F461059

General Info

Members Datasets Scaffolds Average Seq Length
538 307 536 269

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0043292|Ga0495672_0043292_101_1036
Length 311
Sequence MVGLLCGQHPYTTGPAAPISRRDEQDFAQDFSQATAPERHPMSDSLYSNYQRLRFDRPHPRVLRVTIDNPGKKNSIDEVMHPEMVRVWHDISYDDSVAAVILTGAGDAFCAGGNFEMVQQMVENHEMRMKNLREARDVVYNMINCTKPIISAVRGPAVGGGLVCALMSDISIVSKTARLIDGHTRLGLAAGDHAAIIWPLLCGMARAKYHLLMCTTITGEEAERIGLVSMAVEDSELDGKAVEIASTLADGPPTAIRLTKYTMNHWLRMAAPIFDASLAFEFHAFTGPELKEGMAAIKERRKPVFPVHSAF

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
192 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
193 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
298 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
301 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 3.72
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011937 3300001979 Bacteria 3290
2 JGI24739J22299_10001070 3300001989 Bacteria 10191
3 JGI24737J22298_10029437 3300001990 Bacteria 1722
4 JGI24743J22301_10016923 3300001991 Bacteria 1364
5 JGI24735J21928_10019519 3300002067 Bacteria 2083
6 Ga0065707_10189649 3300005295 Bacteria 1369
7 Ga0070658_10282165 3300005327 Bacteria 1414
8 Ga0070658_10355131 3300005327 Bacteria 1255
9 Ga0070676_10074423 3300005328 Bacteria 2046
10 Ga0070683_100081901 3300005329 Bacteria 3022
11 Ga0070683_100416377 3300005329 Bacteria 1282
12 Ga0070670_100005792 3300005331 Bacteria 10442
13 Ga0070670_100105190 3300005331 Bacteria 2431
14 Ga0070670_100106297 3300005331 Bacteria 2418
15 Ga0070677_10041197 3300005333 Bacteria 1822
16 Ga0068869_100098129 3300005334 Bacteria 2213
17 Ga0070666_10148035 3300005335 Bacteria 1637
18 Ga0070680_100258737 3300005336 Bacteria 1472
19 Ga0070682_100117882 3300005337 Bacteria 1778
20 Ga0070660_100059514 3300005339 Bacteria 2962
21 Ga0070660_100151508 3300005339 Bacteria 1865
22 Ga0070660_100341236 3300005339 Bacteria 1233
23 Ga0070661_100384157 3300005344 Bacteria 1107
24 Ga0070692_10043979 3300005345 Bacteria 2299
25 Ga0070668_100087441 3300005347 Bacteria 2452
26 Ga0070669_100012661 3300005353 Bacteria 5987
27 Ga0070675_100017989 3300005354 Bacteria 5624
28 Ga0070675_100123479 3300005354 Bacteria 2201
29 Ga0070675_100172049 3300005354 Bacteria 1868
30 Ga0070671_100000668 3300005355 Bacteria 24571
31 Ga0070671_100094667 3300005355 Bacteria 2504
32 Ga0070671_100272069 3300005355 Bacteria 1440
33 Ga0070671_100377399 3300005355 Bacteria 1211
34 Ga0070674_100013196 3300005356 Bacteria 5100
35 Ga0070674_100408269 3300005356 Bacteria 1111
36 Ga0070659_100168845 3300005366 Bacteria 1791
37 Ga0070659_100464721 3300005366 Bacteria 1075
38 Ga0070667_100051540 3300005367 Bacteria 3470
39 Ga0070667_100129568 3300005367 Bacteria 2201
40 Ga0070667_100223219 3300005367 Bacteria 1678
41 Ga0070709_10059343 3300005434 Bacteria 2429
42 Ga0070714_100340997 3300005435 Bacteria 1406
43 Ga0070713_100035696 3300005436 Bacteria 4005
44 Ga0070713_100041435 3300005436 Bacteria 3751
45 Ga0070710_10005767 3300005437 Bacteria 5899
46 Ga0070711_100038006 3300005439 Bacteria 3233
47 Ga0070711_100131209 3300005439 Bacteria 1866
48 Ga0070700_100004767 3300005441 Bacteria 7114
49 Ga0070700_100074711 3300005441 Bacteria 2172
50 Ga0070700_100271981 3300005441 Bacteria 1224
51 Ga0070708_100118886 3300005445 Bacteria 2435
52 Ga0070663_100076663 3300005455 Bacteria 2445
53 Ga0070662_100009490 3300005457 Bacteria 6367
54 Ga0070681_10242648 3300005458 Bacteria 1715
55 Ga0068867_100092559 3300005459 Bacteria 2296
56 Ga0068867_100188668 3300005459 Bacteria 1644
57 Ga0070706_100016067 3300005467 Bacteria 6913
58 Ga0070706_100405989 3300005467 Bacteria 1268
59 Ga0070698_100070901 3300005471 Bacteria 3496
60 Ga0070698_100181896 3300005471 Bacteria 2040
61 Ga0070698_100697713 3300005471 Bacteria 957
62 Ga0070699_100054655 3300005518 Bacteria 3456
63 Ga0070679_100110802 3300005530 Bacteria 2731
64 Ga0070684_100029369 3300005535 Bacteria 4659
65 Ga0070697_100024841 3300005536 Bacteria 4772
66 Ga0068853_100023049 3300005539 Bacteria 5208
67 Ga0070686_100063806 3300005544 Bacteria 2387
68 Ga0070696_100469746 3300005546 Bacteria 996
69 Ga0070665_100010270 3300005548 Bacteria 9473
70 Ga0070665_100041262 3300005548 Bacteria 4638
71 Ga0070665_100156180 3300005548 Bacteria 2283
72 Ga0068855_100007104 3300005563 Bacteria 13588
73 Ga0068855_100087012 3300005563 Bacteria 3612
74 Ga0068855_100452001 3300005563 Bacteria 1402
75 Ga0068857_100002731 3300005577 Bacteria 14479
76 Ga0068856_100165585 3300005614 Bacteria 2222
77 Ga0068856_100363491 3300005614 Bacteria 1466
78 Ga0068852_100508354 3300005616 Bacteria 1201
79 Ga0068859_100164123 3300005617 Bacteria 2300
80 Ga0068864_100069037 3300005618 Bacteria 3072
81 Ga0068864_100171841 3300005618 Bacteria 1976
82 Ga0068866_10319939 3300005718 Bacteria 975
83 Ga0068861_100009730 3300005719 Bacteria 6648
84 Ga0068861_100619764 3300005719 Bacteria 995
85 Ga0068851_10002665 3300005834 Bacteria 7868
86 Ga0068870_10112520 3300005840 Bacteria 1556
87 Ga0068863_100007247 3300005841 Bacteria 10867
88 Ga0068858_100001501 3300005842 Bacteria 24053
89 Ga0068860_100000887 3300005843 Bacteria 33240
90 Ga0068862_100021059 3300005844 Bacteria 5449
91 Ga0068862_100021685 3300005844 Bacteria 5372
92 Ga0068862_100153892 3300005844 Bacteria 2048
93 Ga0081455_10000811 3300005937 Bacteria 40225
94 Ga0081455_10005965 3300005937 Bacteria 13211
95 Ga0081540_1002187 3300005983 Bacteria 16167
96 Ga0070717_10007579 3300006028 Bacteria 8064
97 Ga0070717_10264506 3300006028 Bacteria 1522
98 Ga0070717_10446103 3300006028 Bacteria 1166
99 Ga0075365_10267011 3300006038 Bacteria 1203
100 Ga0075365_10356144 3300006038 Bacteria 1032
101 Ga0070715_10001047 3300006163 Bacteria 7809
102 Ga0070716_100072554 3300006173 Bacteria 2027
103 Ga0070712_100294553 3300006175 Bacteria 1311
104 Ga0097621_100274829 3300006237 Bacteria 1481
105 Ga0068871_100004129 3300006358 Bacteria 10043
106 Ga0075428_100057649 3300006844 Bacteria 4252
107 Ga0075428_100138237 3300006844 Bacteria 2649
108 Ga0075428_100224136 3300006844 Bacteria 2030
109 Ga0075430_100022060 3300006846 Bacteria 5412
110 Ga0075430_100152968 3300006846 Bacteria 1921
111 Ga0075430_100407287 3300006846 Bacteria 1122
112 Ga0075431_100024205 3300006847 Bacteria 6218
113 Ga0075431_100034351 3300006847 Bacteria 5224
114 Ga0075431_100088529 3300006847 Bacteria 3195
115 Ga0075434_100041044 3300006871 Bacteria 4583
116 Ga0075429_100010864 3300006880 Bacteria 7874
117 Ga0075429_100204237 3300006880 Bacteria 1731
118 Ga0097620_100164122 3300006931 Bacteria 2300
119 Ga0075435_100025640 3300007076 Bacteria 4591
120 Ga0105251_10049031 3300009011 Bacteria 2023
121 Ga0105240_10014186 3300009093 Bacteria 10883
122 Ga0105240_10020530 3300009093 Bacteria 8807
123 Ga0105240_10027626 3300009093 Bacteria 7428
124 Ga0105240_10044218 3300009093 Bacteria 5662
125 Ga0105240_10078202 3300009093 Bacteria 4074
126 Ga0105240_10130864 3300009093 Bacteria 3010
127 Ga0105240_10402485 3300009093 Bacteria 1541
128 Ga0105240_10528113 3300009093 Bacteria 1309
129 Ga0111539_10183863 3300009094 Bacteria 2441
130 Ga0111539_10235839 3300009094 Bacteria 2130
131 Ga0111539_10364783 3300009094 Bacteria 1681
132 Ga0111539_10537157 3300009094 Bacteria 1362
133 Ga0105247_10117351 3300009101 Bacteria 1720
134 Ga0114129_10033312 3300009147 Bacteria 7280
135 Ga0114129_10046783 3300009147 Bacteria 6079
136 Ga0114129_10049896 3300009147 Bacteria 5879
137 Ga0114129_10153397 3300009147 Bacteria 3152
138 Ga0114129_10175480 3300009147 Bacteria 2919
139 Ga0114129_10569614 3300009147 Bacteria 1471
140 Ga0114129_11184753 3300009147 Bacteria 952
141 Ga0105243_10005348 3300009148 Bacteria 10021
142 Ga0105243_10310460 3300009148 Bacteria 1433
