F460887

General Info

Members Datasets Scaffolds Average Seq Length
537 257 1074 146

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101625233|Ga0070708_1016252331
Length 175
Sequence VGSTCGSRARHPRPSGPVRRGTPSPSDLQGMQAALRLARAASVREEVPIGAVIVADGETLAEAHNETIQRRDPTAHAELLAIHRALRQAGDDRLPLATLYVTLEPCAQCAGAIVLAKVGRVVYGAQDLRAGMAGSVHDLLRHPRLNHRPEVVGGLLAEDCAELLKRFFQARRTLL

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
169 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
170 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
230 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
237 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 5.21
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101625233 3300005445 Bacteria 601
2 Ga0070658_10260103 3300005327 Bacteria 1474
3 Ga0070676_10212443 3300005328 Bacteria 1274
4 Ga0070670_100143238 3300005331 Bacteria 2067
5 Ga0070670_100170233 3300005331 Bacteria 1889
6 Ga0070677_10188733 3300005333 Bacteria 987
7 Ga0070680_100108609 3300005336 Bacteria 2308
8 Ga0070682_100959199 3300005337 Bacteria 707
9 Ga0070660_100824713 3300005339 Bacteria 781
10 Ga0070691_10001963 3300005341 Bacteria 9051
11 Ga0070661_100025694 3300005344 Bacteria 4233
12 Ga0070669_100062827 3300005353 Bacteria 2732
13 Ga0070675_100247578 3300005354 Bacteria 1559
14 Ga0070675_100368794 3300005354 Bacteria 1276
15 Ga0070674_100635440 3300005356 Bacteria 906
16 Ga0070667_100346822 3300005367 Bacteria 1343
17 Ga0070709_10005179 3300005434 Bacteria 7052
18 Ga0070714_100095425 3300005435 Bacteria 2612
19 Ga0070714_100190144 3300005435 Bacteria 1873
20 Ga0070714_100395821 3300005435 Bacteria 1305
21 Ga0070713_100000004 3300005436 Bacteria 220768
22 Ga0070713_100608364 3300005436 Bacteria 1039
23 Ga0070710_10061868 3300005437 Bacteria 2133
24 Ga0070711_100064782 3300005439 Bacteria 2555
25 Ga0070705_100028930 3300005440 Bacteria 3040
26 Ga0070705_100135345 3300005440 Bacteria 1613
27 Ga0070705_100260300 3300005440 Bacteria 1223
28 Ga0070694_100269995 3300005444 Bacteria 1293
29 Ga0070694_100337583 3300005444 Bacteria 1164
30 Ga0070708_100042384 3300005445 Bacteria 3995
31 Ga0070708_100243999 3300005445 Bacteria 1687
32 Ga0070708_100915096 3300005445 Bacteria 823
33 Ga0070708_101129078 3300005445 Bacteria 734
34 Ga0070681_10185988 3300005458 Bacteria 1998
35 Ga0070681_10266809 3300005458 Bacteria 1623
36 Ga0070681_10286357 3300005458 Bacteria 1558
37 Ga0070681_10746699 3300005458 Bacteria 895
38 Ga0070685_10620828 3300005466 Bacteria 780
39 Ga0070685_10972348 3300005466 Bacteria 635
40 Ga0070706_100116792 3300005467 Bacteria 2485
41 Ga0070707_100183798 3300005468 Bacteria 2038
42 Ga0070698_100054466 3300005471 Bacteria 4060
43 Ga0070699_100098143 3300005518 Bacteria 2566
44 Ga0070699_100419190 3300005518 Bacteria 1211
45 Ga0070679_100046230 3300005530 Bacteria 4339
46 Ga0070679_100282513 3300005530 Bacteria 1612
47 Ga0070679_100364904 3300005530 Bacteria 1391
48 Ga0070697_100133230 3300005536 Bacteria 2085
49 Ga0070697_100236496 3300005536 Bacteria 1559
50 Ga0070697_100500179 3300005536 Bacteria 1063
51 Ga0070697_100775265 3300005536 Bacteria 848
52 Ga0068853_100005813 3300005539 Bacteria 9715
53 Ga0068853_100115087 3300005539 Bacteria 2393
54 Ga0070672_100176429 3300005543 Bacteria 1779
55 Ga0070695_100007510 3300005545 Bacteria 6458
56 Ga0070695_100271362 3300005545 Bacteria 1243
57 Ga0070695_101328013 3300005545 Bacteria 595
58 Ga0070696_100007903 3300005546 Bacteria 7099
59 Ga0070696_100100271 3300005546 Bacteria 2074
60 Ga0070696_100272927 3300005546 Bacteria 1286
61 Ga0070696_100467210 3300005546 Bacteria 998
62 Ga0070696_100772446 3300005546 Bacteria 789
63 Ga0070696_101161697 3300005546 Bacteria 651
64 Ga0070693_100011054 3300005547 Bacteria 4540
65 Ga0070693_100373028 3300005547 Bacteria 982
66 Ga0070665_100599592 3300005548 Bacteria 1114
67 Ga0070665_100612571 3300005548 Bacteria 1102
68 Ga0070704_100156243 3300005549 Bacteria 1799
69 Ga0070704_100340715 3300005549 Bacteria 1262
70 Ga0070704_101019493 3300005549 Bacteria 749
71 Ga0068855_100126225 3300005563 Bacteria 2925
72 Ga0068855_100246851 3300005563 Bacteria 1992
73 Ga0070664_100003283 3300005564 Bacteria 13060
74 Ga0070664_100151278 3300005564 Bacteria 2049
75 Ga0068857_100000977 3300005577 Bacteria 21873
76 Ga0068857_100190353 3300005577 Bacteria 1869
77 Ga0068857_100232948 3300005577 Bacteria 1685
78 Ga0068857_100907825 3300005577 Bacteria 845
79 Ga0068856_100005941 3300005614 Bacteria 12015
80 Ga0068856_100006729 3300005614 Bacteria 11261
81 Ga0068856_101306073 3300005614 Bacteria 741
82 Ga0070702_100779230 3300005615 Bacteria 737
83 Ga0068852_100003166 3300005616 Bacteria 11479
84 Ga0068852_100189498 3300005616 Bacteria 1939
85 Ga0068859_100450164 3300005617 Bacteria 1384
86 Ga0068864_100040464 3300005618 Bacteria 3987
87 Ga0068864_100297557 3300005618 Bacteria 1510
88 Ga0068864_100480445 3300005618 Bacteria 1192
89 Ga0068863_100156814 3300005841 Bacteria 2179
90 Ga0068863_100852597 3300005841 Bacteria 910
91 Ga0081455_10272698 3300005937 Bacteria 1226
