga0070714_1003409971 | 267 |
| 284 | 3300005436 | Ga0070713_100035696 | Ga0070713_1000356963 | 267 |
| 285 | 3300005445 | Ga0070708_100118886 | Ga0070708_1001188862 | 267 |
| 286 | 3300005467 | Ga0070706_100405989 | Ga0070706_1004059891 | 267 |
| 287 | 3300005518 | Ga0070699_100054655 | Ga0070699_1000546553 | 267 |
| 288 | 3300005536 | Ga0070697_100024841 | Ga0070697_1000248415 | 267 |
| 289 | 3300005548 | Ga0070665_100156180 | Ga0070665_1001561802 | 267 |
| 290 | 3300005614 | Ga0068856_100363491 | Ga0068856_1003634912 | 267 |
| 291 | 3300005617 | Ga0068859_100164123 | Ga0068859_1001641232 | 267 |
| 292 | 3300005618 | Ga0068864_100171841 | Ga0068864_1001718412 | 267 |
| 293 | 3300005718 | Ga0068866_10319939 | Ga0068866_103199392 | 267 |
| 294 | 3300005719 | Ga0068861_100619764 | Ga0068861_1006197642 | 267 |
| 295 | 3300005840 | Ga0068870_10112520 | Ga0068870_101125202 | 267 |
| 296 | 3300005844 | Ga0068862_100153892 | Ga0068862_1001538922 | 267 |
| 297 | 3300005937 | Ga0081455_10000811 | Ga0081455_1000081113 | 267 |
| 298 | 3300005937 | Ga0081455_10005965 | Ga0081455_1000596512 | 267 |
| 299 | 3300006038 | Ga0075365_10267011 | Ga0075365_102670112 | 267 |
| 300 | 3300006038 | Ga0075365_10356144 | Ga0075365_103561441 | 267 |
| 301 | 3300006175 | Ga0070712_100294553 | Ga0070712_1002945532 | 267 |
| 302 | 3300006237 | Ga0097621_100274829 | Ga0097621_1002748292 | 267 |
| 303 | 3300006844 | Ga0075428_100057649 | Ga0075428_1000576495 | 267 |
| 304 | 3300006844 | Ga0075428_100138237 | Ga0075428_1001382373 | 267 |
| 305 | 3300006844 | Ga0075428_100224136 | Ga0075428_1002241363 | 267 |
| 306 | 3300006846 | Ga0075430_100022060 | Ga0075430_1000220603 | 267 |
| 307 | 3300006846 | Ga0075430_100152968 | Ga0075430_1001529681 | 267 |
| 308 | 3300006847 | Ga0075431_100024205 | Ga0075431_1000242055 | 267 |
| 309 | 3300006847 | Ga0075431_100034351 | Ga0075431_1000343514 | 267 |
| 310 | 3300006847 | Ga0075431_100088529 | Ga0075431_1000885292 | 267 |
| 311 | 3300006871 | Ga0075434_100041044 | Ga0075434_1000410442 | 267 |
| 312 | 3300006880 | Ga0075429_100010864 | Ga0075429_1000108642 | 267 |
| 313 | 3300006931 | Ga0097620_100164122 | Ga0097620_1001641222 | 267 |
| 314 | 3300009093 | Ga0105240_10130864 | Ga0105240_101308642 | 267 |
| 315 | 3300009093 | Ga0105240_10528113 | Ga0105240_105281132 | 267 |
| 316 | 3300009094 | Ga0111539_10364783 | Ga0111539_103647832 | 267 |
| 317 | 3300009147 | Ga0114129_10033312 | Ga0114129_100333125 | 267 |
| 318 | 3300009147 | Ga0114129_10046783 | Ga0114129_100467835 | 267 |
| 319 | 3300009147 | Ga0114129_10049896 | Ga0114129_100498962 | 267 |
| 320 | 3300009147 | Ga0114129_10153397 | Ga0114129_101533972 | 267 |
| 321 | 3300009148 | Ga0105243_10310460 | Ga0105243_103104602 | 267 |
| 322 | 3300009551 | Ga0105238_10000267 | Ga0105238_1000026727 | 267 |
| 323 | 3300009551 | Ga0105238_10623519 | Ga0105238_106235191 | 267 |
| 324 | 3300009553 | Ga0105249_10162886 | Ga0105249_101628862 | 267 |
