F461007

General Info

Members Datasets Scaffolds Average Seq Length
538 290 1076 150

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10987062|Ga0105248_109870622
Length 176
Sequence MKIGKPRLIGAGVAALARKFRNDRNAMLRDTIKSAQVAAMKAGDKPRLAAVRLILAKLKDKDIQLRTASSVPDDDTVVVDVLQKMAKQRRESIALFEQGGRQELADVEKGELAVIEEFMPAQLSDEEVKAAIEAIKAEVGATSIKDMGKVVAALKARHGSQLDMGRASGLVKAALA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
223 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
224 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
257 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
258 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
263 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
264 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
265 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
266 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
267 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
268 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
269 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
270 2773857925 Microvirga vignae BR3299 Isolate Unclassified
271 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
272 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
273 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
274 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
275 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
276 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
277 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
278 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
279 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
280 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
281 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
282 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
283 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
284 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
285 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
286 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
287 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
288 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
289 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
290 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.93
Bulb 0
Endosphere 15.06
Nodule 0
Rhizoplane 7.06
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10987062 3300009177 Bacteria 951
2 SwRhRL2b_contig_2631586 2162886007 Bacteria 27217
3 SwRhRL2b_contig_835169 2162886007 Bacteria 6436
4 JGI24741J21665_1007896 3300001915 Bacteria 2037
5 JGI24739J22299_10025526 3300001989 Bacteria 2078
6 JGI24737J22298_10014495 3300001990 Bacteria 2559
7 JGI24735J21928_10035320 3300002067 Bacteria 1471
8 JGI24751J29686_10000337 3300002459 Bacteria 16969
9 rootH1_10065628 3300003316 Bacteria 1908
10 rootL2_10066168 3300003322 Bacteria 2195
11 Ga0055536_1002772 3300003781 Bacteria 9701
12 Ga0055536_1020746 3300003781 Bacteria 2017
13 Ga0055530_10010695 3300003791 Bacteria 3362
14 Ga0055531_10011315 3300003794 Bacteria 4323
15 Ga0055531_10013743 3300003794 Bacteria 3708
16 Ga0055531_10057582 3300003794 Bacteria 973
17 Ga0065165_1002128 3300005262 Bacteria 18000
18 Ga0065704_10005270 3300005289 Bacteria 5103
19 Ga0065704_10071995 3300005289 Bacteria 9433
20 Ga0070658_10011747 3300005327 Bacteria 7027
21 Ga0070658_10120930 3300005327 Bacteria 2176
22 Ga0070658_10294739 3300005327 Bacteria 1383
23 Ga0070690_100523028 3300005330 Bacteria 891
24 Ga0070677_10147583 3300005333 Bacteria 1091
25 Ga0070666_10011895 3300005335 Bacteria 5473
26 Ga0070682_100149702 3300005337 Bacteria 1600
27 Ga0070682_100366657 3300005337 Bacteria 1079
28 Ga0070660_100165132 3300005339 Bacteria 1786
29 Ga0070660_100362607 3300005339 Bacteria 1194
30 Ga0070661_100399406 3300005344 Bacteria 1087
31 Ga0070668_100019334 3300005347 Bacteria 5127
32 Ga0070668_100169459 3300005347 Bacteria 1777
33 Ga0070668_100231148 3300005347 Bacteria 1529
34 Ga0070669_100000331 3300005353 Bacteria 36787
35 Ga0070669_100000844 3300005353 Bacteria 22228
36 Ga0070669_100574932 3300005353 Bacteria 942
37 Ga0070669_101037063 3300005353 Bacteria 705
38 Ga0070671_100000054 3300005355 Bacteria 77908
39 Ga0070671_100011790 3300005355 Bacteria 7032
40 Ga0070674_101090071 3300005356 Bacteria 705
41 Ga0070659_100918889 3300005366 Bacteria 765
42 Ga0070667_100001748 3300005367 Bacteria 19412
43 Ga0070667_100002367 3300005367 Bacteria 16511
44 Ga0070663_100008803 3300005455 Bacteria 6227
45 Ga0070662_100492731 3300005457 Bacteria 1021
46 Ga0070681_10337182 3300005458 Bacteria 1417
47 Ga0070679_100950926 3300005530 Bacteria 803
48 Ga0068853_100354874 3300005539 Bacteria 1365
49 Ga0070686_100657507 3300005544 Bacteria 831
50 Ga0070693_100162335 3300005547 Bacteria 1424
51 Ga0070665_100000076 3300005548 Bacteria 189228
52 Ga0070665_100005309 3300005548 Bacteria 13308
53 Ga0070665_100013141 3300005548 Bacteria 8338
54 Ga0070665_100321325 3300005548 Bacteria 1552
55 Ga0068855_100002646 3300005563 Bacteria 22080
56 Ga0068855_100267425 3300005563 Bacteria 1902
57 Ga0068855_100668969 3300005563 Bacteria 1114
58 Ga0068855_100922434 3300005563 Bacteria 921
59 Ga0070664_100053814 3300005564 Bacteria 3413