92 Ga0081538_10089410 3300005981 Bacteria 1599
93 Ga0070715_10044083 3300006163 Bacteria 1884
94 Ga0070716_100021765 3300006173 Bacteria 3381
95 Ga0070716_100051954 3300006173 Bacteria 2332
96 Ga0070712_100000222 3300006175 Bacteria 32064
97 Ga0070712_100001090 3300006175 Bacteria 16367
98 Ga0070712_100228072 3300006175 Bacteria 1478
99 Ga0075428_100269286 3300006844 Bacteria 1833
100 Ga0075430_100022803 3300006846 Bacteria 5323
101 Ga0075430_100380482 3300006846 Bacteria 1165
102 Ga0075431_100008893 3300006847 Bacteria 10061
103 Ga0075431_100031527 3300006847 Bacteria 5460
104 Ga0075431_100060628 3300006847 Bacteria 3903
105 Ga0075433_10004504 3300006852 Bacteria 10857
106 Ga0075433_10096216 3300006852 Bacteria 2621
107 Ga0075433_10363600 3300006852 Bacteria 1278
108 Ga0075434_100000745 3300006871 Bacteria 25571
109 Ga0075434_101936224 3300006871 Bacteria 595
110 Ga0075429_100007566 3300006880 Bacteria 9433
111 Ga0068865_100064733 3300006881 Bacteria 2574
112 Ga0075436_100000187 3300006914 Bacteria 38576
113 Ga0075436_100080064 3300006914 Bacteria 2263
114 Ga0097620_100450167 3300006931 Bacteria 1384
115 Ga0075435_100160209 3300007076 Bacteria 1895
116 Ga0075435_100856102 3300007076 Bacteria 792
117 Ga0105240_10004599 3300009093 Bacteria 20913
118 Ga0105240_10032518 3300009093 Bacteria 6754
119 Ga0105240_10087420 3300009093 Bacteria 3817
120 Ga0105240_10380848 3300009093 Bacteria 1593
121 Ga0111539_10443643 3300009094 Bacteria 1511
122 Ga0111539_10472079 3300009094 Bacteria 1461
123 Ga0111539_10934424 3300009094 Bacteria 1009
124 Ga0114129_10247698 3300009147 Bacteria 2393
125 Ga0114129_10316175 3300009147 Bacteria 2077
126 Ga0114129_10603191 3300009147 Bacteria 1422
127 Ga0114129_10760401 3300009147 Bacteria 1240
128 Ga0114129_11767651 3300009147 Bacteria 753
129 Ga0105241_10029521 3300009174 Bacteria 4093
130 Ga0105241_11641985 3300009174 Bacteria 623
131 Ga0105237_10001844 3300009545 Bacteria 27229
132 Ga0105237_10063104 3300009545 Bacteria 3703
133 Ga0105238_10004713 3300009551 Bacteria 13480
134 Ga0105238_10253075 3300009551 Bacteria 1740
135 Ga0105238_10620493 3300009551 Bacteria 1090
136 Ga0105238_10711484 3300009551 Bacteria 1017
137 Ga0105239_10032149 3300010375 Bacteria 5767
138 Ga0105239_10251233 3300010375 Bacteria 1986
139 Ga0157373_10006228 3300013100 Bacteria 8916
140 Ga0157370_10023835 3300013104 Bacteria 6071
141 Ga0157369_10000881 3300013105 Bacteria 38268
142 Ga0157369_10006692 3300013105 Bacteria 13312
143 Ga0157369_10059038 3300013105 Bacteria 4137
144 Ga0157372_10006721 3300013307 Bacteria 12232
145 Ga0157372_10647072 3300013307 Bacteria 1231
146 Ga0157372_11945705 3300013307 Bacteria 676
147 Ga0157375_11607860 3300013308 Bacteria 768
148 Ga0163163_10352996 3300014325 Bacteria 1527
149 Ga0163163_10537330 3300014325 Bacteria 1231
150 Ga0157380_11644982 3300014326 Bacteria 698
151 Ga0182008_10046647 3300014497 Bacteria 2154
152 Ga0157379_10013333 3300014968 Bacteria 7197
153 Ga0157379_10020102 3300014968 Bacteria 5901
154 Ga0157376_10717730 3300014969 Bacteria 1006
155 Ga0207682_10018412 3300025893 Bacteria 2731
156 Ga0207685_10047918 3300025905 Bacteria 1634
157 Ga0207699_10000307 3300025906 Bacteria 26162
158 Ga0207684_10439652 3300025910 Bacteria 1120
159 Ga0207654_10594763 3300025911 Bacteria 789
160 Ga0207707_10032761 3300025912 Bacteria 4548
161 Ga0207707_10032967 3300025912 Bacteria 4534
162 Ga0207707_10160359 3300025912 Bacteria 1967
163 Ga0207707_10293832 3300025912 Bacteria 1405
164 Ga0207707_10973079 3300025912 Bacteria 698
165 Ga0207695_10000018 3300025913 Bacteria 766611
166 Ga0207695_10003669 3300025913 Bacteria 21406
167 Ga0207695_10017992 3300025913 Bacteria 8183
168 Ga0207695_10027509 3300025913 Bacteria 6331
169 Ga0207695_10038413 3300025913 Bacteria 5155
170 Ga0207695_10205805 3300025913 Bacteria 1881
171 Ga0207695_10861142 3300025913 Bacteria 786
172 Ga0207671_10011479 3300025914 Bacteria 7204
173 Ga0207693_10001139 3300025915 Bacteria 23823
174 Ga0207693_10004086 3300025915 Bacteria 12400
175 Ga0207663_10016194 3300025916 Bacteria 4127
176 Ga0207663_10072589 3300025916 Bacteria 2225
177 Ga0207663_10368346 3300025916 Bacteria 1092
178 Ga0207660_10042546 3300025917 Bacteria 3189
179 Ga0207660_10461195 3300025917 Bacteria 1028
180 Ga0207649_10018934 3300025920 Bacteria 3927
181 Ga0207649_10745222 3300025920 Bacteria 762
182 Ga0207652_10314583 3300025921 Bacteria 1413
183 Ga0207652_10369220 3300025921 Bacteria 1295
184 Ga0207646_10010123 3300025922 Bacteria 9242
185 Ga0207646_10086309 3300025922 Bacteria 2807
186 Ga0207681_10456509 3300025923 Bacteria 1040
187 Ga0207694_10064589 3300025924 Bacteria 2852
188 Ga0207694_10413409 3300025924 Bacteria 1123
189 Ga0207650_10112203 3300025925 Bacteria 2112
190 Ga0207659_10528218 3300025926 Bacteria 1001
191 Ga0207659_10683131 3300025926 Bacteria 878
192 Ga0207700_10000011 3300025928 Bacteria 266323
193 Ga0207664_10006655 3300025929 Bacteria 7965
194 Ga0207664_10076169 3300025929 Bacteria 2715
195 Ga0207664_10236516 3300025929 Bacteria 1589
196 Ga0207664_10498769 3300025929 Bacteria 1090