| 325 | 3300011119 | Ga0105246_10073623 | Ga0105246_100736232 | 267 |
| 326 | 3300013297 | Ga0157378_10145209 | Ga0157378_101452092 | 267 |
| 327 | 3300013306 | Ga0163162_10464899 | Ga0163162_104648992 | 267 |
| 328 | 3300014326 | Ga0157380_10230710 | Ga0157380_102307102 | 267 |
| 329 | 3300014745 | Ga0157377_10069056 | Ga0157377_100690562 | 267 |
| 330 | 3300014968 | Ga0157379_10240680 | Ga0157379_102406802 | 267 |
| 331 | 3300014969 | Ga0157376_10192097 | Ga0157376_101920972 | 267 |
| 332 | 3300025885 | Ga0207653_10010554 | Ga0207653_100105542 | 267 |
| 333 | 3300025893 | Ga0207682_10071454 | Ga0207682_100714541 | 267 |
| 334 | 3300025904 | Ga0207647_10070436 | Ga0207647_100704362 | 267 |
| 335 | 3300025907 | Ga0207645_10007804 | Ga0207645_100078042 | 267 |
| 336 | 3300025908 | Ga0207643_10001647 | Ga0207643_1000164710 | 267 |
| 337 | 3300025910 | Ga0207684_10014921 | Ga0207684_100149213 | 267 |
| 338 | 3300025913 | Ga0207695_10098495 | Ga0207695_100984952 | 267 |
| 339 | 3300025915 | Ga0207693_10032535 | Ga0207693_100325354 | 267 |
| 340 | 3300025918 | Ga0207662_10009149 | Ga0207662_100091492 | 267 |
| 341 | 3300025919 | Ga0207657_10034284 | Ga0207657_100342842 | 267 |
| 342 | 3300025924 | Ga0207694_10003702 | Ga0207694_100037025 | 267 |
| 343 | 3300025925 | Ga0207650_10018120 | Ga0207650_100181205 | 267 |
| 344 | 3300025925 | Ga0207650_10141920 | Ga0207650_101419202 | 267 |
| 345 | 3300025926 | Ga0207659_10149501 | Ga0207659_101495012 | 267 |
| 346 | 3300025931 | Ga0207644_10239768 | Ga0207644_102397681 | 267 |
| 347 | 3300025933 | Ga0207706_10031576 | Ga0207706_100315765 | 267 |
| 348 | 3300025940 | Ga0207691_10099308 | Ga0207691_100993082 | 267 |
| 349 | 3300025941 | Ga0207711_10232344 | Ga0207711_102323442 | 267 |
| 350 | 3300025942 | Ga0207689_10033977 | Ga0207689_100339772 | 267 |
| 351 | 3300025945 | Ga0207679_10105418 | Ga0207679_101054182 | 267 |
| 352 | 3300025986 | Ga0207658_10226656 | Ga0207658_102266562 | 267 |
| 353 | 3300026041 | Ga0207639_10042634 | Ga0207639_100426342 | 267 |
| 354 | 3300026075 | Ga0207708_10071299 | Ga0207708_100712992 | 267 |
| 355 | 3300026089 | Ga0207648_10042704 | Ga0207648_100427042 | 267 |
| 356 | 3300026095 | Ga0207676_10206255 | Ga0207676_102062552 | 267 |
| 357 | 3300026116 | Ga0207674_10047208 | Ga0207674_100472084 | 267 |
| 358 | 3300026118 | Ga0207675_100006871 | Ga0207675_1000068719 | 267 |
| 359 | 3300026121 | Ga0207683_10185011 | Ga0207683_101850112 | 267 |
| 360 | 3300041512 | Ga0451853_1145584 | Ga0451853_1145584_502_1323 | 267 |
| 361 | 3300046463 | Ga0495653_0088300 | Ga0495653_0088300_16_879 | 267 |
| 362 | 3300046474 | Ga0495605_0055179 | Ga0495605_0055179_899_1705 | 267 |
| 363 | 3300046513 | Ga0495616_0077305 | Ga0495616_0077305_101_922 | 267 |
| 364 | 3300046516 | Ga0495628_0162302 | Ga0495628_0162302_350_1171 | 267 |
| 365 | 3300046615 | Ga0495656_0004258 | Ga0495656_0004258_401_1222 | 267 |