60 Ga0068857_100870711 3300005577 Bacteria 863
61 Ga0068854_100030099 3300005578 Bacteria 3763
62 Ga0068854_100243635 3300005578 Bacteria 1433
63 Ga0068854_100251056 3300005578 Bacteria 1412
64 Ga0068854_100665944 3300005578 Bacteria 895
65 Ga0068854_100715747 3300005578 Bacteria 865
66 Ga0068856_100032517 3300005614 Bacteria 5107
67 Ga0068852_100013014 3300005616 Bacteria 6350
68 Ga0068852_100070380 3300005616 Bacteria 3069
69 Ga0068852_100661237 3300005616 Bacteria 1053
70 Ga0068859_100471427 3300005617 Bacteria 1351
71 Ga0068859_101200528 3300005617 Bacteria 835
72 Ga0068864_100005976 3300005618 Bacteria 9982
73 Ga0068864_100471432 3300005618 Bacteria 1204
74 Ga0068864_101828434 3300005618 Bacteria 613
75 Ga0068863_100000014 3300005841 Bacteria 216135
76 Ga0068863_100107119 3300005841 Bacteria 2659
77 Ga0068858_100008863 3300005842 Bacteria 9644
78 Ga0068858_100147524 3300005842 Bacteria 2210
79 Ga0068860_100000007 3300005843 Bacteria 429329
80 Ga0068860_100010788 3300005843 Bacteria 9018
81 Ga0068860_100049195 3300005843 Bacteria 4017
82 Ga0068860_100561677 3300005843 Bacteria 1144
83 Ga0068860_100572470 3300005843 Bacteria 1133
84 Ga0068862_100173145 3300005844 Bacteria 1933
85 Ga0075363_100012810 3300006048 Bacteria 4048
86 Ga0075364_10057587 3300006051 Bacteria 2546
87 Ga0075432_10000396 3300006058 Bacteria 12682
88 Ga0070712_100632525 3300006175 Bacteria 908
89 Ga0075362_10000104 3300006177 Bacteria 23319
90 Ga0075362_10274158 3300006177 Bacteria 833
91 Ga0075369_10012386 3300006186 Bacteria 3370
92 Ga0075369_10040988 3300006186 Bacteria 1981
93 Ga0075366_10000168 3300006195 Bacteria 28069
94 Ga0075366_10001553 3300006195 Bacteria 11489
95 Ga0075366_10239588 3300006195 Bacteria 1106
96 Ga0075366_10344538 3300006195 Bacteria 914
97 Ga0075370_10000032 3300006353 Bacteria 44839
98 Ga0075370_10151275 3300006353 Bacteria 1360
99 Ga0075436_100521863 3300006914 Bacteria 870
100 Ga0097620_100471469 3300006931 Bacteria 1351
101 Ga0097620_101200538 3300006931 Bacteria 835
102 Ga0097620_101244494 3300006931 Bacteria 820
103 Ga0075435_100310641 3300007076 Bacteria 1349
104 Ga0105250_10011477 3300009092 Bacteria 3675
105 Ga0105240_10017210 3300009093 Bacteria 9751
106 Ga0105240_10023630 3300009093 Bacteria 8120
107 Ga0105240_10068409 3300009093 Bacteria 4398
108 Ga0105240_10189666 3300009093 Bacteria 2418
109 Ga0105240_10254355 3300009093 Bacteria 2030
110 Ga0105247_10109994 3300009101 Bacteria 1772
111 Ga0105247_10265677 3300009101 Bacteria 1178
112 Ga0105241_10003433 3300009174 Bacteria 11789
113 Ga0105241_10460656 3300009174 Bacteria 1126
114 Ga0105248_10304840 3300009177 Bacteria 1794
115 Ga0105237_10023684 3300009545 Bacteria 6287
116 Ga0105237_10467768 3300009545 Bacteria 1267
117 Ga0105238_10041851 3300009551 Bacteria 4640
118 Ga0105238_10105018 3300009551 Bacteria 2806
119 Ga0105238_10657277 3300009551 Bacteria 1058
120 Ga0105238_11378986 3300009551 Bacteria 732
121 Ga0105238_11521175 3300009551 Bacteria 698
122 Ga0105249_10027063 3300009553 Bacteria 5173
123 Ga0105239_10494357 3300010375 Bacteria 1390
124 Ga0105239_11204249 3300010375 Bacteria 873
125 Ga0157371_10053694 3300013102 Bacteria 2862
126 Ga0157370_10082691 3300013104 Bacteria 3019
127 Ga0157370_10298696 3300013104 Bacteria 1487
128 Ga0157370_10379304 3300013104 Bacteria 1302
129 Ga0157370_11207149 3300013104 Bacteria 682
130 Ga0157369_10535275 3300013105 Bacteria 1211
131 Ga0163162_10027930 3300013306 Bacteria 5581
132 Ga0163162_10029922 3300013306 Bacteria 5392
133 Ga0163162_10179389 3300013306 Bacteria 2244
134 Ga0163163_10631692 3300014325 Bacteria 1134
135 Ga0157380_10065513 3300014326 Bacteria 2920
136 Ga0157380_10531026 3300014326 Bacteria 1150
137 Ga0157379_10165292 3300014968 Bacteria 1997
138 Ga0213872_10042568 3300021361 Bacteria 2070
139 Ga0213872_10148033 3300021361 Bacteria 1027
140 Ga0213872_10179910 3300021361 Bacteria 914
141 Ga0213874_10082300 3300021377 Bacteria 1045
142 Ga0213876_10067283 3300021384 Bacteria 1892
143 Ga0213876_10160358 3300021384 Bacteria 1196
144 Ga0207425_1021560 3300025245 Bacteria 1365
145 Ga0209675_1000555 3300025291 Bacteria 27086
146 Ga0209676_1000155 3300025292 Bacteria 165151
147 Ga0209676_1001076 3300025292 Bacteria 30900
148 Ga0209676_1009010 3300025292 Bacteria 4365
149 Ga0209676_1088627 3300025292 Bacteria 686
150 Ga0209025_1008149 3300025294 Bacteria 7597
151 Ga0209025_1098069 3300025294 Bacteria 937
152 Ga0209758_1080656 3300025297 Bacteria 985
153 Ga0209050_1000068 3300025298 Bacteria 298849
154 Ga0209050_1002807 3300025298 Bacteria 13915
155 Ga0209050_1033720 3300025298 Bacteria 1546
156 Ga0209257_1000193 3300025304 Bacteria 151777
157 Ga0209257_1001718 3300025304 Bacteria 24492
158 Ga0209257_1007361 3300025304 Bacteria 6670
159 Ga0207697_10101677 3300025315 Bacteria 1225
160 Ga0207656_10039919 3300025321 Bacteria 1988
161 Ga0207696_1067173 3300025711 Bacteria 1001
162 Ga0207713_1001630 3300025735 Bacteria 17482
163 Ga0207680_10149026 3300025903 Bacteria 1558
164 Ga0207647_10011941 3300025904 Bacteria 6065
165 Ga0207647_10018455 3300025904 Bacteria 4716
166 Ga0207705_10000004 3300025909 Bacteria 705756
167 Ga0207654_10097808 3300025911 Bacteria 1802
168 Ga0207654_10890940 3300025911 Bacteria 645