143 Ga0105241_10439816 3300009174 Bacteria 1151
144 Ga0105248_10100766 3300009177 Bacteria 3255
145 Ga0105248_10188225 3300009177 Bacteria 2326
146 Ga0105237_10005308 3300009545 Bacteria 14575
147 Ga0105237_10116168 3300009545 Bacteria 2669
148 Ga0105237_10140252 3300009545 Bacteria 2411
149 Ga0105237_10211517 3300009545 Bacteria 1939
150 Ga0105238_10000267 3300009551 Bacteria 58437
151 Ga0105238_10008830 3300009551 Bacteria 10082
152 Ga0105238_10014255 3300009551 Bacteria 8037
153 Ga0105238_10022006 3300009551 Bacteria 6497
154 Ga0105238_10060087 3300009551 Bacteria 3807
155 Ga0105238_10136793 3300009551 Bacteria 2428
156 Ga0105238_10314051 3300009551 Bacteria 1552
157 Ga0105238_10355486 3300009551 Bacteria 1454
158 Ga0105238_10506972 3300009551 Bacteria 1208
159 Ga0105238_10623519 3300009551 Bacteria 1087
160 Ga0105249_10093109 3300009553 Bacteria 2822
161 Ga0105249_10162886 3300009553 Bacteria 2157
162 Ga0105239_10009260 3300010375 Bacteria 11132
163 Ga0105239_10013296 3300010375 Bacteria 9147
164 Ga0105246_10073623 3300011119 Bacteria 2412
165 Ga0157373_10206741 3300013100 Bacteria 1384
166 Ga0157370_10010331 3300013104 Bacteria 9849
167 Ga0157370_10040162 3300013104 Bacteria 4518
168 Ga0157369_10000857 3300013105 Bacteria 38789
169 Ga0157369_10163011 3300013105 Bacteria 2352
170 Ga0157374_10346424 3300013296 Bacteria 1476
171 Ga0157378_10145209 3300013297 Bacteria 2206
172 Ga0163162_10090492 3300013306 Bacteria 3141
173 Ga0163162_10464899 3300013306 Bacteria 1397
174 Ga0157372_10000468 3300013307 Bacteria 44530
175 Ga0157372_10114986 3300013307 Bacteria 3084
176 Ga0157372_10142399 3300013307 Bacteria 2763
177 Ga0157375_10003266 3300013308 Bacteria 14069
178 Ga0157375_10946667 3300013308 Bacteria 1003
179 Ga0157380_10230710 3300014326 Bacteria 1662
180 Ga0157380_10281170 3300014326 Bacteria 1523
181 Ga0157377_10069056 3300014745 Bacteria 2038
182 Ga0157377_10070040 3300014745 Bacteria 2025
183 Ga0157379_10222415 3300014968 Bacteria 1711
184 Ga0157379_10240680 3300014968 Bacteria 1641
185 Ga0157376_10016839 3300014969 Bacteria 5560
186 Ga0157376_10192097 3300014969 Bacteria 1873
187 Ga0163161_10075741 3300017792 Bacteria 2470
188 Ga0163161_10191800 3300017792 Bacteria 1571
189 Ga0213874_10083058 3300021377 Bacteria 1041
190 Ga0213876_10219442 3300021384 Bacteria 1011
191 Ga0207653_10010554 3300025885 Bacteria 2881
192 Ga0207682_10007892 3300025893 Bacteria 4226
193 Ga0207682_10071454 3300025893 Bacteria 1471
194 Ga0207710_10032948 3300025900 Bacteria 2271
195 Ga0207688_10059627 3300025901 Bacteria 2149
196 Ga0207647_10000127 3300025904 Bacteria 59293
197 Ga0207647_10070436 3300025904 Bacteria 2112
198 Ga0207699_10058864 3300025906 Bacteria 2300
199 Ga0207645_10007804 3300025907 Bacteria 7528
200 Ga0207645_10214386 3300025907 Bacteria 1268
201 Ga0207643_10001647 3300025908 Bacteria 12569
202 Ga0207643_10027597 3300025908 Bacteria 3148
203 Ga0207684_10014921 3300025910 Bacteria 6686
204 Ga0207684_10035583 3300025910 Bacteria 4228
205 Ga0207684_10166974 3300025910 Bacteria 1897
206 Ga0207654_10000081 3300025911 Bacteria 62713
207 Ga0207654_10241861 3300025911 Bacteria 1206
208 Ga0207707_10157633 3300025912 Bacteria 1985
209 Ga0207695_10026298 3300025913 Bacteria 6496
210 Ga0207695_10052319 3300025913 Bacteria 4279
211 Ga0207695_10067580 3300025913 Bacteria 3666
212 Ga0207695_10098495 3300025913 Bacteria 2923
213 Ga0207671_10079363 3300025914 Bacteria 2459
214 Ga0207671_10086181 3300025914 Bacteria 2361
215 Ga0207671_10143048 3300025914 Bacteria 1844
216 Ga0207693_10007308 3300025915 Bacteria 9088
217 Ga0207693_10010808 3300025915 Bacteria 7410
218 Ga0207693_10032535 3300025915 Bacteria 4115
219 Ga0207663_10049382 3300025916 Bacteria 2609
220 Ga0207662_10009149 3300025918 Bacteria 5445
221 Ga0207657_10034284 3300025919 Bacteria 4567
222 Ga0207657_10105333 3300025919 Bacteria 2335
223 Ga0207681_10032058 3300025923 Bacteria 3438
224 Ga0207694_10000134 3300025924 Bacteria 75759
225 Ga0207694_10003702 3300025924 Bacteria 12107
226 Ga0207694_10087160 3300025924 Bacteria 2459
227 Ga0207694_10185401 3300025924 Bacteria 1689
228 Ga0207650_10018120 3300025925 Bacteria 4937
229 Ga0207650_10141920 3300025925 Bacteria 1889
230 Ga0207659_10050777 3300025926 Bacteria 2948
231 Ga0207659_10149501 3300025926 Bacteria 1822
232 Ga0207659_10347444 3300025926 Bacteria 1230
233 Ga0207664_10025639 3300025929 Bacteria 4445
234 Ga0207664_10046362 3300025929 Bacteria 3411
235 Ga0207644_10109716 3300025931 Bacteria 2085
236 Ga0207644_10239768 3300025931 Bacteria 1443
237 Ga0207690_10138594 3300025932 Bacteria 1790
238 Ga0207706_10031576 3300025933 Bacteria 4719
239 Ga0207670_10042092 3300025936 Bacteria 3008
240 Ga0207669_10194765 3300025937 Bacteria 1465
241 Ga0207665_10013924 3300025939 Bacteria 5290
242 Ga0207691_10099308 3300025940 Bacteria 2599
243 Ga0207711_10055387 3300025941 Bacteria 3405
244 Ga0207711_10112491 3300025941 Bacteria 2423
245 Ga0207711_10232344 3300025941 Bacteria 1689
246 Ga0207689_10033977 3300025942 Bacteria 4236
247 Ga0207661_10062077 3300025944 Bacteria 3022
248 Ga0207661_10384259 3300025944 Bacteria 1271
249 Ga0207679_10105418 3300025945 Bacteria 2214
250 Ga0207667_10001417 3300025949 Bacteria 30024
251 Ga0207667_10032615 3300025949 Bacteria 5610
252 Ga0207667_10080556 3300025949 Bacteria 3373
253 Ga0207667_10103762 3300025949 Bacteria 2932
254 Ga0207667_10508443 3300025949 Bacteria 1221
255 Ga0207651_10081004 3300025960 Bacteria 2339
256 Ga0207640_10011101 3300025981 Bacteria 5091
257 Ga0207658_10022826 3300025986 Bacteria 4359
258 Ga0207658_10226656 3300025986 Bacteria 1575
259 Ga0207703_10000318 3300026035 Bacteria 52249
260 Ga0207703_10462271 3300026035 Bacteria 1187
261 Ga0207639_10017795 3300026041 Bacteria 5039
262 Ga0207639_10042634 3300026041 Bacteria 3401
263 Ga0207639_10092850 3300026041 Bacteria 2419
264 Ga0207639_10154118 3300026041 Bacteria 1928
265 Ga0207678_10056749 3300026067 Bacteria 3371
266 Ga0207678_10232509 3300026067 Bacteria 1578
267 Ga0207708_10071299 3300026075 Bacteria 2661
268 Ga0207702_10000180 3300026078 Bacteria 76230
269 Ga0207702_10073499 3300026078 Bacteria 2948
270 Ga0207641_10000721 3300026088 Bacteria 35497
271 Ga0207648_10040011 3300026089 Bacteria 4120
272 Ga0207648_10042704 3300026089 Bacteria 3980
273 Ga0207648_10097754 3300026089 Bacteria 2569
274 Ga0207676_10116646 3300026095 Bacteria 2244
275 Ga0207676_10206255 3300026095 Bacteria 1740
276 Ga0207676_10413179 3300026095 Bacteria 1264
277 Ga0207674_10001278 3300026116 Bacteria 32880
278 Ga0207674_10047208 3300026116 Bacteria 4416
279 Ga0207674_10305456 3300026116 Bacteria 1540
280 Ga0207675_100006871 3300026118 Bacteria 10774
281 Ga0207675_100017479 3300026118 Bacteria 6693
282 Ga0207683_10185011 3300026121 Bacteria 1890
283 Ga0207683_10494082 3300026121 Bacteria 1130
284 Ga0209983_1041983 3300027665 Bacteria 991
285 Ga0209971_1006235 3300027682 Bacteria 2823
286 Ga0207428_10312657 3300027907 Bacteria 1161
287 Ga0268266_10001230 3300028379 Bacteria 31390
288 Ga0268265_10015648 3300028380 Bacteria 5193
289 Ga0268265_10024333 3300028380 Bacteria 4283
290 Ga0268264_10000373 3300028381 Bacteria 65793
291 Ga0307511_10001542 3300030521 Bacteria 24384
292 Ga0307511_10022858 3300030521 Bacteria 5846
293 Ga0307509_10000001 3300031507 Bacteria 629324
294 Ga0265314_10004840 3300031711 Bacteria 12316
295 Ga0307405_10005061 3300031731 Bacteria 6307
296 Ga0307410_10013156 3300031852 Bacteria 4816
297 Ga0307407_10046811 3300031903 Bacteria 2451
298 Ga0307409_100020544 3300031995 Bacteria 4504
299 Ga0307416_100099944 3300032002 Bacteria 2521
300 Ga0307414_10113758 3300032004 Bacteria 2066