| 366 | 3300046615 | Ga0495656_0160274 | Ga0495656_0160274_258_1064 | 267 |
| 367 | 3300047322 | Ga0495680_0083319 | Ga0495680_0083319_1329_2135 | 267 |
| 368 | 3300048903 | Ga0496100_0155798 | Ga0496100_0155798_501_1322 | 267 |
| 369 | 3300048904 | Ga0496101_0038952 | Ga0496101_0038952_662_1483 | 267 |
| 370 | 3300048906 | Ga0496103_0001026 | Ga0496103_0001026_2525_3346 | 267 |
| 371 | 3300048907 | Ga0496104_0016013 | Ga0496104_0016013_3214_4092 | 267 |
| 372 | 3300048907 | Ga0496104_0103414 | Ga0496104_0103414_540_1361 | 267 |
| 373 | 3300048907 | Ga0496104_0195548 | Ga0496104_0195548_563_1369 | 267 |
| 374 | 3300048908 | Ga0496105_0004542 | Ga0496105_0004542_457_1320 | 267 |
| 375 | 3300048909 | Ga0496106_0132751 | Ga0496106_0132751_923_1744 | 267 |
| 376 | 3300048910 | Ga0496107_0333108 | Ga0496107_0333108_164_970 | 267 |
| 377 | 3300048911 | Ga0496108_0000552 | Ga0496108_0000552_4041_4904 | 267 |
| 378 | 3300048911 | Ga0496108_0248410 | Ga0496108_0248410_255_1076 | 267 |
| 379 | 3300048912 | Ga0496109_0002241 | Ga0496109_0002241_11727_12605 | 267 |
| 380 | 3300048913 | Ga0496110_0018928 | Ga0496110_0018928_2833_3639 | 267 |
| 381 | 3300048914 | Ga0496111_0008382 | Ga0496111_0008382_1654_2517 | 267 |
| 382 | 3300048914 | Ga0496111_0086659 | Ga0496111_0086659_969_1775 | 267 |
| 383 | 3300048916 | Ga0496113_0001551 | Ga0496113_0001551_7740_8603 | 267 |
| 384 | 3300048917 | Ga0496114_0056970 | Ga0496114_0056970_401_1207 | 267 |
| 385 | 3300049741 | Ga0501079_0080697 | Ga0501079_0080697_1088_1894 | 267 |
| 386 | 3300050492 | nmdc:mga0yw44_342574_c1 | nmdc:mga0yw44_342574_c1_41_862 | 267 |
| 387 | 3300050492 | nmdc:mga0yw44_6236_c1 | nmdc:mga0yw44_6236_c1_2207_3013 | 267 |
| 388 | 3300050507 | nmdc:mga05p37_115151_c1 | nmdc:mga05p37_115151_c1_961_1839 | 267 |
| 389 | 3300050507 | nmdc:mga05p37_313130_c1 | nmdc:mga05p37_313130_c1_485_1291 | 267 |
| 390 | 3300050507 | nmdc:mga05p37_434958_c1 | nmdc:mga05p37_434958_c1_596_1402 | 267 |
| 391 | 3300050507 | nmdc:mga05p37_631204_c1 | nmdc:mga05p37_631204_c1_321_1127 | 267 |
| 392 | 3300050508 | nmdc:mga09592_97792_c1 | nmdc:mga09592_97792_c1_1559_2365 | 267 |
| 393 | 3300050509 | nmdc:mga0qj67_134974_c1 | nmdc:mga0qj67_134974_c1_434_1240 | 267 |
| 394 | 3300050509 | nmdc:mga0qj67_47653_c1 | nmdc:mga0qj67_47653_c1_1442_2248 | 267 |
| 395 | 3300050510 | nmdc:mga06r32_35869_c1 | nmdc:mga06r32_35869_c1_1471_2277 | 267 |
| 396 | 3300050510 | nmdc:mga06r32_82669_c1 | nmdc:mga06r32_82669_c1_1740_2546 | 267 |
| 397 | 3300050511 | nmdc:mga08y16_154078_c1 | nmdc:mga08y16_154078_c1_990_1853 | 267 |
| 398 | 3300050515 | nmdc:mga0a205_117897_c1 | nmdc:mga0a205_117897_c1_1372_2178 | 267 |
| 399 | 3300053085 | Ga0495619_0069625 | Ga0495619_0069625_1040_1903 | 267 |
| 400 | 3300053085 | Ga0495619_0143378 | Ga0495619_0143378_617_1438 | 267 |
| 401 | 3300053091 | Ga0500647_0047266 | Ga0500647_0047266_821_1633 | 267 |