197 Ga0207690_10144573 3300025932 Bacteria 1757
198 Ga0207704_10061949 3300025938 Bacteria 2323
199 Ga0207665_10137147 3300025939 Bacteria 1742
200 Ga0207691_10188112 3300025940 Bacteria 1802
201 Ga0207711_10168308 3300025941 Bacteria 1987
202 Ga0207689_10156509 3300025942 Bacteria 1878
203 Ga0207661_10236267 3300025944 Bacteria 1620
204 Ga0207679_10796399 3300025945 Bacteria 861
205 Ga0207667_10094238 3300025949 Bacteria 3092
206 Ga0207667_10200313 3300025949 Bacteria 2048
207 Ga0207651_10344059 3300025960 Bacteria 1254
208 Ga0207651_10923370 3300025960 Bacteria 778
209 Ga0207639_10062570 3300026041 Bacteria 2878
210 Ga0207639_10614320 3300026041 Bacteria 1003
211 Ga0207678_10325679 3300026067 Bacteria 1322
212 Ga0207708_10275743 3300026075 Bacteria 1361
213 Ga0207702_10000164 3300026078 Bacteria 79231
214 Ga0207702_10058637 3300026078 Bacteria 3276
215 Ga0207641_10469713 3300026088 Bacteria 1218
216 Ga0207641_10767060 3300026088 Bacteria 953
217 Ga0207676_10214984 3300026095 Bacteria 1708
218 Ga0207674_10000349 3300026116 Bacteria 59515
219 Ga0207674_10026357 3300026116 Bacteria 6176
220 Ga0207674_10334976 3300026116 Bacteria 1463
221 Ga0207698_10082480 3300026142 Bacteria 2599
222 Ga0207698_10155835 3300026142 Bacteria 1989
223 Ga0209974_10022096 3300027876 Bacteria 2106
224 Ga0209974_10105413 3300027876 Bacteria 988
225 Ga0268266_10170434 3300028379 Bacteria 1975
226 Ga0268266_10416594 3300028379 Bacteria 1272
227 Ga0268265_10881225 3300028380 Bacteria 878
228 Ga0265318_10000229 3300028577 Bacteria 48662
229 Ga0265318_10165099 3300028577 Bacteria 812
230 Ga0265338_10029787 3300028800 Bacteria 5401
231 Ga0265338_10187512 3300028800 Bacteria 1571
232 Ga0265330_10025703 3300031235 Bacteria 2668
233 Ga0265320_10000191 3300031240 Bacteria 50802
234 Ga0265325_10005618 3300031241 Bacteria 7721
235 Ga0265325_10210524 3300031241 Bacteria 893
236 Ga0265340_10001040 3300031247 Bacteria 15829
237 Ga0265340_10051678 3300031247 Bacteria 1989
238 Ga0265339_10144495 3300031249 Bacteria 1208
239 Ga0265339_10187755 3300031249 Bacteria 1026
240 Ga0265331_10108810 3300031250 Bacteria 1272
241 Ga0265316_10006025 3300031344 Bacteria 11652
242 Ga0265316_10032259 3300031344 Bacteria 4275
243 Ga0307408_100004323 3300031548 Bacteria 9644
244 Ga0307408_100007105 3300031548 Bacteria 7409
245 Ga0307408_100119603 3300031548 Bacteria 2039
246 Ga0265313_10030581 3300031595 Bacteria 2770
247 Ga0265313_10072085 3300031595 Bacteria 1588
248 Ga0265314_10199686 3300031711 Bacteria 1183
249 Ga0265314_10335304 3300031711 Bacteria 837
250 Ga0265342_10019318 3300031712 Bacteria 4394
251 Ga0265342_10127522 3300031712 Bacteria 1428
252 Ga0307405_10025198 3300031731 Bacteria 3410
253 Ga0307405_10032930 3300031731 Bacteria 3069
254 Ga0307413_10000983 3300031824 Bacteria 10241
255 Ga0307413_10001152 3300031824 Bacteria 9694
256 Ga0307413_10029516 3300031824 Bacteria 3069
257 Ga0307413_10052045 3300031824 Bacteria 2471
258 Ga0307413_10069558 3300031824 Bacteria 2209
259 Ga0307410_10000345 3300031852 Bacteria 18000
260 Ga0307410_10002022 3300031852 Bacteria 9564
261 Ga0307410_10002507 3300031852 Bacteria 8874
262 Ga0307410_10281302 3300031852 Bacteria 1305
263 Ga0307410_10290760 3300031852 Bacteria 1286
264 Ga0307410_10439052 3300031852 Bacteria 1062
265 Ga0307406_10020167 3300031901 Bacteria 3922
266 Ga0307406_10036866 3300031901 Bacteria 3015
267 Ga0307406_10166782 3300031901 Bacteria 1589
268 Ga0307406_10342481 3300031901 Bacteria 1165
269 Ga0307406_10756413 3300031901 Bacteria 816
270 Ga0307407_10006740 3300031903 Bacteria 5139
271 Ga0307407_10040213 3300031903 Bacteria 2605
272 Ga0307407_10116865 3300031903 Bacteria 1684
273 Ga0307412_10076908 3300031911 Bacteria 2294
274 Ga0307412_10200324 3300031911 Bacteria 1515
275 Ga0307409_100081435 3300031995 Bacteria 2617
276 Ga0307409_100089612 3300031995 Bacteria 2515
277 Ga0307409_100102571 3300031995 Bacteria 2377
278 Ga0307409_100104347 3300031995 Bacteria 2360
279 Ga0307409_100316453 3300031995 Bacteria 1459
280 Ga0307409_100367579 3300031995 Bacteria 1363
281 Ga0307409_101190798 3300031995 Bacteria 785
282 Ga0307416_100000190 3300032002 Bacteria 32729
283 Ga0307416_100046805 3300032002 Bacteria 3417
284 Ga0307416_100491448 3300032002 Bacteria 1289
285 Ga0307416_100716738 3300032002 Bacteria 1091
286 Ga0307416_100776441 3300032002 Bacteria 1052
287 Ga0307416_101275711 3300032002 Bacteria 840
288 Ga0307416_101621504 3300032002 Bacteria 752
289 Ga0307414_10118585 3300032004 Bacteria 2030
290 Ga0307414_10386886 3300032004 Bacteria 1211
291 Ga0307414_11701154 3300032004 Bacteria 588
292 Ga0307411_10003420 3300032005 Bacteria 7358
293 Ga0307411_10020073 3300032005 Bacteria 3877
294 Ga0307411_10044155 3300032005 Bacteria 2856
295 Ga0307411_10077248 3300032005 Bacteria 2279
296 Ga0307411_10139937 3300032005 Bacteria 1783
297 Ga0307411_10353875 3300032005 Bacteria 1198
298 Ga0307415_100000705 3300032126 Bacteria 14890
299 Ga0373959_0006725 3300034820 Bacteria 1918
300 Ga0373944_0085313 3300035089 Bacteria 1049
301 Ga0373923_0041824 3300035111 Bacteria 1891
302 Ga0373932_0190504 3300035112 Bacteria 724
303 Ga0373954_0166669 3300035118 Bacteria 1079
304 Ga0373954_0330413 3300035118 Bacteria 753
305 Ga0373956_0167929 3300035119 Bacteria 1035
306 Ga0373960_0150301 3300035121 Bacteria 795
307 Ga0373931_0245463 3300035691 Bacteria 1087
308 Ga0373931_0277304 3300035691 Bacteria 1028
309 Ga0373935_1047032 3300035692 Bacteria 607
310 Ga0373927_0056183 3300035695 Bacteria 2545
311 Ga0373937_0002889 3300036401 Bacteria 14344
312 Ga0373937_0161728 3300036401 Bacteria 2099
313 Ga0373937_0579605 3300036401 Bacteria 1065
314 Ga0373937_1408605 3300036401 Bacteria 645
315 Ga0373925_0045463 3300037068 Bacteria 3262
316 Ga0373925_0341579 3300037068 Bacteria 1215
317 Ga0373925_0620813 3300037068 Bacteria 891
318 Ga0395899_0334970 3300037312 Bacteria 1016
319 Ga0395900_0056062 3300037418 Bacteria 4057
320 Ga0395898_0026421 3300037466 Bacteria 5841
321 Ga0395905_0420661 3300037471 Bacteria 1232
322 Ga0395905_0636573 3300037471 Bacteria 968
323 Ga0395901_0273290 3300038443 Bacteria 1757
324 Ga0242420_015364 3300038996 Bacteria 1323
325 Ga0436362_0856560 3300039453 Bacteria 3618
326 Ga0439439_0074295 3300041406 Unclassified 913
327 Ga0439431_0031654 3300041997 Bacteria 1316
328 Ga0439443_036152 3300042003 Bacteria 830
329 Ga0439448_0215175 3300042005 Bacteria 675
330 Ga0439457_040586 3300042014 Bacteria 1037
331 Ga0439462_0054788 3300042015 Bacteria 1075
332 Ga0439462_0099026 3300042015 Bacteria 803
333 Ga0450921_014580 3300042123 Bacteria 699
334 Ga0450891_020567 3300042129 Bacteria 647
335 Ga0450898_059987 3300042134 Bacteria 747
336 Ga0439446_0023698 3300042156 Bacteria 1748
337 Ga0439446_0115064 3300042156 Bacteria 861
338 Ga0451577_0030678 3300042876 Bacteria 4855
339 Ga0453684_0033157 3300044712 Bacteria 7205
340 Ga0453684_2093496 3300044712 Bacteria 568
341 Ga0451576_0016081 3300045051 Bacteria 8266
342 Ga0451576_0158797 3300045051 Bacteria 2359
343 Ga0451576_0193793 3300045051 Bacteria 2122
344 Ga0495603_0174215 3300046455 Bacteria 1246
345 Ga0495582_0152851 3300046473 Bacteria 1311
346 Ga0495664_0078958 3300046477 Bacteria 1972
347 Ga0495594_0074870 3300046499 Bacteria 1887
348 Ga0495594_0228664 3300046499 Bacteria 1060
349 Ga0495594_0407590 3300046499 Bacteria 773
350 Ga0495618_0103012 3300046514 Bacteria 1827
351 Ga0495666_0032933 3300046526 Bacteria 2534
352 Ga0495640_0257522 3300046533 Bacteria 1091
353 Ga0495586_0022850 3300046535 Bacteria 3337
354 Ga0495587_0351791 3300046536 Bacteria 821
355 Ga0495647_0031525 3300046681 Bacteria 1972
356 Ga0495600_0196665 3300046809 Bacteria 1296
357 Ga0495600_0319772 3300046809 Bacteria 976
358 Ga0495581_0342289 3300047315 Bacteria 873
359 Ga0495604_0546872 3300047317 Bacteria 747
360 Ga0495680_0026532 3300047322 Bacteria 4774
361 Ga0495675_0085053 3300047444 Bacteria 1989
362 Ga0495602_0486439 3300048088 Bacteria 865
363 Ga0496100_0185504 3300048903 Bacteria 1507
364 Ga0496102_0462268 3300048905 Bacteria 1190
365 Ga0496103_0093785 3300048906 Bacteria 1896
366 Ga0496103_0838563 3300048906 Bacteria 578
367 Ga0496104_0829880 3300048907 Bacteria 830
368 Ga0496106_0378692 3300048909 Bacteria 1137
369 Ga0496106_0555759 3300048909 Bacteria 921
370 Ga0496106_1199188 3300048909 Bacteria 592
371 Ga0496107_0117645 3300048910 Bacteria 1957
372 Ga0496108_0001948 3300048911 Bacteria 16532
373 Ga0496108_0016645 3300048911 Bacteria 6005
374 Ga0496108_0061884 3300048911 Bacteria 3151
375 Ga0496108_0394465 3300048911 Bacteria 1209
376 Ga0496109_0017253 3300048912 Bacteria 6325
377 Ga0496109_0063466 3300048912 Bacteria 3379
378 Ga0496109_0845307 3300048912 Bacteria 853
379 Ga0496110_0004548 3300048913 Bacteria 10770
380 Ga0496110_0945062 3300048913 Bacteria 769
381 Ga0496111_0072872 3300048914 Bacteria 2500
382 Ga0496111_1011524 3300048914 Bacteria 595
383 Ga0496112_0003988 3300048915 Bacteria 12370
384 Ga0496112_0204220 3300048915 Bacteria 1934
385 Ga0496112_0243478 3300048915 Bacteria 1750
386 Ga0496113_0061521 3300048916 Bacteria 2833
387 Ga0496113_0072924 3300048916 Bacteria 2614
388 Ga0496113_0075770 3300048916 Bacteria 2568
389 Ga0496114_0178838 3300048917 Bacteria 1852
390 Ga0496115_0102543 3300048918 Bacteria 2347
391 Ga0501031_0222798 3300049568 Bacteria 1228
392 Ga0501031_0393081 3300049568 Bacteria 897
393 Ga0501033_0024575 3300049570 Bacteria 4545
394 Ga0501033_0039755 3300049570 Bacteria 3514
395 Ga0501033_0050220 3300049570 Bacteria 3095
396 Ga0501033_0056185 3300049570 Bacteria 2910
397 Ga0501033_0146922 3300049570 Bacteria 1702
398 Ga0501034_0026246 3300049571 Bacteria 5933
399 Ga0501034_0046140 3300049571 Bacteria 4403
400 Ga0501034_0343076 3300049571 Bacteria 1423
401 Ga0501036_0153654 3300049572 Bacteria 1941
402 Ga0501036_0341708 3300049572 Bacteria 1250
403 Ga0501036_0448318 3300049572 Bacteria 1075
404 Ga0501036_0460770 3300049572 Bacteria 1059
405 Ga0501036_0592958 3300049572 Bacteria 919
406 Ga0501036_0656966 3300049572 Bacteria 868
407 Ga0501036_1196159 3300049572 Bacteria 619
408 Ga0501037_0032501 3300049573 Bacteria 3853
409 Ga0501038_0269507 3300049574 Bacteria 1343
410 Ga0501038_0274681 3300049574 Bacteria 1328
411 Ga0501039_0106762 3300049575 Bacteria 2187
412 Ga0501039_0633789 3300049575 Bacteria 837
413 Ga0501040_0065752 3300049576 Bacteria 2498
414 Ga0501040_1247883 3300049576 Bacteria 539
415 Ga0501041_0042546 3300049577 Bacteria 2761
416 Ga0501041_0805183 3300049577 Bacteria 602
417 Ga0501042_0066651 3300049578 Bacteria 2574
418 Ga0501042_0114831 3300049578 Bacteria 1939
419 Ga0501042_0233118 3300049578 Bacteria 1328
420 Ga0501042_1016532 3300049578 Unclassified 604
421 Ga0501043_0195431 3300049579 Bacteria 1572
422 Ga0501043_1214377 3300049579 Bacteria 529
423 Ga0501046_0059686 3300049580 Bacteria 2987
424 Ga0501046_0070334 3300049580 Bacteria 2721
425 Ga0501046_0255440 3300049580 Bacteria 1289
426 Ga0501046_0433317 3300049580 Bacteria 947
427 Ga0501047_0003236 3300049581 Bacteria 15441
428 Ga0501047_0010082 3300049581 Bacteria 8932
429 Ga0501047_0152456 3300049581 Bacteria 2186
430 Ga0501047_0313166 3300049581 Bacteria 1410
431 Ga0501047_0338092 3300049581 Bacteria 1343
432 Ga0501047_0381368 3300049581 Bacteria 1244
433 Ga0501048_0239992 3300049582 Bacteria 1286
434 Ga0501048_0281039 3300049582 Bacteria 1184
435 Ga0501067_0004105 3300049583 Bacteria 8029
436 Ga0501067_0033654 3300049583 Bacteria 2843
437 Ga0501067_0227900 3300049583 Bacteria 1037
438 Ga0501067_0444649 3300049583 Bacteria 724
439 Ga0501068_0062810 3300049584 Bacteria 2259
440 Ga0501068_0074584 3300049584 Bacteria 2074
441 Ga0501069_0022736 3300049585 Bacteria 3414
442 Ga0501069_0119964 3300049585 Bacteria 1501
443 Ga0501069_0240248 3300049585 Bacteria 1055
444 Ga0501069_0299164 3300049585 Bacteria 943
445 Ga0501069_0537210 3300049585 Bacteria 699
446 Ga0501069_0787860 3300049585 Unclassified 576
447 Ga0501070_0013231 3300049586 Bacteria 6955
448 Ga0501070_0056690 3300049586 Bacteria 3248
449 Ga0501070_0110663 3300049586 Bacteria 2270
450 Ga0501070_0556542 3300049586 Bacteria 918
451 Ga0501071_0177490 3300049587 Bacteria 1595
452 Ga0501071_1345658 3300049587 Bacteria 551
453 Ga0501072_0023743 3300049588 Bacteria 4763
454 Ga0501073_0035979 3300049589 Bacteria 3518
455 Ga0501073_0501952 3300049589 Bacteria 839
456 Ga0501073_1000206 3300049589 Bacteria 575
457 Ga0501075_0033587 3300049591 Bacteria 3817
458 Ga0501075_0045632 3300049591 Bacteria 3290
459 Ga0501075_0326945 3300049591 Bacteria 1168
460 Ga0501075_0778490 3300049591 Bacteria 728
461 Ga0501076_0085068 3300049592 Bacteria 2541
462 Ga0501076_0431494 3300049592 Bacteria 1084
463 Ga0501076_1316543 3300049592 Bacteria 594
464 Ga0501076_1617644 3300049592 Bacteria 532
465 Ga0501076_1651799 3300049592 Bacteria 526
466 Ga0501077_0004870 3300049593 Bacteria 8152
467 Ga0501077_0017543 3300049593 Bacteria 4520
468 Ga0501077_0193973 3300049593 Bacteria 1290
469 Ga0501233_162639 3300049668 Unclassified 629
470 Ga0501242_037966 3300049674 Bacteria 673
471 Ga0501249_070424 3300049679 Bacteria 817
472 Ga0501079_0023156 3300049741 Bacteria 4768
473 Ga0501079_0073950 3300049741 Bacteria 2634
474 Ga0501079_0213728 3300049741 Bacteria 1506
475 Ga0501080_0428090 3300049742 Bacteria 1188
476 Ga0501080_0537845 3300049742 Bacteria 1041
477 Ga0501080_0738555 3300049742 Bacteria 866
478 Ga0501080_1188942 3300049742 Bacteria 656
479 Ga0501081_0035074 3300049743 Bacteria 3415
480 Ga0501081_0076065 3300049743 Bacteria 2344
481 Ga0501083_0064264 3300049744 Bacteria 2446
482 Ga0501083_0227750 3300049744 Bacteria 1214
483 Ga0501083_0355678 3300049744 Bacteria 952
484 Ga0501268_009985 3300049765 Unclassified 1469
485 Ga0501283_053378 3300049779 Bacteria 720
486 Ga0501035_0003567 3300049822 Bacteria 14870
487 Ga0501035_0004679 3300049822 Bacteria 12990
488 Ga0501035_0032301 3300049822 Bacteria 4763
489 Ga0501035_1195140 3300049822 Bacteria 590
490 Ga0501044_0001279 3300049823 Bacteria 29728
491 Ga0501044_0005283 3300049823 Bacteria 14361
492 Ga0501044_0112677 3300049823 Bacteria 2727
493 Ga0501044_0244520 3300049823 Bacteria 1737
494 Ga0501044_0461571 3300049823 Unclassified 1175
495 Ga0501044_0614840 3300049823 Bacteria 979
496 Ga0501045_0156447 3300049824 Bacteria 1696
497 Ga0501045_0259775 3300049824 Bacteria 1292
498 Ga0501045_1204640 3300049824 Bacteria 552
499 nmdc:mga05p37_649186_c1 3300050507 Bacteria 1182
500 nmdc:mga05p37_76027_c1 3300050507 Bacteria 4134
501 nmdc:mga05p37_84610_c1 3300050507 Bacteria 3908
502 nmdc:mga09592_26451_c1 3300050508 Bacteria 4807
503 nmdc:mga0qj67_53539_c1 3300050509 Bacteria 3195
504 nmdc:mga0qj67_852720_c1 3300050509 Bacteria 719
505 nmdc:mga0qj67_93400_c1 3300050509 Bacteria 2419
506 nmdc:mga06r32_14458_c1 3300050510 Bacteria 7164
507 nmdc:mga06r32_411646_c1 3300050510 Bacteria 1334
508 nmdc:mga06r32_67496_c1 3300050510 Bacteria 3453
509 nmdc:mga08y16_1454017_c1 3300050511 Bacteria 647
510 nmdc:mga0n895_193990_c1 3300050512 Bacteria 2062
511 nmdc:mga0n895_3990_c1 3300050512 Bacteria 11996
512 nmdc:mga0n895_425906_c1 3300050512 Bacteria 1341
513 nmdc:mga0n895_498667_c1 3300050512 Bacteria 1227
514 nmdc:mga0n895_718350_c1 3300050512 Bacteria 994
515 nmdc:mga0n895_886060_c1 3300050512 Bacteria 878
516 nmdc:mga0rr50_116265_c1 3300050513 Bacteria 2123
517 nmdc:mga0rr50_796274_c1 3300050513 Bacteria 806
518 nmdc:mga0rr50_83224_c1 3300050513 Bacteria 2473
519 nmdc:mga08x19_155_c1 3300050514 Bacteria 56249
520 nmdc:mga08x19_7404_c1 3300050514 Bacteria 6518
521 nmdc:mga0a205_4720_c1 3300050515 Bacteria 12233
522 nmdc:mga0a205_53964_c1 3300050515 Bacteria 3880
523 Ga0500639_106603 3300053163 Bacteria 1370
524 Ga0501084_0053010 3300054114 Bacteria 3393
525 Ga0501084_0082783 3300054114 Bacteria 2693
526 Ga0501084_0164455 3300054114 Bacteria 1873
527 Ga0501084_0879459 3300054114 Bacteria 754
528 Ga0590071_005041 3300059421 Bacteria 3187
529 Ga0590071_044576 3300059421 Bacteria 1069
530 Ga0590074_057751 3300059423 Bacteria 718
531 Ga0590075_081513 3300059424 Bacteria 838
532 Ga0590077_002652 3300059426 Bacteria 3784
533 Ga0590077_021224 3300059426 Bacteria 1382
534 Ga0501082_0023324 3300060353 Bacteria 5339
535 Ga0501082_0344137 3300060353 Bacteria 1299
536 Ga0530510_0019998 3300061734 Bacteria 4759
537 Ga0530510_0851635 3300061734 Bacteria 696
538 Ga0070708_101625233
539 Ga0070658_10260103
540 Ga0070676_10212443
541 Ga0070670_100143238
542 Ga0070670_100170233
543 Ga0070677_10188733
544 Ga0070680_100108609
545 Ga0070682_100959199
546 Ga0070660_100824713
547 Ga0070691_10001963
548 Ga0070661_100025694
549 Ga0070669_100062827
550 Ga0070675_100247578
551 Ga0070675_100368794
552 Ga0070674_100635440
553 Ga0070667_100346822
554 Ga0070709_10005179
555 Ga0070714_100095425
556 Ga0070714_100190144
557 Ga0070714_100395821
558 Ga0070713_100000004
559 Ga0070713_100608364
560 Ga0070710_10061868
561 Ga0070711_100064782
562 Ga0070705_100028930
563 Ga0070705_100135345
564 Ga0070705_100260300
565 Ga0070694_100269995
566 Ga0070694_100337583
567 Ga0070708_100042384
568 Ga0070708_100243999
569 Ga0070708_100915096
570 Ga0070708_101129078
571 Ga0070681_10185988
572 Ga0070681_10266809
573 Ga0070681_10286357
574 Ga0070681_10746699
575 Ga0070685_10620828
576 Ga0070685_10972348
577 Ga0070706_100116792
578 Ga0070707_100183798
579 Ga0070698_100054466
580 Ga0070699_100098143
581 Ga0070699_100419190
582 Ga0070679_100046230
583 Ga0070679_100282513
584 Ga0070679_100364904
585 Ga0070697_100133230
586 Ga0070697_100236496
587 Ga0070697_100500179
588 Ga0070697_100775265
589 Ga0068853_100005813
590 Ga0068853_100115087
591 Ga0070672_100176429
592 Ga0070695_100007510
593 Ga0070695_100271362
594 Ga0070695_101328013
595 Ga0070696_100007903
596 Ga0070696_100100271
597 Ga0070696_100272927
598 Ga0070696_100467210
599 Ga0070696_100772446
600 Ga0070696_101161697
601 Ga0070693_100011054
602 Ga0070693_100373028
603 Ga0070665_100599592
604 Ga0070665_100612571
605 Ga0070704_100156243
606 Ga0070704_100340715
607 Ga0070704_101019493
608 Ga0068855_100126225
609 Ga0068855_100246851
610 Ga0070664_100003283
611 Ga0070664_100151278
612 Ga0068857_100000977
613 Ga0068857_100190353
614 Ga0068857_100232948
615 Ga0068857_100907825
616 Ga0068856_100005941
617 Ga0068856_100006729
618 Ga0068856_101306073
619 Ga0070702_100779230
620 Ga0068852_100003166
621 Ga0068852_100189498
622 Ga0068859_100450164
623 Ga0068864_100040464
624 Ga0068864_100297557
625 Ga0068864_100480445
626 Ga0068863_100156814
627 Ga0068863_100852597
628 Ga0081455_10272698
629 Ga0081538_10089410
630 Ga0070715_10044083
631 Ga0070716_100021765
632 Ga0070716_100051954
633 Ga0070712_100000222
634 Ga0070712_100001090
635 Ga0070712_100228072
636 Ga0075428_100269286
637 Ga0075430_100022803
638 Ga0075430_100380482
639 Ga0075431_100008893
640 Ga0075431_100031527
641 Ga0075431_100060628
642 Ga0075433_10004504
643 Ga0075433_10096216
644 Ga0075433_10363600
645 Ga0075434_100000745
646 Ga0075434_101936224
647 Ga0075429_100007566
648 Ga0068865_100064733
649 Ga0075436_100000187
650 Ga0075436_100080064
651 Ga0097620_100450167
652 Ga0075435_100160209
653 Ga0075435_100856102
654 Ga0105240_10004599
655 Ga0105240_10032518
656 Ga0105240_10087420
657 Ga0105240_10380848
658 Ga0111539_10443643
659 Ga0111539_10472079
660 Ga0111539_10934424
661 Ga0114129_10247698
662 Ga0114129_10316175
663 Ga0114129_10603191
664 Ga0114129_10760401
665 Ga0114129_11767651
666 Ga0105241_10029521
667 Ga0105241_11641985
668 Ga0105237_10001844
669 Ga0105237_10063104
670 Ga0105238_10004713
671 Ga0105238_10253075
672 Ga0105238_10620493
673 Ga0105238_10711484
674 Ga0105239_10032149
675 Ga0105239_10251233
676 Ga0157373_10006228
677 Ga0157370_10023835
678 Ga0157369_10000881
679 Ga0157369_10006692
680 Ga0157369_10059038
681 Ga0157372_10006721
682 Ga0157372_10647072
683 Ga0157372_11945705
684 Ga0157375_11607860
685 Ga0163163_10352996
686 Ga0163163_10537330
687 Ga0157380_11644982
688 Ga0182008_10046647
689 Ga0157379_10013333
690 Ga0157379_10020102
691 Ga0157376_10717730
692 Ga0207682_10018412
693 Ga0207685_10047918
694 Ga0207699_10000307
695 Ga0207684_10439652
696 Ga0207654_10594763
697 Ga0207707_10032761
698 Ga0207707_10032967
699 Ga0207707_10160359
700 Ga0207707_10293832
701 Ga0207707_10973079
702 Ga0207695_10000018
703 Ga0207695_10003669
704 Ga0207695_10017992
705 Ga0207695_10027509
706 Ga0207695_10038413
707 Ga0207695_10205805
708 Ga0207695_10861142
709 Ga0207671_10011479
710 Ga0207693_10001139
711 Ga0207693_10004086
712 Ga0207663_10016194
713 Ga0207663_10072589
714 Ga0207663_10368346
715 Ga0207660_10042546
716 Ga0207660_10461195
717 Ga0207649_10018934
718 Ga0207649_10745222
719 Ga0207652_10314583
720 Ga0207652_10369220
721 Ga0207646_10010123
722 Ga0207646_10086309
723 Ga0207681_10456509
724 Ga0207694_10064589
725 Ga0207694_10413409
726 Ga0207650_10112203
727 Ga0207659_10528218
728 Ga0207659_10683131
729 Ga0207700_10000011
730 Ga0207664_10006655
731 Ga0207664_10076169
732 Ga0207664_10236516
733 Ga0207664_10498769
734 Ga0207690_10144573
735 Ga0207704_10061949
736 Ga0207665_10137147
737 Ga0207691_10188112
738 Ga0207711_10168308
739 Ga0207689_10156509
740 Ga0207661_10236267
741 Ga0207679_10796399
742 Ga0207667_10094238
743 Ga0207667_10200313
744 Ga0207651_10344059
745 Ga0207651_10923370
746 Ga0207639_10062570
747 Ga0207639_10614320
748 Ga0207678_10325679
749 Ga0207708_10275743
750 Ga0207702_10000164
751 Ga0207702_10058637
752 Ga0207641_10469713
753 Ga0207641_10767060
754 Ga0207676_10214984
755 Ga0207674_10000349
756 Ga0207674_10026357
757 Ga0207674_10334976
758 Ga0207698_10082480
759 Ga0207698_10155835
760 Ga0209974_10022096
761 Ga0209974_10105413
762 Ga0268266_10170434
763 Ga0268266_10416594
764 Ga0268265_10881225
765 Ga0265318_10000229
766 Ga0265318_10165099
767 Ga0265338_10029787
768 Ga0265338_10187512
769 Ga0265330_10025703
770 Ga0265320_10000191
771 Ga0265325_10005618
772 Ga0265325_10210524
773 Ga0265340_10001040
774 Ga0265340_10051678
775 Ga0265339_10144495
776 Ga0265339_10187755
777 Ga0265331_10108810
778 Ga0265316_10006025
779 Ga0265316_10032259
780 Ga0307408_100004323
781 Ga0307408_100007105
782 Ga0307408_100119603
783 Ga0265313_10030581
784 Ga0265313_10072085
785 Ga0265314_10199686
786 Ga0265314_10335304
787 Ga0265342_10019318
788 Ga0265342_10127522
789 Ga0307405_10025198
790 Ga0307405_10032930
791 Ga0307413_10000983
792 Ga0307413_10001152
793 Ga0307413_10029516
794 Ga0307413_10052045
795 Ga0307413_10069558
796 Ga0307410_10000345
797 Ga0307410_10002022
798 Ga0307410_10002507
799 Ga0307410_10281302
800 Ga0307410_10290760
801 Ga0307410_10439052
802 Ga0307406_10020167
803 Ga0307406_10036866
804 Ga0307406_10166782
805 Ga0307406_10342481
806 Ga0307406_10756413
807 Ga0307407_10006740
808 Ga0307407_10040213
809 Ga0307407_10116865
810 Ga0307412_10076908
811 Ga0307412_10200324
812 Ga0307409_100081435
813 Ga0307409_100089612
814 Ga0307409_100102571
815 Ga0307409_100104347
816 Ga0307409_100316453
817 Ga0307409_100367579
818 Ga0307409_101190798
819 Ga0307416_100000190
820 Ga0307416_100046805
821 Ga0307416_100491448
822 Ga0307416_100716738
823 Ga0307416_100776441
824 Ga0307416_101275711
825 Ga0307416_101621504
826 Ga0307414_10118585
827 Ga0307414_10386886
828 Ga0307414_11701154
829 Ga0307411_10003420
830 Ga0307411_10020073
831 Ga0307411_10044155
832 Ga0307411_10077248
833 Ga0307411_10139937
834 Ga0307411_10353875
835 Ga0307415_100000705
836 Ga0373959_0006725
837 Ga0373944_0085313
838 Ga0373923_0041824
839 Ga0373932_0190504
840 Ga0373954_0166669
841 Ga0373954_0330413
842 Ga0373956_0167929
843 Ga0373960_0150301
844 Ga0373931_0245463
845 Ga0373931_0277304
846 Ga0373935_1047032
847 Ga0373927_0056183
848 Ga0373937_0002889
849 Ga0373937_0161728
850 Ga0373937_0579605
851 Ga0373937_1408605
852 Ga0373925_0045463
853 Ga0373925_0341579
854 Ga0373925_0620813
855 Ga0395899_0334970
856 Ga0395900_0056062
857 Ga0395898_0026421
858 Ga0395905_0420661
859 Ga0395905_0636573
860 Ga0395901_0273290
861 Ga0242420_015364
862 Ga0436362_0856560
863 Ga0439439_0074295
864 Ga0439431_0031654
865 Ga0439443_036152
866 Ga0439448_0215175
867 Ga0439457_040586
868 Ga0439462_0054788
869 Ga0439462_0099026
870 Ga0450921_014580
871 Ga0450891_020567
872 Ga0450898_059987
873 Ga0439446_0023698
874 Ga0439446_0115064
875 Ga0451577_0030678
876 Ga0453684_0033157
877 Ga0453684_2093496
878 Ga0451576_0016081
879 Ga0451576_0158797
880 Ga0451576_0193793
881 Ga0495603_0174215
882 Ga0495582_0152851
883 Ga0495664_0078958
884 Ga0495594_0074870
885 Ga0495594_0228664
886 Ga0495594_0407590
887 Ga0495618_0103012
888 Ga0495666_0032933
889 Ga0495640_0257522
890 Ga0495586_0022850
891 Ga0495587_0351791
892 Ga0495647_0031525
893 Ga0495600_0196665
894 Ga0495600_0319772
895 Ga0495581_0342289
896 Ga0495604_0546872
897 Ga0495680_0026532
898 Ga0495675_0085053
899 Ga0495602_0486439
900 Ga0496100_0185504
901 Ga0496102_0462268
902 Ga0496103_0093785
903 Ga0496103_0838563
904 Ga0496104_0829880
905 Ga0496106_0378692
906 Ga0496106_0555759
907 Ga0496106_1199188
908 Ga0496107_0117645
909 Ga0496108_0001948
910 Ga0496108_0016645
911 Ga0496108_0061884
912 Ga0496108_0394465
913 Ga0496109_0017253
914 Ga0496109_0063466
915 Ga0496109_0845307
916 Ga0496110_0004548
917 Ga0496110_0945062
918 Ga0496111_0072872
919 Ga0496111_1011524
920 Ga0496112_0003988
921 Ga0496112_0204220
922 Ga0496112_0243478
923 Ga0496113_0061521
924 Ga0496113_0072924
925 Ga0496113_0075770