301 Ga0307411_10059859 3300032005 Bacteria 2526
302 Ga0307510_10000015 3300033180 Bacteria 258937
303 Ga0307510_10023531 3300033180 Bacteria 7139
304 Ga0373930_0016234 3300034816 Bacteria 1406
305 Ga0373929_0017199 3300035085 Bacteria 1425
306 Ga0373936_0004685 3300035113 Bacteria 5170
307 Ga0373939_0077250 3300035114 Bacteria 1098
308 Ga0373960_0011725 3300035121 Bacteria 2164
309 Ga0373943_0012079 3300035170 Bacteria 3889
310 Ga0373943_0042609 3300035170 Bacteria 2200
311 Ga0373946_0175705 3300035171 Bacteria 1014
312 Ga0373942_0007700 3300035207 Bacteria 2504
313 Ga0373961_0003399 3300035241 Bacteria 3947
314 Ga0373931_0069935 3300035691 Bacteria 1913
315 Ga0373935_0024433 3300035692 Bacteria 3719
316 Ga0373927_0141211 3300035695 Bacteria 1575
317 Ga0373947_0015100 3300035725 Bacteria 4433
318 Ga0373947_0025699 3300035725 Bacteria 3434
319 Ga0373925_0034944 3300037068 Bacteria 3706
320 Ga0373925_0133081 3300037068 Bacteria 1940
321 Ga0395899_0000083 3300037312 Bacteria 161878
322 Ga0395899_0074988 3300037312 Bacteria 2471
323 Ga0395899_0275151 3300037312 Bacteria 1147
324 Ga0395900_0000004 3300037418 Bacteria 564908
325 Ga0395900_0028376 3300037418 Bacteria 5732
326 Ga0395900_0029736 3300037418 Bacteria 5606
327 Ga0395900_0282554 3300037418 Bacteria 1651
328 Ga0395898_0007994 3300037466 Bacteria 11221
329 Ga0395898_0074387 3300037466 Bacteria 3281
330 Ga0395905_0006577 3300037471 Bacteria 11677
331 Ga0395905_0057360 3300037471 Bacteria 3643
332 Ga0395905_0361950 3300037471 Bacteria 1343
333 Ga0436364_0520633 3300037853 Bacteria 51124
334 Ga0395901_0000005 3300038443 Bacteria 544998
335 Ga0395901_0018973 3300038443 Bacteria 7032
336 Ga0395901_0022989 3300038443 Bacteria 6390
337 Ga0395901_0041390 3300038443 Bacteria 4775
338 Ga0395901_0095446 3300038443 Bacteria 3116
339 Ga0400490_25320 3300038726 Bacteria 33187
340 Ga0400488_15777 3300038741 Bacteria 3018
341 Ga0400487_00056 3300039110 Bacteria 2592
342 Ga0400487_32217 3300039110 Bacteria 35879
343 Ga0400487_56403 3300039110 Unclassified 2977
344 Ga0400487_61000 3300039110 Bacteria 27948
345 Ga0436365_0654630 3300039437 Bacteria 2832
346 Ga0436360_0454558 3300039438 Bacteria 2288
347 Ga0436360_0659314 3300039438 Bacteria 1023
348 Ga0436363_1003312 3300039450 Bacteria 1207
349 Ga0451853_1145584 3300041512 Bacteria 1540
350 Ga0439435_0098916 3300042436 Bacteria 894
351 Ga0439444_0007395 3300042437 Bacteria 1685
352 Ga0450918_018091 3300042531 Bacteria 1228
353 Ga0466969_0097777 3300044656 Bacteria 1384
354 Ga0466970_0028743 3300044765 Bacteria 2923
355 Ga0466959_0001806 3300045049 Bacteria 13393
356 Ga0495603_0087466 3300046455 Bacteria 1823
357 Ga0495603_0164097 3300046455 Bacteria 1288
358 Ga0495603_0321730 3300046455 Bacteria 888
359 Ga0495638_0006033 3300046460 Bacteria 8870
360 Ga0495653_0088300 3300046463 Bacteria 2275
361 Ga0495605_0001268 3300046474 Bacteria 16725
362 Ga0495605_0055179 3300046474 Bacteria 1921
363 Ga0495639_0068584 3300046475 Bacteria 1635
364 Ga0495662_0165298 3300046476 Bacteria 1090
365 Ga0495584_0043813 3300046491 Bacteria 2259
366 Ga0495585_0014506 3300046492 Bacteria 4588
367 Ga0495594_0081541 3300046499 Bacteria 1806
368 Ga0495594_0214263 3300046499 Bacteria 1098
369 Ga0495596_0063233 3300046500 Bacteria 1440
370 Ga0495606_0054069 3300046507 Bacteria 2602
371 Ga0495606_0216746 3300046507 Bacteria 1081
372 Ga0495606_0231206 3300046507 Bacteria 1036
373 Ga0495616_0077305 3300046513 Bacteria 1598
374 Ga0495628_0162302 3300046516 Bacteria 1698
375 Ga0495644_0008346 3300046523 Bacteria 3990
376 Ga0495644_0022053 3300046523 Bacteria 2428
377 Ga0495663_0068550 3300046525 Bacteria 1126
378 Ga0495642_0054211 3300046528 Bacteria 1653
379 Ga0495642_0092324 3300046528 Bacteria 1282
380 Ga0495654_0153970 3300046530 Bacteria 1014
381 Ga0495665_0081285 3300046531 Bacteria 1704
382 Ga0495621_0028363 3300046539 Bacteria 1903
383 Ga0495621_0070331 3300046539 Bacteria 1288
384 Ga0495621_0071339 3300046539 Bacteria 1280
385 Ga0495597_0044494 3300046542 Bacteria 1974
386 Ga0495656_0004258 3300046615 Bacteria 4888
387 Ga0495656_0022509 3300046615 Bacteria 2469
388 Ga0495656_0160274 3300046615 Bacteria 1093
389 Ga0495588_0006437 3300046674 Bacteria 5288
390 Ga0495669_0042113 3300046684 Bacteria 2029
391 Ga0495669_0066751 3300046684 Bacteria 1634
392 Ga0495624_0022066 3300046690 Bacteria 4214
393 Ga0495670_0073480 3300046691 Bacteria 1733
394 Ga0495670_0115798 3300046691 Bacteria 1390
395 Ga0495589_0013321 3300046794 Bacteria 4244
396 Ga0495660_0117851 3300046810 Bacteria 1347
397 Ga0495581_0071680 3300047315 Bacteria 2005
398 Ga0495672_0043292 3300047320 Bacteria 2708
399 Ga0495676_0026477 3300047321 Bacteria 4991
400 Ga0495680_0083319 3300047322 Bacteria 2412
401 Ga0495687_015021 3300047443 Bacteria 3954
402 Ga0495679_049837 3300047446 Bacteria 1262
403 Ga0495684_0133945 3300047471 Bacteria 1860
404 Ga0496100_0155798 3300048903 Bacteria 1633
405 Ga0496101_0038952 3300048904 Bacteria 3377
406 Ga0496101_0072781 3300048904 Bacteria 2523
407 Ga0496103_0001026 3300048906 Bacteria 19554
408 Ga0496104_0016013 3300048907 Bacteria 6807
409 Ga0496104_0103414 3300048907 Bacteria 2728
410 Ga0496104_0195548 3300048907 Bacteria 1934
411 Ga0496105_0004542 3300048908 Bacteria 10457
412 Ga0496106_0132751 3300048909 Bacteria 1953
413 Ga0496107_0299478 3300048910 Bacteria 1197
414 Ga0496107_0333108 3300048910 Bacteria 1129
415 Ga0496108_0000552 3300048911 Bacteria 29320
416 Ga0496108_0248410 3300048911 Bacteria 1547
417 Ga0496108_0424053 3300048911 Bacteria 1162
418 Ga0496109_0002241 3300048912 Bacteria 16058
419 Ga0496110_0018928 3300048913 Bacteria 5786
420 Ga0496111_0008382 3300048914 Bacteria 6836
421 Ga0496111_0086659 3300048914 Bacteria 2291
422 Ga0496113_0001551 3300048916 Bacteria 12887
423 Ga0496114_0056970 3300048917 Bacteria 3262
424 Ga0496119_0000983 3300048922 Bacteria 36653
425 Ga0496119_0278714 3300048922 Bacteria 832
426 Ga0496120_0000199 3300048923 Bacteria 103142
427 Ga0496125_0000854 3300048928 Bacteria 48916
428 Ga0496126_0136978 3300048929 Bacteria 2111
429 Ga0501033_0110850 3300049570 Bacteria 1997
430 Ga0501034_0220457 3300049571 Bacteria 1849
431 Ga0501036_0032503 3300049572 Bacteria 4409
432 Ga0501036_0036210 3300049572 Bacteria 4176
433 Ga0501038_0016306 3300049574 Bacteria 6736
434 Ga0501039_0043830 3300049575 Bacteria 3456
435 Ga0501039_0055148 3300049575 Bacteria 3077
436 Ga0501039_0672021 3300049575 Bacteria 811
437 Ga0501040_0010553 3300049576 Bacteria 6041
438 Ga0501040_0011884 3300049576 Bacteria 5696
439 Ga0501041_0003027 3300049577 Bacteria 9633
440 Ga0501041_0015002 3300049577 Bacteria 4601
441 Ga0501041_0248011 3300049577 Bacteria 1119
442 Ga0501042_0049988 3300049578 Bacteria 2983
443 Ga0501042_0183908 3300049578 Bacteria 1508
444 Ga0501042_0204544 3300049578 Bacteria 1424
445 Ga0501042_0204946 3300049578 Bacteria 1422
446 Ga0501043_0000053 3300049579 Bacteria 106085
447 Ga0501043_0025445 3300049579 Bacteria 4645
448 Ga0501046_0000018 3300049580 Bacteria 220589
449 Ga0501046_0013541 3300049580 Bacteria 6901
450 Ga0501046_0073254 3300049580 Bacteria 2658
451 Ga0501046_0173405 3300049580 Bacteria 1617
452 Ga0501046_0247090 3300049580 Bacteria 1314
453 Ga0501047_0000020 3300049581 Bacteria 259377
454 Ga0501048_0000795 3300049582 Bacteria 23148
455 Ga0501048_0014265 3300049582 Bacteria 5886
456 Ga0501048_0025604 3300049582 Bacteria 4300
457 Ga0501068_0006209 3300049584 Bacteria 6572
458 Ga0501069_0168010 3300049585 Bacteria 1265
459 Ga0501070_0018463 3300049586 Bacteria 5851
460 Ga0501071_0023087 3300049587 Bacteria 4341
461 Ga0501071_0046233 3300049587 Bacteria 3126
462 Ga0501072_0003680 3300049588 Bacteria 11564
463 Ga0501072_0010859 3300049588 Bacteria 6944
464 Ga0501072_0312518 3300049588 Bacteria 1249
465 Ga0501073_0001765 3300049589 Bacteria 16078
466 Ga0501073_0050762 3300049589 Bacteria 2906
467 Ga0501074_0088320 3300049590 Bacteria 2220
468 Ga0501074_0303760 3300049590 Bacteria 1133
469 Ga0501075_0005348 3300049591 Bacteria 8781
470 Ga0501075_0218527 3300049591 Bacteria 1454
471 Ga0501076_0001848 3300049592 Bacteria 14404
472 Ga0501076_0005337 3300049592 Bacteria 9229
473 Ga0501076_0100568 3300049592 Bacteria 2330
474 Ga0501076_0219193 3300049592 Bacteria 1555
475 Ga0501076_0277529 3300049592 Bacteria 1373
476 Ga0501077_0048602 3300049593 Bacteria 2695
477 Ga0501079_0002227 3300049741 Bacteria 13980
478 Ga0501079_0019505 3300049741 Bacteria 5180
479 Ga0501079_0080697 3300049741 Bacteria 2515
480 Ga0501079_0268004 3300049741 Bacteria 1335
481 Ga0501080_0013466 3300049742 Bacteria 7524
482 Ga0501080_0016847 3300049742 Bacteria 6749
483 Ga0501080_0042873 3300049742 Bacteria 4212
484 Ga0501081_0001203 3300049743 Bacteria 15719
485 Ga0501081_0007381 3300049743 Bacteria 7135
486 Ga0501035_0042097 3300049822 Bacteria 4121
487 Ga0501044_0076161 3300049823 Bacteria 3406
488 Ga0501045_0002006 3300049824 Bacteria 13757
489 Ga0501045_0006612 3300049824 Bacteria 8032
490 Ga0501045_0187247 3300049824 Bacteria 1542
491 nmdc:mga0yw44_342574_c1 3300050492 Bacteria 1006
492 nmdc:mga0yw44_6236_c1 3300050492 Bacteria 5739
493 nmdc:mga05p37_115151_c1 3300050507 Bacteria 3305
494 nmdc:mga05p37_313130_c1 3300050507 Bacteria 1860
495 nmdc:mga05p37_434958_c1 3300050507 Bacteria 1523
496 nmdc:mga05p37_631204_c1 3300050507 Bacteria 1204
497 nmdc:mga09592_179312_c1 3300050508 Bacteria 1832
498 nmdc:mga09592_97792_c1 3300050508 Bacteria 2512
499 nmdc:mga0qj67_134974_c1 3300050509 Bacteria 1999
500 nmdc:mga0qj67_47653_c1 3300050509 Bacteria 3386
501 nmdc:mga06r32_35869_c1 3300050510 Bacteria 4680
502 nmdc:mga06r32_82669_c1 3300050510 Bacteria 3129
503 nmdc:mga08y16_154078_c1 3300050511 Bacteria 2388
504 nmdc:mga08y16_216192_c1 3300050511 Bacteria 1985
505 nmdc:mga08y16_554417_c1 3300050511 Bacteria 1163
506 nmdc:mga0n895_100469_c1 3300050512 Bacteria 2902
507 nmdc:mga0n895_363667_c1 3300050512 Bacteria 1465
508 nmdc:mga0rr50_211446_c1 3300050513 Bacteria 1598
509 nmdc:mga08x19_253433_c1 3300050514 Bacteria 1215
510 nmdc:mga0a205_117897_c1 3300050515 Bacteria 2553
511 nmdc:mga0a205_189465_c1 3300050515 Bacteria 1949
512 Ga0495619_0069625 3300053085 Bacteria 2352
513 Ga0495619_0143378 3300053085 Bacteria 1646
514 Ga0500647_0047266 3300053091 Bacteria 2068
515 Ga0500641_0000126 3300053096 Bacteria 28650
516 Ga0500556_0002015 3300053104 Bacteria 7103
517 Ga0500591_058576 3300053115 Bacteria 1784
518 Ga0500590_231977 3300053148 Bacteria 751
519 Ga0500616_0014688 3300053153 Bacteria 4492
520 Ga0500630_095126 3300053159 Bacteria 1368
521 Ga0500639_124255 3300053163 Bacteria 1234
522 Ga0500645_004890 3300053730 Bacteria 5042
523 Ga0501084_0035527 3300054114 Bacteria 4166
524 Ga0501084_0256898 3300054114 Bacteria 1475
525 Ga0501084_0271580 3300054114 Bacteria 1432
526 Ga0501084_0286014 3300054114 Bacteria 1392
527 Ga0501082_0005387 3300060353 Bacteria 11102
528 Ga0501082_0009378 3300060353 Bacteria 8429
529 Ga0501082_0195109 3300060353 Bacteria 1761
530 Ga0501082_0367805 3300060353 Bacteria 1254
531 Ga0466962_0002588 3300061719 Bacteria 8594
532 Ga0530510_0002356 3300061734 Bacteria 12971
533 Ga0530510_0042674 3300061734 Bacteria 3277
534 Ga0530510_0107872 3300061734 Bacteria 2038
535 Ga0530510_0264567 3300061734 Bacteria 1283
536 Ga0530510_0426278 3300061734 Bacteria 1002

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053148 Ga0500590_231977 Ga0500590_231977_49_729 226
2 3300042531 Ga0450918_018091 Ga0450918_018091_524_1210 228
3 3300049588 Ga0501072_0312518 Ga0501072_0312518_31_717 228
4 3300049592 Ga0501076_0219193 Ga0501076_0219193_839_1525 228
5 3300049741 Ga0501079_0268004 Ga0501079_0268004_15_713 231
6 3300049575 Ga0501039_0672021 Ga0501039_0672021_29_727 232
7 3300039438 Ga0436360_0659314 Ga0436360_0659314_287_1009 239
8 3300049580 Ga0501046_0247090 Ga0501046_0247090_567_1304 244
9 3300046507 Ga0495606_0216746 Ga0495606_0216746_319_1068 249
10 3300046455 Ga0495603_0321730 Ga0495603_0321730_18_770 250
11 3300046528 Ga0495642_0092324 Ga0495642_0092324_82_834 250
12 3300005983 Ga0081540_1002187 Ga0081540_10021879 252
13 3300037312 Ga0395899_0275151 Ga0395899_0275151_203_1009 252
14 3300037471 Ga0395905_0361950 Ga0395905_0361950_261_1067 252
15 3300038443 Ga0395901_0095446 Ga0395901_0095446_864_1670 252
16 3300005436 Ga0070713_100041435 Ga0070713_1000414353 253
17 3300005437 Ga0070710_10005767 Ga0070710_100057674 253
18 3300005439 Ga0070711_100131209 Ga0070711_1001312091 253
19 3300005546 Ga0070696_100469746 Ga0070696_1004697461 253
20 3300006028 Ga0070717_10007579 Ga0070717_100075797 253
21 3300006163 Ga0070715_10001047 Ga0070715_100010473 253
22 3300006173 Ga0070716_100072554 Ga0070716_1000725543 253
23 3300007076 Ga0075435_100025640 Ga0075435_1000256405 253
24 3300021377 Ga0213874_10083058 Ga0213874_100830581 253
25 3300025915 Ga0207693_10007308 Ga0207693_100073082 253
26 3300025929 Ga0207664_10025639 Ga0207664_100256393 253
27 3300025939 Ga0207665_10013924 Ga0207665_100139242 253
28 3300039450 Ga0436363_1003312 Ga0436363_1003312_65_871 253
29 3300048910 Ga0496107_0299478 Ga0496107_0299478_310_1116 253
30 3300050512 nmdc:mga0n895_100469_c1 nmdc:mga0n895_100469_c1_97_903 253
31 3300050512 nmdc:mga0n895_363667_c1 nmdc:mga0n895_363667_c1_457_1263 253
32 3300050513 nmdc:mga0rr50_211446_c1 nmdc:mga0rr50_211446_c1_412_1218 253
33 3300050515 nmdc:mga0a205_189465_c1 nmdc:mga0a205_189465_c1_268_1074 253
34 3300009094 Ga0111539_10537157 Ga0111539_105371572 254
35 3300050514 nmdc:mga08x19_253433_c1 nmdc:mga08x19_253433_c1_110_916 254
36 3300009147 Ga0114129_10175480 Ga0114129_101754803 255
37 3300049571 Ga0501034_0220457 Ga0501034_0220457_373_1161 259
38 3300049586 Ga0501070_0018463 Ga0501070_0018463_2844_3632 259
39 3300049589 Ga0501073_0050762 Ga0501073_0050762_627_1415 259
40 3300049742 Ga0501080_0013466 Ga0501080_0013466_2705_3493 259
41 3300021384 Ga0213876_10219442 Ga0213876_102194422 260
42 3300039437 Ga0436365_0654630 Ga0436365_0654630_1953_2798 260
43 3300046499 Ga0495594_0214263 Ga0495594_0214263_150_935 260
44 3300030521 Ga0307511_10001542 Ga0307511_1000154222 261
45 3300031507 Ga0307509_10000001 Ga0307509_10000001508 261
46 3300046528 Ga0495642_0054211 Ga0495642_0054211_339_1127 261
47 3300046539 Ga0495621_0071339 Ga0495621_0071339_237_1025 261
48 3300053096 Ga0500641_0000126 Ga0500641_0000126_23078_23881 261
49 3300053104 Ga0500556_0002015 Ga0500556_0002015_933_1736 261
50 3300053153 Ga0500616_0014688 Ga0500616_0014688_1283_2086 261
51 3300053730 Ga0500645_004890 Ga0500645_004890_742_1545 261
52 3300005329 Ga0070683_100416377 Ga0070683_1004163772 262
53 3300005331 Ga0070670_100105190 Ga0070670_1001051902 262
54 3300005335 Ga0070666_10148035 Ga0070666_101480352 262
55 3300005336 Ga0070680_100258737 Ga0070680_1002587372 262
56 3300005339 Ga0070660_100059514 Ga0070660_1000595143 262
57 3300005339 Ga0070660_100151508 Ga0070660_1001515082 262
58 3300005344 Ga0070661_100384157 Ga0070661_1003841572 262
59 3300005355 Ga0070671_100000668 Ga0070671_10000066819 262
60 3300005355 Ga0070671_100377399 Ga0070671_1003773992 262
61 3300005366 Ga0070659_100168845 Ga0070659_1001688452 262
62 3300005367 Ga0070667_100051540 Ga0070667_1000515401 262
63 3300005434 Ga0070709_10059343 Ga0070709_100593432 262
64 3300005439 Ga0070711_100038006 Ga0070711_1000380063 262
65 3300005458 Ga0070681_10242648 Ga0070681_102426482 262
66 3300005530 Ga0070679_100110802 Ga0070679_1001108023 262
67 3300005548 Ga0070665_100010270 Ga0070665_1000102702 262
68 3300005548 Ga0070665_100041262 Ga0070665_1000412625 262
69 3300005563 Ga0068855_100087012 Ga0068855_1000870123 262
70 3300005563 Ga0068855_100452001 Ga0068855_1004520012 262
71 3300005614 Ga0068856_100165585 Ga0068856_1001655852 262
72 3300005616 Ga0068852_100508354 Ga0068852_1005083542 262
73 3300005841 Ga0068863_100007247 Ga0068863_1000072476 262
74 3300005842 Ga0068858_100001501 Ga0068858_1000015015 262
75 3300005843 Ga0068860_100000887 Ga0068860_10000088713 262
76 3300005844 Ga0068862_100021059 Ga0068862_1000210593 262
77 3300009093 Ga0105240_10027626 Ga0105240_100276263 262
78 3300009093 Ga0105240_10044218 Ga0105240_100442183 262
79 3300009093 Ga0105240_10078202 Ga0105240_100782026 262
80 3300009093 Ga0105240_10402485 Ga0105240_104024852 262
81 3300009101 Ga0105247_10117351 Ga0105247_101173512 262
82 3300009174 Ga0105241_10439816 Ga0105241_104398161 262
83 3300009545 Ga0105237_10116168 Ga0105237_101161683 262
84 3300009545 Ga0105237_10140252 Ga0105237_101402522 262
85 3300009551 Ga0105238_10022006 Ga0105238_100220064 262
86 3300009551 Ga0105238_10136793 Ga0105238_101367933 262
87 3300009551 Ga0105238_10314051 Ga0105238_103140512 262
88 3300009551 Ga0105238_10355486 Ga0105238_103554861 262
89 3300009551 Ga0105238_10506972 Ga0105238_105069722 262
90 3300013100 Ga0157373_10206741 Ga0157373_102067412 262
91 3300013104 Ga0157370_10010331 Ga0157370_1001033111 262
92 3300013104 Ga0157370_10040162 Ga0157370_100401622 262
93 3300013105 Ga0157369_10000857 Ga0157369_1000085731 262
94 3300013105 Ga0157369_10163011 Ga0157369_101630112 262
95 3300013296 Ga0157374_10346424 Ga0157374_103464241 262
96 3300013306 Ga0163162_10090492 Ga0163162_100904922 262
97 3300013307 Ga0157372_10000468 Ga0157372_1000046840 262
98 3300013307 Ga0157372_10114986 Ga0157372_101149862 262
99 3300013307 Ga0157372_10142399 Ga0157372_101423992 262
100 3300014968 Ga0157379_10222415 Ga0157379_102224152 262
101 3300025900 Ga0207710_10032948 Ga0207710_100329482 262
102 3300025906 Ga0207699_10058864 Ga0207699_100588643 262
103 3300025911 Ga0207654_10241861 Ga0207654_102418611 262
104 3300025912 Ga0207707_10157633 Ga0207707_101576332 262
105 3300025913 Ga0207695_10026298 Ga0207695_100262985 262
106 3300025914 Ga0207671_10079363 Ga0207671_100793632 262
107 3300025916 Ga0207663_10049382 Ga0207663_100493822 262
108 3300025919 Ga0207657_10105333 Ga0207657_101053332 262
109 3300025924 Ga0207694_10087160 Ga0207694_100871602 262
110 3300025924 Ga0207694_10185401 Ga0207694_101854012 262
111 3300025929 Ga0207664_10046362 Ga0207664_100463622 262
112 3300025932 Ga0207690_10138594 Ga0207690_101385942 262
113 3300025944 Ga0207661_10384259 Ga0207661_103842592 262
114 3300025949 Ga0207667_10080556 Ga0207667_100805563 262
115 3300025949 Ga0207667_10103762 Ga0207667_101037622 262
116 3300025949 Ga0207667_10508443 Ga0207667_105084431 262
117 3300025986 Ga0207658_10022826 Ga0207658_100228265 262
118 3300026035 Ga0207703_10000318 Ga0207703_1000031811 262
119 3300026041 Ga0207639_10092850 Ga0207639_100928502 262
120 3300026088 Ga0207641_10000721 Ga0207641_100007215 262
121 3300026095 Ga0207676_10413179 Ga0207676_104131792 262
122 3300028379 Ga0268266_10001230 Ga0268266_100012305 262
123 3300028380 Ga0268265_10024333 Ga0268265_100243334 262
124 3300028381 Ga0268264_10000373 Ga0268264_1000037318 262
125 3300030521 Ga0307511_10022858 Ga0307511_100228582 262
126 3300033180 Ga0307510_10000015 Ga0307510_10000015167 262
127 3300033180 Ga0307510_10023531 Ga0307510_100235315 262
128 3300035113 Ga0373936_0004685 Ga0373936_0004685_254_1075 262
129 3300037312 Ga0395899_0074988 Ga0395899_0074988_1060_1863 262
130 3300037418 Ga0395900_0028376 Ga0395900_0028376_3886_4692 262
131 3300037418 Ga0395900_0029736 Ga0395900_0029736_2218_3021 262
132 3300037466 Ga0395898_0074387 Ga0395898_0074387_1421_2224 262
133 3300037471 Ga0395905_0057360 Ga0395905_0057360_1555_2361 262
134 3300038443 Ga0395901_0022989 Ga0395901_0022989_5465_6268 262
135 3300038443 Ga0395901_0041390 Ga0395901_0041390_715_1521 262
136 3300046507 Ga0495606_0054069 Ga0495606_0054069_438_1244 262
137 3300046507 Ga0495606_0231206 Ga0495606_0231206_57_863 262
138 3300047443 Ga0495687_015021 Ga0495687_015021_2467_3273 262
139 3300048911 Ga0496108_0424053 Ga0496108_0424053_64_870 262
140 3300048922 Ga0496119_0000983 Ga0496119_0000983_11250_12056 262
141 3300048922 Ga0496119_0278714 Ga0496119_0278714_15_812 262
142 3300048923 Ga0496120_0000199 Ga0496120_0000199_32517_33323 262
143 3300048928 Ga0496125_0000854 Ga0496125_0000854_20567_21373 262
144 3300048929 Ga0496126_0136978 Ga0496126_0136978_20_826 262
145 3300049585 Ga0501069_0168010 Ga0501069_0168010_363_1154 262
146 3300053115 Ga0500591_058576 Ga0500591_058576_355_1176 262
147 3300053159 Ga0500630_095126 Ga0500630_095126_126_947 262
148 3300053163 Ga0500639_124255 Ga0500639_124255_355_1176 262
149 3300025941 Ga0207711_10112491 Ga0207711_101124912 263
150 3300046539 Ga0495621_0070331 Ga0495621_0070331_125_934 263
151 3300049570 Ga0501033_0110850 Ga0501033_0110850_685_1491 263
152 3300049572 Ga0501036_0032503 Ga0501036_0032503_1877_2683 263
153 3300049574 Ga0501038_0016306 Ga0501038_0016306_1013_1819 263
154 3300049575 Ga0501039_0043830 Ga0501039_0043830_1239_2045 263
155 3300049576 Ga0501040_0010553 Ga0501040_0010553_1236_2042 263
156 3300049577 Ga0501041_0003027 Ga0501041_0003027_6376_7182 263
157 3300049577 Ga0501041_0248011 Ga0501041_0248011_77_883 263
158 3300049578 Ga0501042_0049988 Ga0501042_0049988_1472_2278 263
159 3300049579 Ga0501043_0025445 Ga0501043_0025445_2944_3750 263
160 3300049580 Ga0501046_0013541 Ga0501046_0013541_3953_4759 263
161 3300049582 Ga0501048_0025604 Ga0501048_0025604_2772_3578 263
162 3300049584 Ga0501068_0006209 Ga0501068_0006209_1831_2637 263
163 3300049587 Ga0501071_0023087 Ga0501071_0023087_1110_1916 263
164 3300049588 Ga0501072_0003680 Ga0501072_0003680_3446_4252 263
165 3300049589 Ga0501073_0001765 Ga0501073_0001765_1712_2524 263
166 3300049590 Ga0501074_0088320 Ga0501074_0088320_625_1437 263
167 3300049590 Ga0501074_0303760 Ga0501074_0303760_235_1041 263
168 3300049591 Ga0501075_0005348 Ga0501075_0005348_832_1638 263
169 3300049592 Ga0501076_0001848 Ga0501076_0001848_8177_8983 263
170 3300049592 Ga0501076_0100568 Ga0501076_0100568_1225_2037 263
171 3300049593 Ga0501077_0048602 Ga0501077_0048602_505_1311 263
172 3300049741 Ga0501079_0002227 Ga0501079_0002227_8317_9123 263
173 3300049742 Ga0501080_0016847 Ga0501080_0016847_5605_6417 263
174 3300049742 Ga0501080_0042873 Ga0501080_0042873_951_1757 263
175 3300049743 Ga0501081_0001203 Ga0501081_0001203_7217_8023 263
176 3300049822 Ga0501035_0042097 Ga0501035_0042097_2776_3582 263
177 3300049824 Ga0501045_0002006 Ga0501045_0002006_7663_8469 263
178 3300054114 Ga0501084_0035527 Ga0501084_0035527_2399_3205 263
179 3300054114 Ga0501084_0271580 Ga0501084_0271580_513_1325 263
180 3300060353 Ga0501082_0005387 Ga0501082_0005387_3318_4130 263
181 3300060353 Ga0501082_0009378 Ga0501082_0009378_315_1121 263
182 3300061734 Ga0530510_0002356 Ga0530510_0002356_4231_5037 263
183 iso_pu_bacteria 2574179768 2574430386 263
184 iso_pu_bacteria 639633007 639788199 263
185 3300005327 Ga0070658_10355131 Ga0070658_103551311 264
186 3300037312 Ga0395899_0000083 Ga0395899_0000083_69621_70415 264
187 3300037418 Ga0395900_0000004 Ga0395900_0000004_91227_92021 264
188 3300037466 Ga0395898_0007994 Ga0395898_0007994_6498_7292 264
189 3300037471 Ga0395905_0006577 Ga0395905_0006577_4055_4849 264
190 3300038443 Ga0395901_0000005 Ga0395901_0000005_473557_474351 264
191 3300049578 Ga0501042_0204544 Ga0501042_0204544_245_1054 264
192 3300049591 Ga0501075_0218527 Ga0501075_0218527_150_959 264
193 3300005471 Ga0070698_100697713 Ga0070698_1006977131 265
194 3300025915 Ga0207693_10010808 Ga0207693_100108087 265
195 3300037853 Ga0436364_0520633 Ga0436364_0520633_33709_34515 265
196 3300005295 Ga0065707_10189649 Ga0065707_101896491 266
197 3300005328 Ga0070676_10074423 Ga0070676_100744232 266
198 3300005329 Ga0070683_100081901 Ga0070683_1000819015 266
199 3300005353 Ga0070669_100012661 Ga0070669_1000126616 266
200 3300005354 Ga0070675_100017989 Ga0070675_1000179893 266
201 3300005441 Ga0070700_100004767 Ga0070700_10000476710 266
202 3300005441 Ga0070700_100074711 Ga0070700_1000747113 266
203 3300005441 Ga0070700_100271981 Ga0070700_1002719812 266
204 3300005459 Ga0068867_100092559 Ga0068867_1000925593 266
205 3300005535 Ga0070684_100029369 Ga0070684_1000293695 266
206 3300005544 Ga0070686_100063806 Ga0070686_1000638064 266
207 3300005844 Ga0068862_100021685 Ga0068862_1000216852 266
208 3300006358 Ga0068871_100004129 Ga0068871_10000412914 266
209 3300006846 Ga0075430_100407287 Ga0075430_1004072872 266
210 3300006880 Ga0075429_100204237 Ga0075429_1002042371 266
211 3300009094 Ga0111539_10183863 Ga0111539_101838633 266
212 3300009094 Ga0111539_10235839 Ga0111539_102358391 266
213 3300009147 Ga0114129_10569614 Ga0114129_105696143 266
214 3300009147 Ga0114129_11184753 Ga0114129_111847531 266
215 3300009148 Ga0105243_10005348 Ga0105243_1000534813 266
216 3300009553 Ga0105249_10093109 Ga0105249_100931093 266
217 3300014326 Ga0157380_10281170 Ga0157380_102811702 266
218 3300014745 Ga0157377_10070040 Ga0157377_100700403 266
219 3300014969 Ga0157376_10016839 Ga0157376_100168396 266
220 3300017792 Ga0163161_10191800 Ga0163161_101918002 266
221 3300025901 Ga0207688_10059627 Ga0207688_100596272 266
222 3300025908 Ga0207643_10027597 Ga0207643_100275974 266
223 3300025926 Ga0207659_10050777 Ga0207659_100507773 266
224 3300025936 Ga0207670_10042092 Ga0207670_100420923 266
225 3300025944 Ga0207661_10062077 Ga0207661_100620771 266
226 3300026089 Ga0207648_10040011 Ga0207648_100400113 266
227 3300026116 Ga0207674_10305456 Ga0207674_103054562 266
228 3300027665 Ga0209983_1041983 Ga0209983_10419831 266
229 3300027682 Ga0209971_1006235 Ga0209971_10062353 266
230 3300027907 Ga0207428_10312657 Ga0207428_103126572 266
231 3300028380 Ga0268265_10015648 Ga0268265_100156485 266
232 3300034816 Ga0373930_0016234 Ga0373930_0016234_317_1123 266
233 3300035085 Ga0373929_0017199 Ga0373929_0017199_359_1165 266
234 3300035114 Ga0373939_0077250 Ga0373939_0077250_29_835 266
235 3300035121 Ga0373960_0011725 Ga0373960_0011725_986_1792 266
236 3300035207 Ga0373942_0007700 Ga0373942_0007700_993_1799 266
237 3300035241 Ga0373961_0003399 Ga0373961_0003399_2756_3562 266
238 3300035691 Ga0373931_0069935 Ga0373931_0069935_65_871 266
239 3300038726 Ga0400490_25320 Ga0400490_25320_22634_23446 266
240 3300038741 Ga0400488_15777 Ga0400488_15777_173_988 266
241 3300039110 Ga0400487_00056 Ga0400487_00056_310_1125 266
242 3300039110 Ga0400487_32217 Ga0400487_32217_19040_19852 266
243 3300039110 Ga0400487_56403 Ga0400487_56403_1666_2481 266
244 3300039110 Ga0400487_61000 Ga0400487_61000_6401_7216 266
245 3300042436 Ga0439435_0098916 Ga0439435_0098916_57_863 266
246 3300042437 Ga0439444_0007395 Ga0439444_0007395_241_1047 266
247 3300046684 Ga0495669_0066751 Ga0495669_0066751_358_1164 266
248 3300049572 Ga0501036_0036210 Ga0501036_0036210_1458_2288 266
249 3300049575 Ga0501039_0055148 Ga0501039_0055148_1316_2146 266
250 3300049576 Ga0501040_0011884 Ga0501040_0011884_931_1761 266
251 3300049577 Ga0501041_0015002 Ga0501041_0015002_3446_4276 266
252 3300049578 Ga0501042_0183908 Ga0501042_0183908_130_936 266
253 3300049578 Ga0501042_0204946 Ga0501042_0204946_579_1409 266
254 3300049580 Ga0501046_0073254 Ga0501046_0073254_1049_1879 266
255 3300049580 Ga0501046_0173405 Ga0501046_0173405_577_1383 266
256 3300049582 Ga0501048_0014265 Ga0501048_0014265_4571_5401 266
257 3300049587 Ga0501071_0046233 Ga0501071_0046233_1385_2215 266
258 3300049588 Ga0501072_0010859 Ga0501072_0010859_1366_2196 266
259 3300049592 Ga0501076_0005337 Ga0501076_0005337_7401_8231 266
260 3300049741 Ga0501079_0019505 Ga0501079_0019505_1829_2659 266
261 3300049743 Ga0501081_0007381 Ga0501081_0007381_63_893 266
262 3300049824 Ga0501045_0187247 Ga0501045_0187247_675_1481 266
263 3300050508 nmdc:mga09592_179312_c1 nmdc:mga09592_179312_c1_712_1518 266
264 3300050511 nmdc:mga08y16_216192_c1 nmdc:mga08y16_216192_c1_1130_1936 266
265 3300050511 nmdc:mga08y16_554417_c1 nmdc:mga08y16_554417_c1_28_834 266
266 3300054114 Ga0501084_0286014 Ga0501084_0286014_528_1334 266
267 3300060353 Ga0501082_0195109 Ga0501082_0195109_99_929 266
268 3300061734 Ga0530510_0107872 Ga0530510_0107872_1192_2022 266
269 3300061734 Ga0530510_0426278 Ga0530510_0426278_67_873 266
270 3300001991 JGI24743J22301_10016923 JGI24743J22301_100169232 267
271 3300005331 Ga0070670_100005792 Ga0070670_1000057929 267
272 3300005331 Ga0070670_100106297 Ga0070670_1001062972 267
273 3300005334 Ga0068869_100098129 Ga0068869_1000981292 267
274 3300005337 Ga0070682_100117882 Ga0070682_1001178822 267
275 3300005339 Ga0070660_100341236 Ga0070660_1003412362 267
276 3300005345 Ga0070692_10043979 Ga0070692_100439792 267
277 3300005347 Ga0070668_100087441 Ga0070668_1000874412 267
278 3300005354 Ga0070675_100123479 Ga0070675_1001234792 267
279 3300005355 Ga0070671_100272069 Ga0070671_1002720692 267
280 3300005356 Ga0070674_100408269 Ga0070674_1004082691 267
281 3300005366 Ga0070659_100464721 Ga0070659_1004647212 267
282 3300005367 Ga0070667_100223219 Ga0070667_1002232192 267
283 3300005435 Ga0070714_100340997 Ga0070714_1003409971 267
284 3300005436 Ga0070713_100035696 Ga0070713_1000356963 267
285 3300005445 Ga0070708_100118886 Ga0070708_1001188862 267
286 3300005467 Ga0070706_100405989 Ga0070706_1004059891 267
287 3300005518 Ga0070699_100054655 Ga0070699_1000546553 267
288 3300005536 Ga0070697_100024841 Ga0070697_1000248415 267
289 3300005548 Ga0070665_100156180 Ga0070665_1001561802 267
290 3300005614 Ga0068856_100363491 Ga0068856_1003634912 267
291 3300005617 Ga0068859_100164123 Ga0068859_1001641232 267
292 3300005618 Ga0068864_100171841 Ga0068864_1001718412 267
293 3300005718 Ga0068866_10319939 Ga0068866_103199392 267
294 3300005719 Ga0068861_100619764 Ga0068861_1006197642 267
295 3300005840 Ga0068870_10112520 Ga0068870_101125202 267
296 3300005844 Ga0068862_100153892 Ga0068862_1001538922 267
297 3300005937 Ga0081455_10000811 Ga0081455_1000081113 267
298 3300005937 Ga0081455_10005965 Ga0081455_1000596512 267
299 3300006038 Ga0075365_10267011 Ga0075365_102670112 267
300 3300006038 Ga0075365_10356144 Ga0075365_103561441 267
301 3300006175 Ga0070712_100294553 Ga0070712_1002945532 267
302 3300006237 Ga0097621_100274829 Ga0097621_1002748292 267
303 3300006844 Ga0075428_100057649 Ga0075428_1000576495 267
304 3300006844 Ga0075428_100138237 Ga0075428_1001382373 267
305 3300006844 Ga0075428_100224136 Ga0075428_1002241363 267
306 3300006846 Ga0075430_100022060 Ga0075430_1000220603 267
307 3300006846 Ga0075430_100152968 Ga0075430_1001529681 267
308 3300006847 Ga0075431_100024205 Ga0075431_1000242055 267
309 3300006847 Ga0075431_100034351 Ga0075431_1000343514 267
310 3300006847 Ga0075431_100088529 Ga0075431_1000885292 267
311 3300006871 Ga0075434_100041044 Ga0075434_1000410442 267
312 3300006880 Ga0075429_100010864 Ga0075429_1000108642 267
313 3300006931 Ga0097620_100164122 Ga0097620_1001641222 267
314 3300009093 Ga0105240_10130864 Ga0105240_101308642 267
315 3300009093 Ga0105240_10528113 Ga0105240_105281132 267
316 3300009094 Ga0111539_10364783 Ga0111539_103647832 267
317 3300009147 Ga0114129_10033312 Ga0114129_100333125 267
318 3300009147 Ga0114129_10046783 Ga0114129_100467835 267
319 3300009147 Ga0114129_10049896 Ga0114129_100498962 267
320 3300009147 Ga0114129_10153397 Ga0114129_101533972 267
321 3300009148 Ga0105243_10310460 Ga0105243_103104602 267
322 3300009551 Ga0105238_10000267 Ga0105238_1000026727 267
323 3300009551 Ga0105238_10623519 Ga0105238_106235191 267
324 3300009553 Ga0105249_10162886 Ga0105249_101628862 267
325 3300011119 Ga0105246_10073623 Ga0105246_100736232 267
326 3300013297 Ga0157378_10145209 Ga0157378_101452092 267
327 3300013306 Ga0163162_10464899 Ga0163162_104648992 267
328 3300014326 Ga0157380_10230710 Ga0157380_102307102 267
329 3300014745 Ga0157377_10069056 Ga0157377_100690562 267
330 3300014968 Ga0157379_10240680 Ga0157379_102406802 267
331 3300014969 Ga0157376_10192097 Ga0157376_101920972 267
332 3300025885 Ga0207653_10010554 Ga0207653_100105542 267
333 3300025893 Ga0207682_10071454 Ga0207682_100714541 267
334 3300025904 Ga0207647_10070436 Ga0207647_100704362 267
335 3300025907 Ga0207645_10007804 Ga0207645_100078042 267
336 3300025908 Ga0207643_10001647 Ga0207643_1000164710 267
337 3300025910 Ga0207684_10014921 Ga0207684_100149213 267
338 3300025913 Ga0207695_10098495 Ga0207695_100984952 267
339 3300025915 Ga0207693_10032535 Ga0207693_100325354 267
340 3300025918 Ga0207662_10009149 Ga0207662_100091492 267
341 3300025919 Ga0207657_10034284 Ga0207657_100342842 267
342 3300025924 Ga0207694_10003702 Ga0207694_100037025 267
343 3300025925 Ga0207650_10018120 Ga0207650_100181205 267
344 3300025925 Ga0207650_10141920 Ga0207650_101419202 267
345 3300025926 Ga0207659_10149501 Ga0207659_101495012 267
346 3300025931 Ga0207644_10239768 Ga0207644_102397681 267
347 3300025933 Ga0207706_10031576 Ga0207706_100315765 267
348 3300025940 Ga0207691_10099308 Ga0207691_100993082 267
349 3300025941 Ga0207711_10232344 Ga0207711_102323442 267
350 3300025942 Ga0207689_10033977 Ga0207689_100339772 267
351 3300025945 Ga0207679_10105418 Ga0207679_101054182 267
352 3300025986 Ga0207658_10226656 Ga0207658_102266562 267
353 3300026041 Ga0207639_10042634 Ga0207639_100426342 267
354 3300026075 Ga0207708_10071299 Ga0207708_100712992 267
355 3300026089 Ga0207648_10042704 Ga0207648_100427042 267
356 3300026095 Ga0207676_10206255 Ga0207676_102062552 267
357 3300026116 Ga0207674_10047208 Ga0207674_100472084 267
358 3300026118 Ga0207675_100006871 Ga0207675_1000068719 267
359 3300026121 Ga0207683_10185011 Ga0207683_101850112 267
360 3300041512 Ga0451853_1145584 Ga0451853_1145584_502_1323 267
361 3300046463 Ga0495653_0088300 Ga0495653_0088300_16_879 267
362 3300046474 Ga0495605_0055179 Ga0495605_0055179_899_1705 267
363 3300046513 Ga0495616_0077305 Ga0495616_0077305_101_922 267
364 3300046516 Ga0495628_0162302 Ga0495628_0162302_350_1171 267
365 3300046615 Ga0495656_0004258 Ga0495656_0004258_401_1222 267
366 3300046615 Ga0495656_0160274 Ga0495656_0160274_258_1064 267
367 3300047322 Ga0495680_0083319 Ga0495680_0083319_1329_2135 267
368 3300048903 Ga0496100_0155798 Ga0496100_0155798_501_1322 267
369 3300048904 Ga0496101_0038952 Ga0496101_0038952_662_1483 267
370 3300048906 Ga0496103_0001026 Ga0496103_0001026_2525_3346 267
371 3300048907 Ga0496104_0016013 Ga0496104_0016013_3214_4092 267
372 3300048907 Ga0496104_0103414 Ga0496104_0103414_540_1361 267
373 3300048907 Ga0496104_0195548 Ga0496104_0195548_563_1369 267
374 3300048908 Ga0496105_0004542 Ga0496105_0004542_457_1320 267
375 3300048909 Ga0496106_0132751 Ga0496106_0132751_923_1744 267
376 3300048910 Ga0496107_0333108 Ga0496107_0333108_164_970 267
377 3300048911 Ga0496108_0000552 Ga0496108_0000552_4041_4904 267
378 3300048911 Ga0496108_0248410 Ga0496108_0248410_255_1076 267
379 3300048912 Ga0496109_0002241 Ga0496109_0002241_11727_12605 267
380 3300048913 Ga0496110_0018928 Ga0496110_0018928_2833_3639 267
381 3300048914 Ga0496111_0008382 Ga0496111_0008382_1654_2517 267
382 3300048914 Ga0496111_0086659 Ga0496111_0086659_969_1775 267
383 3300048916 Ga0496113_0001551 Ga0496113_0001551_7740_8603 267
384 3300048917 Ga0496114_0056970 Ga0496114_0056970_401_1207 267
385 3300049741 Ga0501079_0080697 Ga0501079_0080697_1088_1894 267
386 3300050492 nmdc:mga0yw44_342574_c1 nmdc:mga0yw44_342574_c1_41_862 267
387 3300050492 nmdc:mga0yw44_6236_c1 nmdc:mga0yw44_6236_c1_2207_3013 267
388 3300050507 nmdc:mga05p37_115151_c1 nmdc:mga05p37_115151_c1_961_1839 267
389 3300050507 nmdc:mga05p37_313130_c1 nmdc:mga05p37_313130_c1_485_1291 267
390 3300050507 nmdc:mga05p37_434958_c1 nmdc:mga05p37_434958_c1_596_1402 267
391 3300050507 nmdc:mga05p37_631204_c1 nmdc:mga05p37_631204_c1_321_1127 267
392 3300050508 nmdc:mga09592_97792_c1 nmdc:mga09592_97792_c1_1559_2365 267
393 3300050509 nmdc:mga0qj67_134974_c1 nmdc:mga0qj67_134974_c1_434_1240 267
394 3300050509 nmdc:mga0qj67_47653_c1 nmdc:mga0qj67_47653_c1_1442_2248 267
395 3300050510 nmdc:mga06r32_35869_c1 nmdc:mga06r32_35869_c1_1471_2277 267
396 3300050510 nmdc:mga06r32_82669_c1 nmdc:mga06r32_82669_c1_1740_2546 267
397 3300050511 nmdc:mga08y16_154078_c1 nmdc:mga08y16_154078_c1_990_1853 267
398 3300050515 nmdc:mga0a205_117897_c1 nmdc:mga0a205_117897_c1_1372_2178 267
399 3300053085 Ga0495619_0069625 Ga0495619_0069625_1040_1903 267
400 3300053085 Ga0495619_0143378 Ga0495619_0143378_617_1438 267
401 3300053091 Ga0500647_0047266 Ga0500647_0047266_821_1633 267
402 3300060353 Ga0501082_0367805 Ga0501082_0367805_318_1124 267
403 3300061734 Ga0530510_0264567 Ga0530510_0264567_102_932 267
404 3300005467 Ga0070706_100016067 Ga0070706_1000160672 268
405 3300005471 Ga0070698_100070901 Ga0070698_1000709012 268
406 3300005471 Ga0070698_100181896 Ga0070698_1001818961 268
407 3300006028 Ga0070717_10264506 Ga0070717_102645061 268
408 3300006028 Ga0070717_10446103 Ga0070717_104461032 268
409 3300009545 Ga0105237_10211517 Ga0105237_102115172 268
410 3300025910 Ga0207684_10035583 Ga0207684_100355831 268
411 3300025910 Ga0207684_10166974 Ga0207684_101669741 268
412 3300035170 Ga0373943_0012079 Ga0373943_0012079_2881_3705 268
413 3300035170 Ga0373943_0042609 Ga0373943_0042609_506_1315 268
414 3300035171 Ga0373946_0175705 Ga0373946_0175705_41_865 268
415 3300035692 Ga0373935_0024433 Ga0373935_0024433_2278_3102 268
416 3300035695 Ga0373927_0141211 Ga0373927_0141211_467_1291 268
417 3300035725 Ga0373947_0015100 Ga0373947_0015100_1086_1910 268
418 3300035725 Ga0373947_0025699 Ga0373947_0025699_1498_2307 268
419 3300037068 Ga0373925_0034944 Ga0373925_0034944_17_826 268
420 3300037068 Ga0373925_0133081 Ga0373925_0133081_480_1304 268
421 3300038443 Ga0395901_0018973 Ga0395901_0018973_3331_4140 268
422 3300039438 Ga0436360_0454558 Ga0436360_0454558_1163_1969 268
423 3300044656 Ga0466969_0097777 Ga0466969_0097777_15_824 268
424 3300044765 Ga0466970_0028743 Ga0466970_0028743_66_875 268
425 3300045049 Ga0466959_0001806 Ga0466959_0001806_60_869 268
426 3300046455 Ga0495603_0087466 Ga0495603_0087466_476_1300 268
427 3300046475 Ga0495639_0068584 Ga0495639_0068584_202_1011 268
428 3300046476 Ga0495662_0165298 Ga0495662_0165298_70_936 268
429 3300046491 Ga0495584_0043813 Ga0495584_0043813_698_1507 268
430 3300046492 Ga0495585_0014506 Ga0495585_0014506_3714_4523 268
431 3300046499 Ga0495594_0081541 Ga0495594_0081541_641_1465 268
432 3300046500 Ga0495596_0063233 Ga0495596_0063233_88_912 268
433 3300046523 Ga0495644_0022053 Ga0495644_0022053_1468_2292 268
434 3300046525 Ga0495663_0068550 Ga0495663_0068550_46_855 268
435 3300046531 Ga0495665_0081285 Ga0495665_0081285_34_858 268
436 3300046615 Ga0495656_0022509 Ga0495656_0022509_1116_1925 268
437 3300046674 Ga0495588_0006437 Ga0495588_0006437_2471_3295 268
438 3300046690 Ga0495624_0022066 Ga0495624_0022066_443_1267 268