| 402 | 3300060353 | Ga0501082_0367805 | Ga0501082_0367805_318_1124 | 267 |
| 403 | 3300061734 | Ga0530510_0264567 | Ga0530510_0264567_102_932 | 267 |
| 404 | 3300005467 | Ga0070706_100016067 | Ga0070706_1000160672 | 268 |
| 405 | 3300005471 | Ga0070698_100070901 | Ga0070698_1000709012 | 268 |
| 406 | 3300005471 | Ga0070698_100181896 | Ga0070698_1001818961 | 268 |
| 407 | 3300006028 | Ga0070717_10264506 | Ga0070717_102645061 | 268 |
| 408 | 3300006028 | Ga0070717_10446103 | Ga0070717_104461032 | 268 |
| 409 | 3300009545 | Ga0105237_10211517 | Ga0105237_102115172 | 268 |
| 410 | 3300025910 | Ga0207684_10035583 | Ga0207684_100355831 | 268 |
| 411 | 3300025910 | Ga0207684_10166974 | Ga0207684_101669741 | 268 |
| 412 | 3300035170 | Ga0373943_0012079 | Ga0373943_0012079_2881_3705 | 268 |
| 413 | 3300035170 | Ga0373943_0042609 | Ga0373943_0042609_506_1315 | 268 |
| 414 | 3300035171 | Ga0373946_0175705 | Ga0373946_0175705_41_865 | 268 |
| 415 | 3300035692 | Ga0373935_0024433 | Ga0373935_0024433_2278_3102 | 268 |
| 416 | 3300035695 | Ga0373927_0141211 | Ga0373927_0141211_467_1291 | 268 |
| 417 | 3300035725 | Ga0373947_0015100 | Ga0373947_0015100_1086_1910 | 268 |
| 418 | 3300035725 | Ga0373947_0025699 | Ga0373947_0025699_1498_2307 | 268 |
| 419 | 3300037068 | Ga0373925_0034944 | Ga0373925_0034944_17_826 | 268 |
| 420 | 3300037068 | Ga0373925_0133081 | Ga0373925_0133081_480_1304 | 268 |
| 421 | 3300038443 | Ga0395901_0018973 | Ga0395901_0018973_3331_4140 | 268 |
| 422 | 3300039438 | Ga0436360_0454558 | Ga0436360_0454558_1163_1969 | 268 |
| 423 | 3300044656 | Ga0466969_0097777 | Ga0466969_0097777_15_824 | 268 |
| 424 | 3300044765 | Ga0466970_0028743 | Ga0466970_0028743_66_875 | 268 |
| 425 | 3300045049 | Ga0466959_0001806 | Ga0466959_0001806_60_869 | 268 |
| 426 | 3300046455 | Ga0495603_0087466 | Ga0495603_0087466_476_1300 | 268 |
| 427 | 3300046475 | Ga0495639_0068584 | Ga0495639_0068584_202_1011 | 268 |
| 428 | 3300046476 | Ga0495662_0165298 | Ga0495662_0165298_70_936 | 268 |
| 429 | 3300046491 | Ga0495584_0043813 | Ga0495584_0043813_698_1507 | 268 |
| 430 | 3300046492 | Ga0495585_0014506 | Ga0495585_0014506_3714_4523 | 268 |
| 431 | 3300046499 | Ga0495594_0081541 | Ga0495594_0081541_641_1465 | 268 |
| 432 | 3300046500 | Ga0495596_0063233 | Ga0495596_0063233_88_912 | 268 |
| 433 | 3300046523 | Ga0495644_0022053 | Ga0495644_0022053_1468_2292 | 268 |
| 434 | 3300046525 | Ga0495663_0068550 | Ga0495663_0068550_46_855 | 268 |
| 435 | 3300046531 | Ga0495665_0081285 | Ga0495665_0081285_34_858 | 268 |
| 436 | 3300046615 | Ga0495656_0022509 | Ga0495656_0022509_1116_1925 | 268 |
| 437 | 3300046674 | Ga0495588_0006437 | Ga0495588_0006437_2471_3295 | 268 |
| 438 | 3300046690 | Ga0495624_0022066 | Ga0495624_0022066_443_1267 | 268 |
| 439 | 3300046691 | Ga0495670_0073480 | Ga0495670_0073480_532_1356 | 268 |
| 440 | 3300046810 | Ga0495660_0117851 | Ga0495660_0117851_295_1119 | 268 |