926 Ga0496114_0178838
927 Ga0496115_0102543
928 Ga0501031_0222798
929 Ga0501031_0393081
930 Ga0501033_0024575
931 Ga0501033_0039755
932 Ga0501033_0050220
933 Ga0501033_0056185
934 Ga0501033_0146922
935 Ga0501034_0026246
936 Ga0501034_0046140
937 Ga0501034_0343076
938 Ga0501036_0153654
939 Ga0501036_0341708
940 Ga0501036_0448318
941 Ga0501036_0460770
942 Ga0501036_0592958
943 Ga0501036_0656966
944 Ga0501036_1196159
945 Ga0501037_0032501
946 Ga0501038_0269507
947 Ga0501038_0274681
948 Ga0501039_0106762
949 Ga0501039_0633789
950 Ga0501040_0065752
951 Ga0501040_1247883
952 Ga0501041_0042546
953 Ga0501041_0805183
954 Ga0501042_0066651
955 Ga0501042_0114831
956 Ga0501042_0233118
957 Ga0501042_1016532
958 Ga0501043_0195431
959 Ga0501043_1214377
960 Ga0501046_0059686
961 Ga0501046_0070334
962 Ga0501046_0255440
963 Ga0501046_0433317
964 Ga0501047_0003236
965 Ga0501047_0010082
966 Ga0501047_0152456
967 Ga0501047_0313166
968 Ga0501047_0338092
969 Ga0501047_0381368
970 Ga0501048_0239992
971 Ga0501048_0281039
972 Ga0501067_0004105
973 Ga0501067_0033654
974 Ga0501067_0227900
975 Ga0501067_0444649
976 Ga0501068_0062810
977 Ga0501068_0074584
978 Ga0501069_0022736
979 Ga0501069_0119964
980 Ga0501069_0240248
981 Ga0501069_0299164
982 Ga0501069_0537210
983 Ga0501069_0787860
984 Ga0501070_0013231
985 Ga0501070_0056690
986 Ga0501070_0110663
987 Ga0501070_0556542
988 Ga0501071_0177490
989 Ga0501071_1345658
990 Ga0501072_0023743
991 Ga0501073_0035979
992 Ga0501073_0501952
993 Ga0501073_1000206
994 Ga0501075_0033587
995 Ga0501075_0045632
996 Ga0501075_0326945
997 Ga0501075_0778490
998 Ga0501076_0085068
999 Ga0501076_0431494
1000 Ga0501076_1316543
1001 Ga0501076_1617644
1002 Ga0501076_1651799
1003 Ga0501077_0004870
1004 Ga0501077_0017543
1005 Ga0501077_0193973
1006 Ga0501233_162639
1007 Ga0501242_037966
1008 Ga0501249_070424
1009 Ga0501079_0023156
1010 Ga0501079_0073950
1011 Ga0501079_0213728
1012 Ga0501080_0428090
1013 Ga0501080_0537845
1014 Ga0501080_0738555
1015 Ga0501080_1188942
1016 Ga0501081_0035074
1017 Ga0501081_0076065
1018 Ga0501083_0064264
1019 Ga0501083_0227750
1020 Ga0501083_0355678
1021 Ga0501268_009985
1022 Ga0501283_053378
1023 Ga0501035_0003567
1024 Ga0501035_0004679
1025 Ga0501035_0032301
1026 Ga0501035_1195140
1027 Ga0501044_0001279
1028 Ga0501044_0005283
1029 Ga0501044_0112677
1030 Ga0501044_0244520
1031 Ga0501044_0461571
1032 Ga0501044_0614840
1033 Ga0501045_0156447
1034 Ga0501045_0259775
1035 Ga0501045_1204640
1036 nmdc:mga05p37_649186_c1
1037 nmdc:mga05p37_76027_c1
1038 nmdc:mga05p37_84610_c1
1039 nmdc:mga09592_26451_c1
1040 nmdc:mga0qj67_53539_c1
1041 nmdc:mga0qj67_852720_c1
1042 nmdc:mga0qj67_93400_c1
1043 nmdc:mga06r32_14458_c1
1044 nmdc:mga06r32_411646_c1
1045 nmdc:mga06r32_67496_c1
1046 nmdc:mga08y16_1454017_c1
1047 nmdc:mga0n895_193990_c1
1048 nmdc:mga0n895_3990_c1
1049 nmdc:mga0n895_425906_c1
1050 nmdc:mga0n895_498667_c1
1051 nmdc:mga0n895_718350_c1
1052 nmdc:mga0n895_886060_c1
1053 nmdc:mga0rr50_116265_c1
1054 nmdc:mga0rr50_796274_c1
1055 nmdc:mga0rr50_83224_c1
1056 nmdc:mga08x19_155_c1
1057 nmdc:mga08x19_7404_c1
1058 nmdc:mga0a205_4720_c1
1059 nmdc:mga0a205_53964_c1
1060 Ga0500639_106603
1061 Ga0501084_0053010
1062 Ga0501084_0082783
1063 Ga0501084_0164455
1064 Ga0501084_0879459
1065 Ga0590071_005041
1066 Ga0590071_044576
1067 Ga0590074_057751
1068 Ga0590075_081513
1069 Ga0590077_002652
1070 Ga0590077_021224
1071 Ga0501082_0023324
1072 Ga0501082_0344137
1073 Ga0530510_0019998
1074 Ga0530510_0851635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

26

172

0.98

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

24

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8n-assembly1.cif.gz_A biochemical and structural studies of a-to-i editing by trna:a34 deaminases at the wobble position of transfer rna 0.9879 5 130
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9681 2 150
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9661 1 146
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9643 1 146
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9542 1 103
ID Description Score Start End Superfamily
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9879 5 130 3.40.140.10
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9872 43 102 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9635 3 151 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9587 5 103 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9506 1 151 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2V0P6K5-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9954 3 110 GO:0002100
GO:0008270
GO:0009507
GO:0052717
AF-A0A6P0JPJ0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9916 3 125 GO:0002100
GO:0008270
GO:0052717
AF-A0A257QHS5-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9882 8 130 GO:0002100
GO:0008251
GO:0008270
AF-A0A6P0T365-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9871 3 130 GO:0002100
GO:0008270
GO:0052717
AF-A0A7S9Z836-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9857 10 151 GO:0002100
GO:0008270
GO:0052717

Map