439 3300046691 Ga0495670_0073480 Ga0495670_0073480_532_1356 268
440 3300046810 Ga0495660_0117851 Ga0495660_0117851_295_1119 268
441 3300047315 Ga0495581_0071680 Ga0495581_0071680_210_1091 268
442 3300047321 Ga0495676_0026477 Ga0495676_0026477_2374_3198 268
443 3300047446 Ga0495679_049837 Ga0495679_049837_175_999 268
444 3300047471 Ga0495684_0133945 Ga0495684_0133945_44_925 268
445 3300048904 Ga0496101_0072781 Ga0496101_0072781_705_1571 268
446 3300049592 Ga0501076_0277529 Ga0501076_0277529_171_980 268
447 3300054114 Ga0501084_0256898 Ga0501084_0256898_630_1439 268
448 3300061719 Ga0466962_0002588 Ga0466962_0002588_1972_2781 268
449 3300061734 Ga0530510_0042674 Ga0530510_0042674_360_1169 268
450 3300001979 JGI24740J21852_10011937 JGI24740J21852_100119373 269
451 3300001989 JGI24739J22299_10001070 JGI24739J22299_100010705 269
452 3300001990 JGI24737J22298_10029437 JGI24737J22298_100294372 269
453 3300002067 JGI24735J21928_10019519 JGI24735J21928_100195191 269
454 3300005327 Ga0070658_10282165 Ga0070658_102821651 269
455 3300005333 Ga0070677_10041197 Ga0070677_100411972 269
456 3300005354 Ga0070675_100172049 Ga0070675_1001720492 269
457 3300005355 Ga0070671_100094667 Ga0070671_1000946672 269
458 3300005356 Ga0070674_100013196 Ga0070674_1000131965 269
459 3300005367 Ga0070667_100129568 Ga0070667_1001295682 269
460 3300005455 Ga0070663_100076663 Ga0070663_1000766631 269
461 3300005457 Ga0070662_100009490 Ga0070662_1000094901 269
462 3300005459 Ga0068867_100188668 Ga0068867_1001886681 269
463 3300005539 Ga0068853_100023049 Ga0068853_1000230492 269
464 3300005563 Ga0068855_100007104 Ga0068855_10000710413 269
465 3300005577 Ga0068857_100002731 Ga0068857_1000027313 269
466 3300005618 Ga0068864_100069037 Ga0068864_1000690374 269
467 3300005719 Ga0068861_100009730 Ga0068861_1000097302 269
468 3300005834 Ga0068851_10002665 Ga0068851_100026655 269
469 3300009011 Ga0105251_10049031 Ga0105251_100490312 269
470 3300009093 Ga0105240_10014186 Ga0105240_1001418611 269
471 3300009093 Ga0105240_10020530 Ga0105240_100205305 269
472 3300009177 Ga0105248_10100766 Ga0105248_101007663 269
473 3300009177 Ga0105248_10188225 Ga0105248_101882253 269
474 3300009545 Ga0105237_10005308 Ga0105237_100053082 269
475 3300009551 Ga0105238_10008830 Ga0105238_100088304 269
476 3300009551 Ga0105238_10014255 Ga0105238_100142553 269
477 3300009551 Ga0105238_10060087 Ga0105238_100600873 269
478 3300010375 Ga0105239_10009260 Ga0105239_100092602 269
479 3300010375 Ga0105239_10013296 Ga0105239_100132962 269
480 3300013308 Ga0157375_10003266 Ga0157375_100032664 269
481 3300013308 Ga0157375_10946667 Ga0157375_109466672 269
482 3300017792 Ga0163161_10075741 Ga0163161_100757413 269
483 3300025893 Ga0207682_10007892 Ga0207682_100078923 269
484 3300025904 Ga0207647_10000127 Ga0207647_1000012741 269
485 3300025907 Ga0207645_10214386 Ga0207645_102143862 269
486 3300025911 Ga0207654_10000081 Ga0207654_1000008161 269
487 3300025913 Ga0207695_10052319 Ga0207695_100523192 269
488 3300025913 Ga0207695_10067580 Ga0207695_100675804 269
489 3300025914 Ga0207671_10086181 Ga0207671_100861811 269
490 3300025914 Ga0207671_10143048 Ga0207671_101430482 269
491 3300025923 Ga0207681_10032058 Ga0207681_100320584 269
492 3300025924 Ga0207694_10000134 Ga0207694_1000013413 269
493 3300025926 Ga0207659_10347444 Ga0207659_103474442 269
494 3300025931 Ga0207644_10109716 Ga0207644_101097162 269
495 3300025937 Ga0207669_10194765 Ga0207669_101947652 269
496 3300025941 Ga0207711_10055387 Ga0207711_100553872 269
497 3300025949 Ga0207667_10001417 Ga0207667_1000141730 269
498 3300025949 Ga0207667_10032615 Ga0207667_100326153 269
499 3300025960 Ga0207651_10081004 Ga0207651_100810042 269
500 3300025981 Ga0207640_10011101 Ga0207640_100111014 269
501 3300026035 Ga0207703_10462271 Ga0207703_104622711 269
502 3300026041 Ga0207639_10017795 Ga0207639_100177953 269
503 3300026041 Ga0207639_10154118 Ga0207639_101541182 269
504 3300026067 Ga0207678_10056749 Ga0207678_100567492 269
505 3300026067 Ga0207678_10232509 Ga0207678_102325091 269
506 3300026078 Ga0207702_10000180 Ga0207702_1000018013 269
507 3300026078 Ga0207702_10073499 Ga0207702_100734992 269
508 3300026089 Ga0207648_10097754 Ga0207648_100977542 269
509 3300026095 Ga0207676_10116646 Ga0207676_101166462 269
510 3300026116 Ga0207674_10001278 Ga0207674_1000127815 269
511 3300026118 Ga0207675_100017479 Ga0207675_1000174792 269
512 3300026121 Ga0207683_10494082 Ga0207683_104940821 269
513 3300031711 Ga0265314_10004840 Ga0265314_100048408 269
514 3300031731 Ga0307405_10005061 Ga0307405_100050615 269
515 3300031852 Ga0307410_10013156 Ga0307410_100131566 269
516 3300031903 Ga0307407_10046811 Ga0307407_100468112 269
517 3300031995 Ga0307409_100020544 Ga0307409_1000205442 269
518 3300032002 Ga0307416_100099944 Ga0307416_1000999441 269
519 3300032004 Ga0307414_10113758 Ga0307414_101137582 269
520 3300032005 Ga0307411_10059859 Ga0307411_100598592 269
521 3300037418 Ga0395900_0282554 Ga0395900_0282554_604_1416 269
522 3300046455 Ga0495603_0164097 Ga0495603_0164097_218_1030 269
523 3300046460 Ga0495638_0006033 Ga0495638_0006033_2259_3092 269
524 3300046474 Ga0495605_0001268 Ga0495605_0001268_1388_2221 269
525 3300046523 Ga0495644_0008346 Ga0495644_0008346_247_1080 269
526 3300046530 Ga0495654_0153970 Ga0495654_0153970_157_990 269
527 3300046539 Ga0495621_0028363 Ga0495621_0028363_944_1756 269
528 3300046542 Ga0495597_0044494 Ga0495597_0044494_1100_1933 269
529 3300046684 Ga0495669_0042113 Ga0495669_0042113_871_1704 269
530 3300046691 Ga0495670_0115798 Ga0495670_0115798_113_925 269
531 3300046794 Ga0495589_0013321 Ga0495589_0013321_1304_2137 269
532 3300047320 Ga0495672_0043292 Ga0495672_0043292_101_1036 269
533 3300049579 Ga0501043_0000053 Ga0501043_0000053_52319_53185 269
534 3300049580 Ga0501046_0000018 Ga0501046_0000018_13104_13970 269
535 3300049581 Ga0501047_0000020 Ga0501047_0000020_51913_52779 269
536 3300049582 Ga0501048_0000795 Ga0501048_0000795_13545_14411 269
537 3300049823 Ga0501044_0076161 Ga0501044_0076161_238_1104 269
538 3300049824 Ga0501045_0006612 Ga0501045_0006612_5561_6427 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

62

241

0.94

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

59

307

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qk8-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.9746 6 263
3qk8-assembly1.cif.gz_D crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.9714 6 264
3q1t-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium avium 0.9697 6 263
7m3w-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis 0.9693 2 264
1wz8-assembly1.cif.gz_D crystal structure of probable enoyl-coa dehydratase from thermus thermophilus hb8 0.9662 5 264
ID Description Score Start End Superfamily
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9524 5 206 3.90.226.10
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9376 10 254 3.90.226.10
1szoD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9275 3 244 3.90.226.10
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9257 5 206 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9239 11 209 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7Z9Y011-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9799 6 242 GO:0016853
AF-A0A7V3I0T4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9785 65 267 GO:0016853
AF-A0A521YQ15-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.978 1 268 GO:0016853
AF-A0A7W1R674-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9777 1 243 GO:0016853
AF-A0A4V1UHM0-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9776 1 219 GO:0016853

Feature Viewer

pLDDT pTM Quality
94.27 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map