| 441 | 3300047315 | Ga0495581_0071680 | Ga0495581_0071680_210_1091 | 268 |
| 442 | 3300047321 | Ga0495676_0026477 | Ga0495676_0026477_2374_3198 | 268 |
| 443 | 3300047446 | Ga0495679_049837 | Ga0495679_049837_175_999 | 268 |
| 444 | 3300047471 | Ga0495684_0133945 | Ga0495684_0133945_44_925 | 268 |
| 445 | 3300048904 | Ga0496101_0072781 | Ga0496101_0072781_705_1571 | 268 |
| 446 | 3300049592 | Ga0501076_0277529 | Ga0501076_0277529_171_980 | 268 |
| 447 | 3300054114 | Ga0501084_0256898 | Ga0501084_0256898_630_1439 | 268 |
| 448 | 3300061719 | Ga0466962_0002588 | Ga0466962_0002588_1972_2781 | 268 |
| 449 | 3300061734 | Ga0530510_0042674 | Ga0530510_0042674_360_1169 | 268 |
| 450 | 3300001979 | JGI24740J21852_10011937 | JGI24740J21852_100119373 | 269 |
| 451 | 3300001989 | JGI24739J22299_10001070 | JGI24739J22299_100010705 | 269 |
| 452 | 3300001990 | JGI24737J22298_10029437 | JGI24737J22298_100294372 | 269 |
| 453 | 3300002067 | JGI24735J21928_10019519 | JGI24735J21928_100195191 | 269 |
| 454 | 3300005327 | Ga0070658_10282165 | Ga0070658_102821651 | 269 |
| 455 | 3300005333 | Ga0070677_10041197 | Ga0070677_100411972 | 269 |
| 456 | 3300005354 | Ga0070675_100172049 | Ga0070675_1001720492 | 269 |
| 457 | 3300005355 | Ga0070671_100094667 | Ga0070671_1000946672 | 269 |
| 458 | 3300005356 | Ga0070674_100013196 | Ga0070674_1000131965 | 269 |
| 459 | 3300005367 | Ga0070667_100129568 | Ga0070667_1001295682 | 269 |
| 460 | 3300005455 | Ga0070663_100076663 | Ga0070663_1000766631 | 269 |
| 461 | 3300005457 | Ga0070662_100009490 | Ga0070662_1000094901 | 269 |
| 462 | 3300005459 | Ga0068867_100188668 | Ga0068867_1001886681 | 269 |
| 463 | 3300005539 | Ga0068853_100023049 | Ga0068853_1000230492 | 269 |
| 464 | 3300005563 | Ga0068855_100007104 | Ga0068855_10000710413 | 269 |
| 465 | 3300005577 | Ga0068857_100002731 | Ga0068857_1000027313 | 269 |
| 466 | 3300005618 | Ga0068864_100069037 | Ga0068864_1000690374 | 269 |
| 467 | 3300005719 | Ga0068861_100009730 | Ga0068861_1000097302 | 269 |
| 468 | 3300005834 | Ga0068851_10002665 | Ga0068851_100026655 | 269 |
| 469 | 3300009011 | Ga0105251_10049031 | Ga0105251_100490312 | 269 |
| 470 | 3300009093 | Ga0105240_10014186 | Ga0105240_1001418611 | 269 |
| 471 | 3300009093 | Ga0105240_10020530 | Ga0105240_100205305 | 269 |
| 472 | 3300009177 | Ga0105248_10100766 | Ga0105248_101007663 | 269 |
| 473 | 3300009177 | Ga0105248_10188225 | Ga0105248_101882253 | 269 |
| 474 | 3300009545 | Ga0105237_10005308 | Ga0105237_100053082 | 269 |
| 475 | 3300009551 | Ga0105238_10008830 | Ga0105238_100088304 | 269 |
| 476 | 3300009551 | Ga0105238_10014255 | Ga0105238_100142553 | 269 |
| 477 | 3300009551 | Ga0105238_10060087 | Ga0105238_100600873 | 269 |
| 478 | 3300010375 | Ga0105239_10009260 | Ga0105239_100092602 | 269 |
| 479 | 3300010375 | Ga0105239_10013296 | Ga0105239_100132962 | 269 |
| 480 | 3300013308 | Ga0157375_10003266 | Ga0157375_100032664 | 269 |