169 Ga0207695_10015212 3300025913 Bacteria 9073
170 Ga0207695_10051135 3300025913 Bacteria 4341
171 Ga0207695_10075504 3300025913 Bacteria 3429
172 Ga0207695_10158335 3300025913 Bacteria 2198
173 Ga0207671_10028314 3300025914 Bacteria 4186
174 Ga0207671_10539194 3300025914 Bacteria 930
175 Ga0207671_10567092 3300025914 Bacteria 905
176 Ga0207657_10069301 3300025919 Bacteria 2994
177 Ga0207649_10178104 3300025920 Bacteria 1486
178 Ga0207681_10000145 3300025923 Bacteria 58987
179 Ga0207681_10000232 3300025923 Bacteria 43369
180 Ga0207681_10178679 3300025923 Bacteria 1615
181 Ga0207694_10019279 3300025924 Bacteria 5156
182 Ga0207694_10046073 3300025924 Bacteria 3370
183 Ga0207694_11023488 3300025924 Bacteria 699
184 Ga0207700_11493647 3300025928 Bacteria 599
185 Ga0207700_11608623 3300025928 Bacteria 575
186 Ga0207644_10000003 3300025931 Bacteria 585905
187 Ga0207644_10022927 3300025931 Bacteria 4270
188 Ga0207644_10148371 3300025931 Bacteria 1813
189 Ga0207644_10285315 3300025931 Bacteria 1326
190 Ga0207690_10226791 3300025932 Bacteria 1432
191 Ga0207706_10746866 3300025933 Bacteria 834
192 Ga0207669_10790387 3300025937 Bacteria 786
193 Ga0207711_10197853 3300025941 Bacteria 1833
194 Ga0207711_10442208 3300025941 Bacteria 1210
195 Ga0207711_11269949 3300025941 Bacteria 678
196 Ga0207679_10264545 3300025945 Bacteria 1468
197 Ga0207667_10004217 3300025949 Bacteria 17643
198 Ga0207667_10382436 3300025949 Bacteria 1434
199 Ga0207667_10588878 3300025949 Bacteria 1122
200 Ga0207712_10189226 3300025961 Bacteria 1623
201 Ga0207668_10210999 3300025972 Bacteria 1553
202 Ga0207668_10260108 3300025972 Bacteria 1414
203 Ga0207668_10579982 3300025972 Bacteria 975
204 Ga0207668_10673268 3300025972 Bacteria 907
205 Ga0207668_11733692 3300025972 Bacteria 564
206 Ga0207640_10009386 3300025981 Bacteria 5477
207 Ga0207640_10059592 3300025981 Bacteria 2520
208 Ga0207640_10197930 3300025981 Bacteria 1520
209 Ga0207640_11083293 3300025981 Bacteria 708
210 Ga0207658_10004029 3300025986 Bacteria 10282
211 Ga0207658_10005026 3300025986 Bacteria 9111
212 Ga0207658_10005415 3300025986 Bacteria 8751
213 Ga0207658_10137255 3300025986 Bacteria 1974
214 Ga0207703_10008591 3300026035 Bacteria 8061
215 Ga0207703_10054601 3300026035 Bacteria 3250
216 Ga0207703_10154147 3300026035 Bacteria 2006
217 Ga0207639_10002936 3300026041 Bacteria 11459
218 Ga0207639_10629271 3300026041 Bacteria 991
219 Ga0207678_10001360 3300026067 Bacteria 22535
220 Ga0207702_10011706 3300026078 Bacteria 7307
221 Ga0207702_10283372 3300026078 Bacteria 1567
222 Ga0207702_11869029 3300026078 Bacteria 592
223 Ga0207641_10000035 3300026088 Bacteria 214358
224 Ga0207641_10658424 3300026088 Bacteria 1029
225 Ga0207676_10060953 3300026095 Bacteria 2986
226 Ga0207676_10146889 3300026095 Bacteria 2026
227 Ga0207676_10363426 3300026095 Bacteria 1342
228 Ga0207676_11680763 3300026095 Bacteria 633
229 Ga0207674_10334417 3300026116 Bacteria 1464
230 Ga0207698_10007224 3300026142 Bacteria 6958
231 Ga0207698_10051468 3300026142 Bacteria 3149
232 Ga0207698_10313778 3300026142 Bacteria 1465
233 Ga0207428_10226854 3300027907 Bacteria 1399
234 Ga0268266_10002375 3300028379 Bacteria 20339
235 Ga0268266_10008265 3300028379 Bacteria 9274
236 Ga0268266_10018790 3300028379 Bacteria 5889
237 Ga0268266_10259092 3300028379 Bacteria 1611
238 Ga0268265_10105406 3300028380 Bacteria 2287
239 Ga0268265_11595662 3300028380 Bacteria 657
240 Ga0268264_10000077 3300028381 Bacteria 252597
241 Ga0268264_10029005 3300028381 Bacteria 4530
242 Ga0268264_10039299 3300028381 Bacteria 3909
243 Ga0268264_10383227 3300028381 Bacteria 1347
244 Ga0268264_10539214 3300028381 Bacteria 1143
245 Ga0307515_10077071 3300028794 Bacteria 4409
246 Ga0265330_10270779 3300031235 Bacteria 715
247 Ga0265325_10058801 3300031241 Bacteria 1957
248 Ga0265340_10060930 3300031247 Bacteria 1806
249 Ga0265331_10013964 3300031250 Bacteria 4295
250 Ga0265316_10141027 3300031344 Bacteria 1810
251 Ga0265316_10416417 3300031344 Bacteria 966
252 Ga0265316_10704931 3300031344 Bacteria 711
253 Ga0307408_100071551 3300031548 Bacteria 2564
254 Ga0307408_100163485 3300031548 Bacteria 1770
255 Ga0307408_100305895 3300031548 Bacteria 1333
256 Ga0307408_100466083 3300031548 Bacteria 1099
257 Ga0265313_10059598 3300031595 Bacteria 1795
258 Ga0265314_10109296 3300031711 Bacteria 1760
259 Ga0265314_10287516 3300031711 Bacteria 927
260 Ga0307405_10007770 3300031731 Bacteria 5393
261 Ga0307405_10141876 3300031731 Bacteria 1677
262 Ga0307405_10308596 3300031731 Bacteria 1203
263 Ga0307405_10432929 3300031731 Bacteria 1038
264 Ga0307405_10715031 3300031731 Bacteria 831
265 Ga0307413_10137320 3300031824 Bacteria 1683
266 Ga0307413_10269053 3300031824 Bacteria 1275
267 Ga0307413_10313312 3300031824 Bacteria 1195
268 Ga0307413_10436550 3300031824 Bacteria 1035
269 Ga0307410_10031609 3300031852 Bacteria 3399
270 Ga0307406_10157854 3300031901 Bacteria 1627
271 Ga0307406_10370711 3300031901 Bacteria 1125
272 Ga0307406_11290280 3300031901 Bacteria 637
273 Ga0307407_10007329 3300031903 Bacteria 4988
274 Ga0307412_10001229 3300031911 Bacteria 14546
275 Ga0307412_10070785 3300031911 Bacteria 2379
276 Ga0307412_10300669 3300031911 Bacteria 1268
277 Ga0307412_11437000 3300031911 Bacteria 625
278 Ga0307409_100054093 3300031995 Bacteria 3089
279 Ga0307409_100684381 3300031995 Bacteria 1023
280 Ga0307416_100117927 3300032002 Bacteria 2357
281 Ga0307416_100216504 3300032002 Bacteria 1832
282 Ga0307416_100567125 3300032002 Bacteria 1211
283 Ga0307416_100669352 3300032002 Bacteria 1124
284 Ga0307416_100945657 3300032002 Bacteria 963
285 Ga0307414_10000703 3300032004 Bacteria 17137
286 Ga0307414_10000938 3300032004 Bacteria 14900
287 Ga0307414_10020203 3300032004 Bacteria 4146
288 Ga0307414_10051936 3300032004 Bacteria 2849
289 Ga0307414_10064969 3300032004 Bacteria 2601
290 Ga0307414_10747755 3300032004 Bacteria 888
291 Ga0307414_11254126 3300032004 Bacteria 687
292 Ga0307414_11684278 3300032004 Bacteria 591
293 Ga0307411_10087960 3300032005 Bacteria 2159
294 Ga0307411_10177426 3300032005 Bacteria 1613
295 Ga0307411_10283909 3300032005 Bacteria 1319
296 Ga0307411_10294825 3300032005 Bacteria 1298
297 Ga0307411_10313611 3300032005 Bacteria 1263
298 Ga0307415_100262512 3300032126 Bacteria 1410
299 Ga0307415_100295948 3300032126 Bacteria 1338
300 Ga0307415_102046021 3300032126 Bacteria 558
301 Ga0307510_10141527 3300033180 Bacteria 2048
302 Ga0373948_0087983 3300034817 Bacteria 717
303 Ga0373928_0138871 3300035084 Bacteria 665
304 Ga0373943_0080362 3300035170 Bacteria 1671
305 Ga0373962_0121379 3300035242 Bacteria 834
306 Ga0316574_0322601 3300035398 Bacteria 980
307 Ga0373931_0439252 3300035691 Bacteria 833
308 Ga0316584_0077123 3300036712 Bacteria 2497
309 Ga0316581_0056049 3300037588 Bacteria 1208
310 Ga0436365_0724808 3300039437 Bacteria 1322
311 Ga0436360_0186386 3300039438 Bacteria 700
312 Ga0436360_0689183 3300039438 Bacteria 2724
313 Ga0436360_0703881 3300039438 Bacteria 1262
314 Ga0436361_0008383 3300039447 Bacteria 2653
315 Ga0436361_0516175 3300039447 Bacteria 4899
316 Ga0436361_0554008 3300039447 Unclassified 800
317 Ga0436361_0594283 3300039447 Bacteria 6375
318 Ga0436361_0982139 3300039447 Bacteria 6504
319 Ga0436361_1024998 3300039447 Bacteria 1472
320 Ga0436363_0282676 3300039450 Bacteria 1393
321 Ga0436363_1320142 3300039450 Bacteria 954
322 Ga0436363_1349209 3300039450 Bacteria 1281
323 Ga0436363_1506991 3300039450 Bacteria 795
324 Ga0436362_0035554 3300039453 Bacteria 601
325 Ga0436362_0425159 3300039453 Bacteria 546
326 Ga0436362_0686165 3300039453 Bacteria 589
327 Ga0451807_1759921 3300041486 Bacteria 1346
328 Ga0451839_0761122 3300041496 Bacteria 666
329 Ga0451841_0021166 3300041498 Bacteria 1694
330 Ga0451849_1206638 3300041505 Bacteria 526
331 Ga0451843_1250276 3300041509 Bacteria 670
332 Ga0451853_2312453 3300041512 Bacteria 884
333 Ga0450898_115189 3300042134 Bacteria 571
334 Ga0451577_0097320 3300042876 Bacteria 2628
335 Ga0466966_0067545 3300044684 Bacteria 2245
336 Ga0466966_0143968 3300044684 Bacteria 1455
337 Ga0466961_0315822 3300044693 Bacteria 953
338 Ga0466961_0579271 3300044693 Bacteria 675
339 Ga0466963_0325441 3300044694 Bacteria 1082
340 Ga0453684_1265345 3300044712 Bacteria 771
341 Ga0466957_0019786 3300044842 Bacteria 3962
342 Ga0466957_0185814 3300044842 Bacteria 1359
343 Ga0466959_0234831 3300045049 Bacteria 1268
344 Ga0466958_0175882 3300045836 Bacteria 1357
345 Ga0495627_000248 3300046453 Bacteria 56262
346 Ga0495638_0237495 3300046460 Bacteria 1011
347 Ga0495596_0007580 3300046500 Bacteria 4890
348 Ga0495610_0027643 3300046512 Bacteria 3011
349 Ga0495610_0175652 3300046512 Bacteria 895
350 Ga0495632_0000060 3300046519 Bacteria 120480
351 Ga0495637_0002973 3300046520 Bacteria 9117
352 Ga0495643_0000014 3300046522 Bacteria 314632
353 Ga0495648_0050106 3300046524 Bacteria 2555
354 Ga0495648_0071172 3300046524 Bacteria 2017
355 Ga0495663_0000007 3300046525 Bacteria 262438
356 Ga0495622_0013512 3300046557 Bacteria 3786
357 Ga0495633_0001277 3300046558 Bacteria 19975
358 Ga0495633_0002982 3300046558 Bacteria 11574
359 Ga0495667_0505915 3300046559 Bacteria 757
360 Ga0495668_0012144 3300046616 Bacteria 5121
361 Ga0495668_0236677 3300046616 Bacteria 1000
362 Ga0495625_0041406 3300046660 Bacteria 3353
363 Ga0495625_0232265 3300046660 Bacteria 1204
364 Ga0495671_0000032 3300046692 Bacteria 201185
365 Ga0495671_0009947 3300046692 Bacteria 5291
366 Ga0495673_0123003 3300047469 Bacteria 1026
367 Ga0495686_0234883 3300047472 Bacteria 1037
368 Ga0495626_0005610 3300048091 Bacteria 7277
369 Ga0496100_0030251 3300048903 Bacteria 3357
370 Ga0496100_0070196 3300048903 Bacteria 2335
371 Ga0496100_0244138 3300048903 Bacteria 1326
372 Ga0496101_0082546 3300048904 Bacteria 2378
373 Ga0496101_0092658 3300048904 Bacteria 2250
374 Ga0496101_0502328 3300048904 Bacteria 958
375 Ga0496102_0000361 3300048905 Bacteria 54882
376 Ga0496102_0335808 3300048905 Bacteria 1423
377 Ga0496102_0406748 3300048905 Bacteria 1279
378 Ga0496102_0514204 3300048905 Bacteria 1120
379 Ga0496102_1072670 3300048905 Bacteria 725
380 Ga0496103_0000161 3300048906 Bacteria 70714
381 Ga0496104_0000426 3300048907 Bacteria 36707
382 Ga0496104_0140929 3300048907 Bacteria 2316
383 Ga0496104_0650585 3300048907 Bacteria 963
384 Ga0496105_0000607 3300048908 Bacteria 23937
385 Ga0496105_0011207 3300048908 Bacteria 7074
386 Ga0496105_0123346 3300048908 Bacteria 2135
387 Ga0496105_0676029 3300048908 Bacteria 794
388 Ga0496106_0000284 3300048909 Bacteria 35805
389 Ga0496106_0216705 3300048909 Bacteria 1526
390 Ga0496106_0292514 3300048909 Bacteria 1306
391 Ga0496107_0007109 3300048910 Bacteria 7711
392 Ga0496109_0232768 3300048912 Bacteria 1733
393 Ga0496109_1093452 3300048912 Bacteria 734
394 Ga0496110_0119199 3300048913 Bacteria 2377
395 Ga0496110_0405908 3300048913 Bacteria 1242
396 Ga0496110_1270123 3300048913 Bacteria 645
397 Ga0496111_0322911 3300048914 Bacteria 1143
398 Ga0496112_0084844 3300048915 Bacteria 3133
399 Ga0496112_0883124 3300048915 Bacteria 816
400 Ga0496113_0000423 3300048916 Bacteria 20596
401 Ga0496113_0207314 3300048916 Bacteria 1559
402 Ga0496114_0015588 3300048917 Bacteria 6111
403 Ga0496115_0258137 3300048918 Bacteria 1433
404 Ga0496115_0431198 3300048918 Bacteria 1067
405 Ga0496115_0605574 3300048918 Bacteria 871
406 Ga0496116_0000248 3300048919 Bacteria 97391
407 Ga0496116_0013343 3300048919 Bacteria 6632
408 Ga0496117_0001452 3300048920 Bacteria 34178
409 Ga0496117_0017763 3300048920 Bacteria 5929
410 Ga0496117_0061291 3300048920 Bacteria 2587
411 Ga0496117_0132478 3300048920 Bacteria 1508
412 Ga0496118_0031376 3300048921 Bacteria 4407
413 Ga0496118_0033521 3300048921 Bacteria 4212
414 Ga0496118_0058028 3300048921 Bacteria 2896
415 Ga0496118_0221711 3300048921 Bacteria 1100
416 Ga0496119_0000365 3300048922 Bacteria 63466
417 Ga0496120_0001099 3300048923 Bacteria 35287
418 Ga0496121_0000022 3300048924 Bacteria 472849
419 Ga0496121_0000509 3300048924 Bacteria 74211
420 Ga0496121_0018269 3300048924 Bacteria 7083
421 Ga0496122_0000233 3300048925 Bacteria 125120
422 Ga0496122_0029538 3300048925 Bacteria 4621
423 Ga0496123_0001250 3300048926 Bacteria 36759
424 Ga0496123_0002288 3300048926 Bacteria 24045
425 Ga0496123_0314904 3300048926 Bacteria 741
426 Ga0496124_0008386 3300048927 Bacteria 10811
427 Ga0496124_0010029 3300048927 Bacteria 9666
428 Ga0496124_0120892 3300048927 Bacteria 2093
429 Ga0496125_0002314 3300048928 Bacteria 25137
430 Ga0496125_0007624 3300048928 Bacteria 11480
431 Ga0496125_0309386 3300048928 Bacteria 963
432 Ga0496126_0000097 3300048929 Bacteria 206014
433 Ga0496126_0000872 3300048929 Bacteria 53113
434 Ga0496126_0043164 3300048929 Bacteria 4161
435 Ga0496126_0149694 3300048929 Bacteria 2001
436 Ga0496126_0162755 3300048929 Bacteria 1906
437 Ga0496126_1044512 3300048929 Bacteria 610
438 Ga0495682_0023076 3300049460 Bacteria 2325
439 Ga0501034_0027116 3300049571 Bacteria 5828
440 Ga0501034_0374717 3300049571 Bacteria 1349
441 Ga0501034_0704574 3300049571 Bacteria 908
442 Ga0501043_1111879 3300049579 Bacteria 558
443 Ga0501069_0054649 3300049585 Bacteria 2224
444 Ga0501070_0022063 3300049586 Bacteria 5333
445 Ga0501074_0904565 3300049590 Bacteria 621
446 Ga0501076_0434762 3300049592 Bacteria 1080
447 Ga0501223_021874 3300049663 Bacteria 1250
448 Ga0501224_000012 3300049664 Bacteria 92585
449 Ga0501233_000534 3300049668 Bacteria 6125
450 Ga0501235_001802 3300049669 Bacteria 4598
451 Ga0501235_044439 3300049669 Bacteria 1020
452 Ga0501225_0000884 3300049705 Bacteria 9313
453 Ga0501225_0032626 3300049705 Bacteria 1432
454 Ga0501234_010229 3300049707 Bacteria 1461
455 Ga0501080_0219959 3300049742 Bacteria 1738
456 Ga0501044_0013121 3300049823 Bacteria 8970
457 Ga0501044_0015141 3300049823 Bacteria 8311
458 Ga0501044_0241996 3300049823 Bacteria 1748
459 Ga0501226_000091 3300049853 Bacteria 23656
460 nmdc:mga03683_100993_c1 3300050489 Bacteria 1268
461 nmdc:mga03683_57_c1 3300050489 Bacteria 46363
462 nmdc:mga03n38_12213_c1 3300050490 Bacteria 3225
463 nmdc:mga00v17_55570_c1 3300050491 Bacteria 2418
464 nmdc:mga00v17_56138_c1 3300050491 Bacteria 2407
465 nmdc:mga0k408_21419_c1 3300050493 Bacteria 3631
466 nmdc:mga0k408_2211_c1 3300050493 Bacteria 9628
467 nmdc:mga0k408_303996_c1 3300050493 Bacteria 952
468 nmdc:mga0k408_488_c1 3300050493 Bacteria 21772
469 nmdc:mga06z11_406_c1 3300050494 Bacteria 16221
470 nmdc:mga04h51_2555_c1 3300050495 Bacteria 4332
471 nmdc:mga07m45_356007_c1 3300050496 Bacteria 850
472 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
473 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
474 nmdc:mga0rr50_201806_c1 3300050513 Bacteria 1634
475 nmdc:mga0sz30_216339_c1 3300050516 Bacteria 852
476 nmdc:mga0sz30_25942_c1 3300050516 Bacteria 2399
477 nmdc:mga0sz30_41907_c1 3300050516 Bacteria 1925
478 nmdc:mga0sz30_4336_c1 3300050516 Bacteria 5119
479 Ga0495619_0635694 3300053085 Bacteria 729
480 Ga0500643_017550 3300053087 Bacteria 2395
481 Ga0500646_0192998 3300053090 Bacteria 695
482 Ga0500562_006577 3300053108 Bacteria 2928
483 Ga0500562_042322 3300053108 Bacteria 1212
484 Ga0500594_0003348 3300053118 Bacteria 3514
485 Ga0500595_030091 3300053119 Bacteria 1834
486 Ga0500607_000021 3300053121 Bacteria 99974
487 Ga0500607_001405 3300053121 Bacteria 21787
488 Ga0500607_227836 3300053121 Bacteria 768
489 Ga0500608_000914 3300053122 Bacteria 10631
490 Ga0500608_126493 3300053122 Bacteria 1151
491 Ga0500618_001369 3300053125 Bacteria 11055
492 Ga0500618_013752 3300053125 Bacteria 2084
493 Ga0500559_0002451 3300053136 Bacteria 9599
494 Ga0500559_0009699 3300053136 Bacteria 4156
495 Ga0500559_0147616 3300053136 Bacteria 1103
496 Ga0500564_069088 3300053138 Bacteria 1595
497 Ga0500568_0064341 3300053139 Bacteria 1413
498 Ga0500573_0345180 3300053140 Bacteria 725
499 Ga0500590_009034 3300053148 Bacteria 4999
500 Ga0500622_0000395 3300053156 Bacteria 41993
501 Ga0500627_0006620 3300053158 Bacteria 3962
502 Ga0500637_0008729 3300053178 Bacteria 5127
503 Ga0500567_008505 3300053723 Bacteria 4865
504 Ga0500625_000003 3300053729 Bacteria 268493
505 Ga0500625_076566 3300053729 Bacteria 1472
506 Ga0500645_004547 3300053730 Bacteria 5291
507 Ga0500645_007129 3300053730 Bacteria 3927
508 Ga0500552_018923 3300053733 Bacteria 959
509 Ga0466962_0254608 3300061719 Bacteria 863
510 2643821108 2643221560 Bacteria 4801179
511 2738709273 2738541275 Bacteria 4830863
512 2738847698 2738541301 Bacteria 4834102
513 2738863427 2738541304 Bacteria 4833665
514 2739295945 2738543022 Bacteria 4835059
515 2739357623 2738543033 Bacteria 4833336
516 2739651612 2739367664 Bacteria 4114334
517 2740030085 2739367865 Bacteria 4114482
518 2774869760 2773857925 Bacteria 6472445
519 2809062009 2808606401 Bacteria 4586670
520 2809077973 2808606404 Bacteria 4652788
521 2809082319 2808606405 Bacteria 4586632
522 2819553933 2818991438 Bacteria 5793701
523 2848299744 2848297114 Bacteria 3608511
524 2852657108 2852653556 Bacteria 4050083
525 2852683721 2852680915 Bacteria 4100189
526 2880519807 2880518877 Bacteria 5012590
527 2882461098 2882456835 Bacteria 6863978
528 2884300929 2884298095 Bacteria 3823049
529 2895882513 2895880812 Bacteria 11255272
530 2919139836 2919138771 Bacteria 5281312
531 2928030927 2928027323 Bacteria 4382488
532 2928102938 2928100450 Bacteria 4837635
533 2928959503 2928959182 Bacteria 4725774
534 2984557707 2984555340 Bacteria 4247089
535 2984567927 2984564862 Bacteria 4339992
536 2990266299 2990265787 Bacteria 3943888
537 2993358975 2993356040 Bacteria 4247105
538 2993695908 2993693658 Bacteria 4040749
539 Ga0105248_10987062
540 SwRhRL2b_contig_2631586
541 SwRhRL2b_contig_835169
542 JGI24741J21665_1007896
543 JGI24739J22299_10025526
544 JGI24737J22298_10014495
545 JGI24735J21928_10035320
546 JGI24751J29686_10000337
547 rootH1_10065628
548 rootL2_10066168
549 Ga0055536_1002772
550 Ga0055536_1020746
551 Ga0055530_10010695
552 Ga0055531_10011315
553 Ga0055531_10013743
554 Ga0055531_10057582
555 Ga0065165_1002128
556 Ga0065704_10005270
557 Ga0065704_10071995
558 Ga0070658_10011747
559 Ga0070658_10120930
560 Ga0070658_10294739
561 Ga0070690_100523028
562 Ga0070677_10147583
563 Ga0070666_10011895
564 Ga0070682_100149702
565 Ga0070682_100366657
566 Ga0070660_100165132
567 Ga0070660_100362607
568 Ga0070661_100399406
569 Ga0070668_100019334
570 Ga0070668_100169459
571 Ga0070668_100231148
572 Ga0070669_100000331
573 Ga0070669_100000844
574 Ga0070669_100574932
575 Ga0070669_101037063
576 Ga0070671_100000054
577 Ga0070671_100011790
578 Ga0070674_101090071
579 Ga0070659_100918889
580 Ga0070667_100001748
581 Ga0070667_100002367
582 Ga0070663_100008803
583 Ga0070662_100492731
584 Ga0070681_10337182
585 Ga0070679_100950926
586 Ga0068853_100354874
587 Ga0070686_100657507
588 Ga0070693_100162335
589 Ga0070665_100000076
590 Ga0070665_100005309
591 Ga0070665_100013141
592 Ga0070665_100321325
593 Ga0068855_100002646
594 Ga0068855_100267425
595 Ga0068855_100668969
596 Ga0068855_100922434
597 Ga0070664_100053814
598 Ga0068857_100870711
599 Ga0068854_100030099
600 Ga0068854_100243635
601 Ga0068854_100251056
602 Ga0068854_100665944
603 Ga0068854_100715747
604 Ga0068856_100032517
605 Ga0068852_100013014
606 Ga0068852_100070380
607 Ga0068852_100661237
608 Ga0068859_100471427
609 Ga0068859_101200528
610 Ga0068864_100005976
611 Ga0068864_100471432
612 Ga0068864_101828434
613 Ga0068863_100000014
614 Ga0068863_100107119
615 Ga0068858_100008863
616 Ga0068858_100147524
617 Ga0068860_100000007
618 Ga0068860_100010788
619 Ga0068860_100049195
620 Ga0068860_100561677
621 Ga0068860_100572470
622 Ga0068862_100173145
623 Ga0075363_100012810
624 Ga0075364_10057587
625 Ga0075432_10000396
626 Ga0070712_100632525
627 Ga0075362_10000104
628 Ga0075362_10274158
629 Ga0075369_10012386
630 Ga0075369_10040988
631 Ga0075366_10000168
632 Ga0075366_10001553
633 Ga0075366_10239588
634 Ga0075366_10344538
635 Ga0075370_10000032
636 Ga0075370_10151275
637 Ga0075436_100521863
638 Ga0097620_100471469
639 Ga0097620_101200538
640 Ga0097620_101244494
641 Ga0075435_100310641
642 Ga0105250_10011477
643 Ga0105240_10017210
644 Ga0105240_10023630
645 Ga0105240_10068409
646 Ga0105240_10189666
647 Ga0105240_10254355
648 Ga0105247_10109994
649 Ga0105247_10265677
650 Ga0105241_10003433
651 Ga0105241_10460656
652 Ga0105248_10304840
653 Ga0105237_10023684
654 Ga0105237_10467768
655 Ga0105238_10041851
656 Ga0105238_10105018
657 Ga0105238_10657277
658 Ga0105238_11378986
659 Ga0105238_11521175
660 Ga0105249_10027063
661 Ga0105239_10494357
662 Ga0105239_11204249
663 Ga0157371_10053694
664 Ga0157370_10082691
665 Ga0157370_10298696
666 Ga0157370_10379304
667 Ga0157370_11207149
668 Ga0157369_10535275
669 Ga0163162_10027930
670 Ga0163162_10029922
671 Ga0163162_10179389
672 Ga0163163_10631692
673 Ga0157380_10065513
674 Ga0157380_10531026
675 Ga0157379_10165292
676 Ga0213872_10042568
677 Ga0213872_10148033
678 Ga0213872_10179910
679 Ga0213874_10082300
680 Ga0213876_10067283
681 Ga0213876_10160358
682 Ga0207425_1021560
683 Ga0209675_1000555
684 Ga0209676_1000155
685 Ga0209676_1001076
686 Ga0209676_1009010
687 Ga0209676_1088627
688 Ga0209025_1008149
689 Ga0209025_1098069
690 Ga0209758_1080656
691 Ga0209050_1000068
692 Ga0209050_1002807
693 Ga0209050_1033720
694 Ga0209257_1000193
695 Ga0209257_1001718
696 Ga0209257_1007361
697 Ga0207697_10101677
698 Ga0207656_10039919
699 Ga0207696_1067173
700 Ga0207713_1001630
701 Ga0207680_10149026
702 Ga0207647_10011941
703 Ga0207647_10018455
704 Ga0207705_10000004
705 Ga0207654_10097808
706 Ga0207654_10890940
707 Ga0207695_10015212
708 Ga0207695_10051135
709 Ga0207695_10075504
710 Ga0207695_10158335
711 Ga0207671_10028314
712 Ga0207671_10539194
713 Ga0207671_10567092
714 Ga0207657_10069301
715 Ga0207649_10178104
716 Ga0207681_10000145
717 Ga0207681_10000232
718 Ga0207681_10178679
719 Ga0207694_10019279
720 Ga0207694_10046073
721 Ga0207694_11023488
722 Ga0207700_11493647
723 Ga0207700_11608623
724 Ga0207644_10000003
725 Ga0207644_10022927
726 Ga0207644_10148371
727 Ga0207644_10285315
728 Ga0207690_10226791
729 Ga0207706_10746866
730 Ga0207669_10790387
731 Ga0207711_10197853
732 Ga0207711_10442208
733 Ga0207711_11269949
734 Ga0207679_10264545
735 Ga0207667_10004217
736 Ga0207667_10382436
737 Ga0207667_10588878
738 Ga0207712_10189226
739 Ga0207668_10210999
740 Ga0207668_10260108
741 Ga0207668_10579982
742 Ga0207668_10673268
743 Ga0207668_11733692
744 Ga0207640_10009386
745 Ga0207640_10059592
746 Ga0207640_10197930
747 Ga0207640_11083293
748 Ga0207658_10004029
749 Ga0207658_10005026
750 Ga0207658_10005415
751 Ga0207658_10137255
752 Ga0207703_10008591
753 Ga0207703_10054601
754 Ga0207703_10154147
755 Ga0207639_10002936
756 Ga0207639_10629271
757 Ga0207678_10001360
758 Ga0207702_10011706
759 Ga0207702_10283372
760 Ga0207702_11869029
761 Ga0207641_10000035
762 Ga0207641_10658424
763 Ga0207676_10060953
764 Ga0207676_10146889
765 Ga0207676_10363426
766 Ga0207676_11680763
767 Ga0207674_10334417
768 Ga0207698_10007224
769 Ga0207698_10051468
770 Ga0207698_10313778
771 Ga0207428_10226854
772 Ga0268266_10002375
773 Ga0268266_10008265
774 Ga0268266_10018790
775 Ga0268266_10259092
776 Ga0268265_10105406
777 Ga0268265_11595662
778 Ga0268264_10000077
779 Ga0268264_10029005
780 Ga0268264_10039299
781 Ga0268264_10383227
782 Ga0268264_10539214
783 Ga0307515_10077071
784 Ga0265330_10270779
785 Ga0265325_10058801
786 Ga0265340_10060930
787 Ga0265331_10013964
788 Ga0265316_10141027
789 Ga0265316_10416417
790 Ga0265316_10704931
791 Ga0307408_100071551
792 Ga0307408_100163485
793 Ga0307408_100305895
794 Ga0307408_100466083
795 Ga0265313_10059598
796 Ga0265314_10109296
797 Ga0265314_10287516
798 Ga0307405_10007770
799 Ga0307405_10141876
800 Ga0307405_10308596
801 Ga0307405_10432929
802 Ga0307405_10715031
803 Ga0307413_10137320
804 Ga0307413_10269053
805 Ga0307413_10313312
806 Ga0307413_10436550
807 Ga0307410_10031609
808 Ga0307406_10157854
809 Ga0307406_10370711
810 Ga0307406_11290280
811 Ga0307407_10007329
812 Ga0307412_10001229
813 Ga0307412_10070785
814 Ga0307412_10300669
815 Ga0307412_11437000
816 Ga0307409_100054093
817 Ga0307409_100684381
818 Ga0307416_100117927
819 Ga0307416_100216504
820 Ga0307416_100567125
821 Ga0307416_100669352
822 Ga0307416_100945657
823 Ga0307414_10000703
824 Ga0307414_10000938
825 Ga0307414_10020203
826 Ga0307414_10051936
827 Ga0307414_10064969
828 Ga0307414_10747755
829 Ga0307414_11254126
830 Ga0307414_11684278
831 Ga0307411_10087960
832 Ga0307411_10177426
833 Ga0307411_10283909
834 Ga0307411_10294825
835 Ga0307411_10313611
836 Ga0307415_100262512
837 Ga0307415_100295948
838 Ga0307415_102046021
839 Ga0307510_10141527
840 Ga0373948_0087983
841 Ga0373928_0138871
842 Ga0373943_0080362
843 Ga0373962_0121379
844 Ga0316574_0322601
845 Ga0373931_0439252
846 Ga0316584_0077123
847 Ga0316581_0056049
848 Ga0436365_0724808
849 Ga0436360_0186386
850 Ga0436360_0689183
851 Ga0436360_0703881
852 Ga0436361_0008383
853 Ga0436361_0516175
854 Ga0436361_0554008
855 Ga0436361_0594283
856 Ga0436361_0982139
857 Ga0436361_1024998
858 Ga0436363_0282676
859 Ga0436363_1320142
860 Ga0436363_1349209
861 Ga0436363_1506991
862 Ga0436362_0035554
863 Ga0436362_0425159
864 Ga0436362_0686165
865 Ga0451807_1759921
866 Ga0451839_0761122
867 Ga0451841_0021166
868 Ga0451849_1206638
869 Ga0451843_1250276
870 Ga0451853_2312453
871 Ga0450898_115189
872 Ga0451577_0097320
873 Ga0466966_0067545
874 Ga0466966_0143968
875 Ga0466961_0315822
876 Ga0466961_0579271
877 Ga0466963_0325441
878 Ga0453684_1265345
879 Ga0466957_0019786
880 Ga0466957_0185814
881 Ga0466959_0234831
882 Ga0466958_0175882
883 Ga0495627_000248
884 Ga0495638_0237495
885 Ga0495596_0007580
886 Ga0495610_0027643
887 Ga0495610_0175652
888 Ga0495632_0000060
889 Ga0495637_0002973
890 Ga0495643_0000014
891 Ga0495648_0050106
892 Ga0495648_0071172
893 Ga0495663_0000007
894 Ga0495622_0013512
895 Ga0495633_0001277
896 Ga0495633_0002982
897 Ga0495667_0505915
898 Ga0495668_0012144
899 Ga0495668_0236677
900 Ga0495625_0041406
901 Ga0495625_0232265
902 Ga0495671_0000032
903 Ga0495671_0009947
904 Ga0495673_0123003
905 Ga0495686_0234883
906 Ga0495626_0005610
907 Ga0496100_0030251
908 Ga0496100_0070196
909 Ga0496100_0244138
910 Ga0496101_0082546
911 Ga0496101_0092658
912 Ga0496101_0502328
913 Ga0496102_0000361
914 Ga0496102_0335808
915 Ga0496102_0406748
916 Ga0496102_0514204
917 Ga0496102_1072670
918 Ga0496103_0000161
919 Ga0496104_0000426
920 Ga0496104_0140929
921 Ga0496104_0650585
922 Ga0496105_0000607
923 Ga0496105_0011207
924 Ga0496105_0123346
925 Ga0496105_0676029
926 Ga0496106_0000284
927 Ga0496106_0216705
928 Ga0496106_0292514
929 Ga0496107_0007109
930 Ga0496109_0232768
931 Ga0496109_1093452
932 Ga0496110_0119199
933 Ga0496110_0405908
934 Ga0496110_1270123
935 Ga0496111_0322911
936 Ga0496112_0084844
937 Ga0496112_0883124
938 Ga0496113_0000423
939 Ga0496113_0207314
940 Ga0496114_0015588
941 Ga0496115_0258137
942 Ga0496115_0431198
943 Ga0496115_0605574
944 Ga0496116_0000248
945 Ga0496116_0013343
946 Ga0496117_0001452
947 Ga0496117_0017763
948 Ga0496117_0061291
949 Ga0496117_0132478
950 Ga0496118_0031376
951 Ga0496118_0033521
952 Ga0496118_0058028
953 Ga0496118_0221711
954 Ga0496119_0000365
955 Ga0496120_0001099
956 Ga0496121_0000022
957 Ga0496121_0000509
958 Ga0496121_0018269
959 Ga0496122_0000233
960 Ga0496122_0029538
961 Ga0496123_0001250
962 Ga0496123_0002288
963 Ga0496123_0314904
964 Ga0496124_0008386
965 Ga0496124_0010029
966 Ga0496124_0120892
967 Ga0496125_0002314
968 Ga0496125_0007624
969 Ga0496125_0309386
970 Ga0496126_0000097
971 Ga0496126_0000872
972 Ga0496126_0043164
973 Ga0496126_0149694
974 Ga0496126_0162755
975 Ga0496126_1044512
976 Ga0495682_0023076
977 Ga0501034_0027116
978 Ga0501034_0374717
979 Ga0501034_0704574
980 Ga0501043_1111879
981 Ga0501069_0054649
982 Ga0501070_0022063
983 Ga0501074_0904565
984 Ga0501076_0434762
985 Ga0501223_021874
986 Ga0501224_000012
987 Ga0501233_000534
988 Ga0501235_001802
989 Ga0501235_044439
990 Ga0501225_0000884
991 Ga0501225_0032626
992 Ga0501234_010229
993 Ga0501080_0219959
994 Ga0501044_0013121
995 Ga0501044_0015141
996 Ga0501044_0241996
997 Ga0501226_000091
998 nmdc:mga03683_100993_c1
999 nmdc:mga03683_57_c1
1000 nmdc:mga03n38_12213_c1
1001 nmdc:mga00v17_55570_c1
1002 nmdc:mga00v17_56138_c1
1003 nmdc:mga0k408_21419_c1
1004 nmdc:mga0k408_2211_c1
1005 nmdc:mga0k408_303996_c1
1006 nmdc:mga0k408_488_c1
1007 nmdc:mga06z11_406_c1
1008 nmdc:mga04h51_2555_c1
1009 nmdc:mga07m45_356007_c1
1010 nmdc:mga07m45_4_c1
1011 nmdc:mga07m45_8_c1
1012 nmdc:mga0rr50_201806_c1
1013 nmdc:mga0sz30_216339_c1
1014 nmdc:mga0sz30_25942_c1
1015 nmdc:mga0sz30_41907_c1
1016 nmdc:mga0sz30_4336_c1
1017 Ga0495619_0635694
1018 Ga0500643_017550
1019 Ga0500646_0192998
1020 Ga0500562_006577
1021 Ga0500562_042322
1022 Ga0500594_0003348
1023 Ga0500595_030091
1024 Ga0500607_000021
1025 Ga0500607_001405
1026 Ga0500607_227836
1027 Ga0500608_000914
1028 Ga0500608_126493
1029 Ga0500618_001369
1030 Ga0500618_013752
1031 Ga0500559_0002451
1032 Ga0500559_0009699
1033 Ga0500559_0147616
1034 Ga0500564_069088
1035 Ga0500568_0064341
1036 Ga0500573_0345180
1037 Ga0500590_009034
1038 Ga0500622_0000395
1039 Ga0500627_0006620
1040 Ga0500637_0008729
1041 Ga0500567_008505
1042 Ga0500625_000003
1043 Ga0500625_076566
1044 Ga0500645_004547
1045 Ga0500645_007129
1046 Ga0500552_018923
1047 Ga0466962_0254608
1048 2643821108
1049 2738709273
1050 2738847698
1051 2738863427
1052 2739295945
1053 2739357623
1054 2739651612
1055 2740030085
1056 2774869760
1057 2809062009
1058 2809077973
1059 2809082319
1060 2819553933
1061 2848299744
1062 2852657108
1063 2852683721
1064 2880519807
1065 2882461098
1066 2884300929
1067 2895882513
1068 2919139836
1069 2928030927
1070 2928102938
1071 2928959503
1072 2984557707
1073 2984567927
1074 2990266299
1075 2993358975
1076 2993695908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

29

175

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qde-assembly1.cif.gz_B the structure of cellobiose phosphorylase from clostridium thermocellum in complex with phosphate 0.9 53 93
8ho9-assembly1.cif.gz_A the cryo-em structure of cellobiose phosphorylase from clostridium thermocellum (cysteine-to-serine varient) 0.8965 53 93
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7979 4 150
5gw7-assembly1.cif.gz_A crystal structure of the glycosynthase mutant e727a of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.7763 53 103
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7744 4 150
ID Description Score Start End Superfamily
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9315 4 93 1.10.1510.10
1ng6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9183 94 150 1.10.10.410
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9117 4 93 1.10.1510.10
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9096 4 93 1.10.1510.10
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9079 1 93 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A653J3S8-F1-model_v4 GatB protein 0.9789 1 150 GO:0016884
AF-A0A259HHD4-F1-model_v4 Aspartyl-tRNA amidotransferase 0.9594 1 106 GO:0016740
GO:0016884
AF-A0A496Q6B5-F1-model_v4 GatB/YqeY domain-containing protein 0.9461 1 149 GO:0016884
AF-A0A538CB45-F1-model_v4 GatB/YqeY domain-containing protein 0.943 12 148 GO:0016884
AF-A0A3D1U4K6-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9387 2 150 GO:0016740
GO:0016884

Map