| 481 | 3300013308 | Ga0157375_10946667 | Ga0157375_109466672 | 269 |
| 482 | 3300017792 | Ga0163161_10075741 | Ga0163161_100757413 | 269 |
| 483 | 3300025893 | Ga0207682_10007892 | Ga0207682_100078923 | 269 |
| 484 | 3300025904 | Ga0207647_10000127 | Ga0207647_1000012741 | 269 |
| 485 | 3300025907 | Ga0207645_10214386 | Ga0207645_102143862 | 269 |
| 486 | 3300025911 | Ga0207654_10000081 | Ga0207654_1000008161 | 269 |
| 487 | 3300025913 | Ga0207695_10052319 | Ga0207695_100523192 | 269 |
| 488 | 3300025913 | Ga0207695_10067580 | Ga0207695_100675804 | 269 |
| 489 | 3300025914 | Ga0207671_10086181 | Ga0207671_100861811 | 269 |
| 490 | 3300025914 | Ga0207671_10143048 | Ga0207671_101430482 | 269 |
| 491 | 3300025923 | Ga0207681_10032058 | Ga0207681_100320584 | 269 |
| 492 | 3300025924 | Ga0207694_10000134 | Ga0207694_1000013413 | 269 |
| 493 | 3300025926 | Ga0207659_10347444 | Ga0207659_103474442 | 269 |
| 494 | 3300025931 | Ga0207644_10109716 | Ga0207644_101097162 | 269 |
| 495 | 3300025937 | Ga0207669_10194765 | Ga0207669_101947652 | 269 |
| 496 | 3300025941 | Ga0207711_10055387 | Ga0207711_100553872 | 269 |
| 497 | 3300025949 | Ga0207667_10001417 | Ga0207667_1000141730 | 269 |
| 498 | 3300025949 | Ga0207667_10032615 | Ga0207667_100326153 | 269 |
| 499 | 3300025960 | Ga0207651_10081004 | Ga0207651_100810042 | 269 |
| 500 | 3300025981 | Ga0207640_10011101 | Ga0207640_100111014 | 269 |
| 501 | 3300026035 | Ga0207703_10462271 | Ga0207703_104622711 | 269 |
| 502 | 3300026041 | Ga0207639_10017795 | Ga0207639_100177953 | 269 |
| 503 | 3300026041 | Ga0207639_10154118 | Ga0207639_101541182 | 269 |
| 504 | 3300026067 | Ga0207678_10056749 | Ga0207678_100567492 | 269 |
| 505 | 3300026067 | Ga0207678_10232509 | Ga0207678_102325091 | 269 |
| 506 | 3300026078 | Ga0207702_10000180 | Ga0207702_1000018013 | 269 |
| 507 | 3300026078 | Ga0207702_10073499 | Ga0207702_100734992 | 269 |
| 508 | 3300026089 | Ga0207648_10097754 | Ga0207648_100977542 | 269 |
| 509 | 3300026095 | Ga0207676_10116646 | Ga0207676_101166462 | 269 |
| 510 | 3300026116 | Ga0207674_10001278 | Ga0207674_1000127815 | 269 |
| 511 | 3300026118 | Ga0207675_100017479 | Ga0207675_1000174792 | 269 |
| 512 | 3300026121 | Ga0207683_10494082 | Ga0207683_104940821 | 269 |
| 513 | 3300031711 | Ga0265314_10004840 | Ga0265314_100048408 | 269 |
| 514 | 3300031731 | Ga0307405_10005061 | Ga0307405_100050615 | 269 |
| 515 | 3300031852 | Ga0307410_10013156 | Ga0307410_100131566 | 269 |
| 516 | 3300031903 | Ga0307407_10046811 | Ga0307407_100468112 | 269 |
| 517 | 3300031995 | Ga0307409_100020544 | Ga0307409_1000205442 | 269 |
| 518 | 3300032002 | Ga0307416_100099944 | Ga0307416_1000999441 | 269 |
| 519 | 3300032004 | Ga0307414_10113758 | Ga0307414_101137582 | 269 |
| 520 | 3300032005 | Ga0307411_10059859 | Ga0307411_100598592 | 269 |
| 521 | 3300037418 | Ga0395900_0282554 | Ga0395900_0282554_604_1416 | 269 |
| 522 | 3300046455 | Ga0495603_0164097 | Ga0495603_0164097_218_1030 | 269 |
| 523 | 3300046460 | Ga0495638_0006033 | Ga0495638_0006033_2259_3092 | 269 |
| 524 | 3300046474 | Ga0495605_0001268 | Ga0495605_0001268_1388_2221 | 269 |
| 525 | 3300046523 | Ga0495644_0008346 | Ga0495644_0008346_247_1080 | 269 |
| 526 | 3300046530 | Ga0495654_0153970 | Ga0495654_0153970_157_990 | 269 |
| 527 | 3300046539 | Ga0495621_0028363 | Ga0495621_0028363_944_1756 | 269 |
| 528 | 3300046542 | Ga0495597_0044494 | Ga0495597_0044494_1100_1933 | 269 |
| 529 | 3300046684 | Ga0495669_0042113 | Ga0495669_0042113_871_1704 | 269 |
| 530 | 3300046691 | Ga0495670_0115798 | Ga0495670_0115798_113_925 | 269 |
| 531 | 3300046794 | Ga0495589_0013321 | Ga0495589_0013321_1304_2137 | 269 |
| 532 | 3300047320 | Ga0495672_0043292 | Ga0495672_0043292_101_1036 | 269 |
| 533 | 3300049579 | Ga0501043_0000053 | Ga0501043_0000053_52319_53185 | 269 |
| 534 | 3300049580 | Ga0501046_0000018 | Ga0501046_0000018_13104_13970 | 269 |
| 535 | 3300049581 | Ga0501047_0000020 | Ga0501047_0000020_51913_52779 | 269 |
| 536 | 3300049582 | Ga0501048_0000795 | Ga0501048_0000795_13545_14411 | 269 |
| 537 | 3300049823 | Ga0501044_0076161 | Ga0501044_0076161_238_1104 | 269 |
| 538 | 3300049824 | Ga0501045_0006612 | Ga0501045_0006612_5561_6427 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qk8-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand | 0.9746 | 6 | 263 |
| 3qk8-assembly1.cif.gz_D | crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand | 0.9714 | 6 | 264 |
| 3q1t-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from mycobacterium avium | 0.9697 | 6 | 263 |
| 7m3w-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis | 0.9693 | 2 | 264 |
| 1wz8-assembly1.cif.gz_D | crystal structure of probable enoyl-coa dehydratase from thermus thermophilus hb8 | 0.9662 | 5 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wz8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9524 | 5 | 206 | 3.90.226.10 |
| 3rrvD00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9376 | 10 | 254 | 3.90.226.10 |
| 1szoD00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9275 | 3 | 244 | 3.90.226.10 |
| 1wz8A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9257 | 5 | 206 | 3.90.226.10 |
| 3hrxF01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9239 | 11 | 209 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9Y011-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9799 | 6 | 242 |
GO:0016853
|
| AF-A0A7V3I0T4-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9785 | 65 | 267 |
GO:0016853
|
| AF-A0A521YQ15-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.978 | 1 | 268 |
GO:0016853
|
| AF-A0A7W1R674-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9777 | 1 | 243 |
GO:0016853
|
| AF-A0A4V1UHM0-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9776 | 1 | 219 |
GO:0016853
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar