F460789

General Info

Members Datasets Scaffolds Average Seq Length
536 307 1072 91

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10198389|Ga0213872_101983892
Length 108
Sequence MTLNRVRRATASSEEKMQFMVIERFKNRDAKAVYRRFREQGRGAPEGLTYVNSWIEVNFDRCFQVMECEDARLLQQWVAFWGDLVEFEIVPVVPSKETREVVDALPGA

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
224 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
272 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
295 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
296 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
305 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0
Rhizoplane 0.93
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 9.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10198389 3300021361 Bacteria 861
2 MBSR1b_contig_5614685 2162886012 Bacteria 2163
3 JGI24749J21850_1035230 3300002076 Bacteria 725
4 JGI24034J26672_10086862 3300002239 Bacteria 577
5 JGI24742J22300_10079977 3300002244 Bacteria 617
6 JGI24751J29686_10041250 3300002459 Bacteria 955
7 JGI25406J46586_10027635 3300003203 Bacteria 2172
8 Ga0065714_10200348 3300005288 Bacteria 897
9 Ga0065704_10621437 3300005289 Bacteria 596
10 Ga0065712_10012808 3300005290 Bacteria 3977
11 Ga0065715_10003643 3300005293 Bacteria 4168
12 Ga0065715_10261123 3300005293 Bacteria 1138
13 Ga0065715_10349525 3300005293 Bacteria 934
14 Ga0065707_10207415 3300005295 Bacteria 1281
15 Ga0065707_10289782 3300005295 Bacteria 1028
16 Ga0070676_10346145 3300005328 Bacteria 1021
17 Ga0070676_10407162 3300005328 Bacteria 948
18 Ga0070676_11103258 3300005328 Bacteria 600
19 Ga0070683_100323465 3300005329 Bacteria 1468
20 Ga0070690_100020704 3300005330 Bacteria 4009
21 Ga0070690_100070596 3300005330 Bacteria 2268
22 Ga0070670_100015535 3300005331 Bacteria 6538
23 Ga0070670_100160259 3300005331 Bacteria 1950
24 Ga0070670_100225776 3300005331 Bacteria 1629
25 Ga0070670_100888349 3300005331 Bacteria 807
26 Ga0070670_101348140 3300005331 Bacteria 653
27 Ga0070677_10002563 3300005333 Bacteria 5813
28 Ga0068869_100310281 3300005334 Bacteria 1277
29 Ga0070666_10130001 3300005335 Bacteria 1749
30 Ga0070682_100139883 3300005337 Bacteria 1649
31 Ga0068868_100525793 3300005338 Bacteria 1039
32 Ga0068868_102382108 3300005338 Bacteria 505
33 Ga0070689_100120786 3300005340 Bacteria 2092
34 Ga0070689_100217394 3300005340 Bacteria 1566
35 Ga0070687_100392553 3300005343 Bacteria 908
36 Ga0070687_100622187 3300005343 Bacteria 745
37 Ga0070661_101119067 3300005344 Bacteria 657
38 Ga0070661_101619566 3300005344 Bacteria 548
39 Ga0070692_10311831 3300005345 Bacteria 964
40 Ga0070668_100972709 3300005347 Bacteria 762
41 Ga0070669_100040063 3300005353 Bacteria 3404
42 Ga0070675_100008155 3300005354 Bacteria 8117
43 Ga0070675_100028335 3300005354 Bacteria 4508
44 Ga0070671_100210181 3300005355 Bacteria 1650
45 Ga0070671_101684340 3300005355 Bacteria 563
46 Ga0070674_100001825 3300005356 Bacteria 11556
47 Ga0070674_100172505 3300005356 Unclassified 1650
48 Ga0070674_101373640 3300005356 Bacteria 632
49 Ga0070673_100040494 3300005364 Bacteria 3575
50 Ga0070673_100199540 3300005364 Bacteria 1723
51 Ga0070673_100603147 3300005364 Bacteria 1002
52 Ga0070688_100022452 3300005365 Bacteria 3698
53 Ga0070688_101150620 3300005365 Bacteria 622
54 Ga0070659_101219118 3300005366 Bacteria 666
55 Ga0070667_100606809 3300005367 Bacteria 1008
56 Ga0070709_10768337 3300005434 Bacteria 754
57 Ga0070709_10865222 3300005434 Bacteria 713
58 Ga0070714_100112590 3300005435 Bacteria 2412
59 Ga0070714_100164943 3300005435 Bacteria 2007
60 Ga0070713_100000006 3300005436 Bacteria 190565
61 Ga0070710_11049761 3300005437 Unclassified 596
62 Ga0070710_11263477 3300005437 Bacteria 548
63 Ga0070701_10399111 3300005438 Bacteria 871
64 Ga0070701_10952905 3300005438 Bacteria 596
65 Ga0070711_100520588 3300005439 Bacteria 983
66 Ga0070705_100051787 3300005440 Bacteria 2396
67 Ga0070705_100128557 3300005440 Unclassified 1649
68 Ga0070700_100504334 3300005441 Bacteria 931
69 Ga0070700_101254151 3300005441 Unclassified 621
70 Ga0070708_100167063 3300005445 Bacteria 2053
71 Ga0070708_100305672 3300005445 Bacteria 1498
72 Ga0070678_100266218 3300005456 Unclassified 1444
73 Ga0070662_100016669 3300005457 Bacteria 4937
74 Ga0070662_100669105 3300005457 Bacteria 877
75 Ga0068867_100398920 3300005459 Bacteria 1159
76 Ga0068867_101919904 3300005459 Bacteria 558
77 Ga0070685_10044467 3300005466 Bacteria 2542
78 Ga0070685_10073654 3300005466 Bacteria 2030
79 Ga0070685_10559200 3300005466 Bacteria 818
80 Ga0070706_100013082 3300005467 Bacteria 7679
81 Ga0070706_100031985 3300005467 Bacteria 4851
82 Ga0070706_100039502 3300005467 Bacteria 4357
83 Ga0070706_100209464 3300005467 Bacteria 1820
84 Ga0070706_100252742 3300005467 Unclassified 1645
85 Ga0070706_100426518 3300005467 Bacteria 1234
86 Ga0070706_101629627 3300005467 Unclassified 588
87 Ga0070707_100000601 3300005468 Bacteria 36170
88 Ga0070707_100019911 3300005468 Bacteria 6325
89 Ga0070698_100060961 3300005471 Bacteria 3806
90 Ga0070698_100327783 3300005471 Unclassified 1462
91 Ga0070698_101422550 3300005471 Bacteria 644
92 Ga0070698_101744501 3300005471 Bacteria 575
93 Ga0070699_100195154 3300005518 Bacteria 1799
94 Ga0070699_100562193 3300005518 Unclassified 1039
95 Ga0070699_101179299 3300005518 Bacteria 702
96 Ga0070699_102158217 3300005518 Bacteria 508
97 Ga0070684_100278391 3300005535 Bacteria 1533
98 Ga0070684_100282516 3300005535 Bacteria 1521
99 Ga0070684_101670710 3300005535 Bacteria 601
100 Ga0070697_100051333 3300005536 Bacteria 3350
101 Ga0070697_100628015 3300005536 Bacteria 945
102 Ga0070697_100957224 3300005536 Unclassified 760
103 Ga0068853_100327623 3300005539 Bacteria 1421
104 Ga0068853_100519136 3300005539 Bacteria 1126
105 Ga0068853_102159993 3300005539 Bacteria 540
106 Ga0070672_100010875 3300005543 Bacteria 6328
107 Ga0070672_100019782 3300005543 Bacteria 4895
108 Ga0070672_101906925 3300005543 Bacteria 535
109 Ga0070686_100024976 3300005544 Bacteria 3587
110 Ga0070695_100423414 3300005545 Unclassified 1014
111 Ga0070695_100587224 3300005545 Bacteria 873
112 Ga0070695_101317016 3300005545 Bacteria 597
113 Ga0070696_100033378 3300005546 Bacteria 3536
114 Ga0070696_100360140 3300005546 Bacteria 1129
115 Ga0070693_100075004 3300005547 Bacteria 2002
116 Ga0070665_100610609 3300005548 Bacteria 1104
117 Ga0070665_100688014 3300005548 Bacteria 1036
118 Ga0070704_100525473 3300005549 Bacteria 1030
119 Ga0070704_100855995 3300005549 Unclassified 815
120 Ga0070664_100011022 3300005564 Bacteria 7332
121 Ga0070664_100233437 3300005564 Bacteria 1649
122 Ga0070664_100801532 3300005564 Bacteria 881
123 Ga0068857_100162246 3300005577 Bacteria 2028
124 Ga0068857_101065872 3300005577 Bacteria 779
125 Ga0068857_101482156 3300005577 Bacteria 661
126 Ga0068854_101034737 3300005578 Bacteria 729
127 Ga0068854_101941822 3300005578 Bacteria 542
128 Ga0068856_100000280 3300005614 Bacteria 55488
129 Ga0070702_100168154 3300005615 Bacteria 1424
130 Ga0068852_100345426 3300005616 Bacteria 1451
131 Ga0068859_100189257 3300005617 Bacteria 2142
132 Ga0068859_101621444 3300005617 Bacteria 714
133 Ga0068859_102026777 3300005617 Unclassified 635
134 Ga0068864_100047976 3300005618 Bacteria 3670
135 Ga0068864_101227134 3300005618 Bacteria 749
136 Ga0068864_102675588 3300005618 Bacteria 505
137 Ga0068866_10278211 3300005718 Bacteria 1036
138 Ga0068861_100228880 3300005719 Bacteria 1575
139 Ga0068861_100658215 3300005719 Bacteria 968
140 Ga0068861_100855977 3300005719 Bacteria 857
141 Ga0068861_102040238 3300005719 Bacteria 573
142 Ga0068851_10978370 3300005834 Bacteria 533
143 Ga0068870_10007214 3300005840 Bacteria 4949
144 Ga0068870_10238495 3300005840 Bacteria 1121
145 Ga0068870_11102981 3300005840 Bacteria 571
146 Ga0068863_100430366 3300005841 Bacteria 1293
147 Ga0068863_100758657 3300005841 Bacteria 966
148 Ga0068858_100429053 3300005842 Bacteria 1272
149 Ga0068858_102529212 3300005842 Bacteria 507
150 Ga0068860_100493584 3300005843 Bacteria 1222
151 Ga0068860_100647654 3300005843 Unclassified 1064
152 Ga0068860_102191316 3300005843 Bacteria 574
153 Ga0068862_101061283 3300005844 Bacteria 804
154 Ga0068862_101526802 3300005844 Bacteria 674
155 Ga0068862_102457210 3300005844 Bacteria 533
156 Ga0081455_10094124 3300005937 Bacteria 2421
157 Ga0081455_10761413 3300005937 Bacteria 611
158 Ga0081540_1309420 3300005983 Bacteria 542
159 Ga0081539_10005816 3300005985 Bacteria 12256
160 Ga0070717_10763797 3300006028 Bacteria 879
161 Ga0075365_10661020 3300006038 Bacteria 738
162 Ga0075365_11328610 3300006038 Bacteria 505
163 Ga0075368_10225529 3300006042 Bacteria 797
164 Ga0075363_100000325 3300006048 Bacteria 14237
165 Ga0075363_100686213 3300006048 Bacteria 618
166 Ga0070716_100020933 3300006173 Bacteria 3441
167 Ga0070716_100092753 3300006173 Bacteria 1832
168 Ga0070716_100183663 3300006173 Bacteria 1375
169 Ga0070712_100000184 3300006175 Bacteria 34651
170 Ga0075362_10001083 3300006177 Bacteria 8440
171 Ga0075367_10012652 3300006178 Bacteria 4510
172 Ga0075369_10155739 3300006186 Bacteria 1046
173 Ga0075366_10003248 3300006195 Bacteria 8543
174 Ga0097621_100198463 3300006237 Bacteria 1741
175 Ga0097621_100837912 3300006237 Bacteria 854
176 Ga0075370_10255458 3300006353 Bacteria 1039
177 Ga0075370_10282719 3300006353 Bacteria 986
178 Ga0068871_100284383 3300006358 Bacteria 1447
179 Ga0068871_100562606 3300006358 Bacteria 1034
180 Ga0068871_101856128 3300006358 Bacteria 573
181 Ga0068871_102327879 3300006358 Bacteria 511
182 Ga0075428_100002731 3300006844 Bacteria 19203
183 Ga0075428_100057425 3300006844 Bacteria 4260
184 Ga0075430_100499332 3300006846 Bacteria 1004
185 Ga0075430_100527695 3300006846 Bacteria 974
186 Ga0075431_100000191 3300006847 Bacteria 44571
187 Ga0075431_100498751 3300006847 Bacteria 1209
188 Ga0075431_100877292 3300006847 Bacteria 867
189 Ga0075433_11404449 3300006852 Bacteria 604
190 Ga0075433_11465506 3300006852 Unclassified 590
191 Ga0075434_100693642 3300006871 Bacteria 1036
192 Ga0075434_100702170 3300006871 Unclassified 1029
193 Ga0075434_101669453 3300006871 Unclassified 645
194 Ga0075434_101915474 3300006871 Bacteria 599
195 Ga0075429_100009144 3300006880 Bacteria 8602
196 Ga0068865_100431710 3300006881 Bacteria 1085
197 Ga0075436_100001960 3300006914 Bacteria 14189
198 Ga0097620_100189255 3300006931 Bacteria 2142
199 Ga0097620_101621372 3300006931 Bacteria 714
200 Ga0097620_102026688 3300006931 Unclassified 635
201 Ga0075435_100045236 3300007076 Bacteria 3528
202 Ga0099794_10034672 3300007265 Unclassified 2379
203 Ga0099794_10045888 3300007265 Unclassified 2092
204 Ga0099794_10111552 3300007265 Bacteria 1371
205 Ga0099794_10122606 3300007265 Bacteria 1309
206 Ga0099795_10623691 3300007788 Bacteria 515
207 Ga0105251_10377323 3300009011 Bacteria 649
208 Ga0105240_10111829 3300009093 Bacteria 3303
209 Ga0105240_12543597 3300009093 Unclassified 529
210 Ga0111539_10000066 3300009094 Bacteria 106021
211 Ga0111539_10058861 3300009094 Bacteria 4557
212 Ga0111539_10339608 3300009094 Bacteria 1748
213 Ga0111539_12685961 3300009094 Bacteria 577
214 Ga0111539_13465844 3300009094 Unclassified 507
215 Ga0105245_10328875 3300009098 Bacteria 1508
216 Ga0105245_10662882 3300009098 Bacteria 1074
217 Ga0105245_12369284 3300009098 Bacteria 584
218 Ga0105247_10080320 3300009101 Bacteria 2054
219 Ga0114129_10000159 3300009147 Bacteria 72498
220 Ga0114129_10358999 3300009147 Bacteria 1928
221 Ga0114129_10438191 3300009147 Unclassified 1716
222 Ga0114129_10465988 3300009147 Bacteria 1655
223 Ga0114129_12002665 3300009147 Bacteria 700
224 Ga0105243_10253699 3300009148 Bacteria 1572
225 Ga0105243_10570195 3300009148 Bacteria 1085
226 Ga0105241_10686488 3300009174 Bacteria 933
227 Ga0105242_10166763 3300009176 Unclassified 1932
228 Ga0105242_10557845 3300009176 Bacteria 1099
229 Ga0105242_11018615 3300009176 Bacteria 837
230 Ga0105242_11887040 3300009176 Bacteria 638
231 Ga0105248_10750135 3300009177 Bacteria 1101
232 Ga0105248_10921817 3300009177 Bacteria 987
233 Ga0105248_12226649 3300009177 Bacteria 624
234 Ga0105248_12308031 3300009177 Bacteria 613
235 Ga0105237_11595230 3300009545 Bacteria 659
236 Ga0105238_10249657 3300009551 Bacteria 1752
237 Ga0105238_10322593 3300009551 Bacteria 1531
238 Ga0105238_12021242 3300009551 Bacteria 610
239 Ga0105249_10625719 3300009553 Bacteria 1133
240 Ga0105249_10990797 3300009553 Bacteria 909
241 Ga0099796_10058261 3300010159 Unclassified 1361
242 Ga0105239_12591265 3300010375 Bacteria 591
243 Ga0105246_10048741 3300011119 Bacteria 2897
244 Ga0105246_10626086 3300011119 Bacteria 933
245 Ga0105246_11034963 3300011119 Bacteria 745
246 Ga0105246_11340097 3300011119 Bacteria 665
247 Ga0157378_10025427 3300013297 Bacteria 5214
248 Ga0157378_10281403 3300013297 Bacteria 1603
249 Ga0157378_10807270 3300013297 Bacteria 964
250 Ga0157378_11009566 3300013297 Bacteria 866
251 Ga0157378_11226265 3300013297 Unclassified 790
252 Ga0163162_10431918 3300013306 Unclassified 1449
253 Ga0163162_10875830 3300013306 Bacteria 1012
254 Ga0163162_11066243 3300013306 Bacteria 915
255 Ga0157372_11000459 3300013307 Bacteria 968
256 Ga0157375_11042019 3300013308 Bacteria 956
257 Ga0157375_11739139 3300013308 Unclassified 739
258 Ga0163163_10139302 3300014325 Bacteria 2468
259 Ga0163163_10277896 3300014325 Bacteria 1726
260 Ga0163163_10373123 3300014325 Bacteria 1484
261 Ga0157380_11192451 3300014326 Bacteria 805
262 Ga0157380_13209295 3300014326 Bacteria 522
263 Ga0182008_10448904 3300014497 Bacteria 701
264 Ga0157377_10104422 3300014745 Bacteria 1694
265 Ga0157377_10736235 3300014745 Unclassified 720
266 Ga0157379_10046138 3300014968 Bacteria 3889
267 Ga0157379_12418987 3300014968 Bacteria 524
268 Ga0182005_1024214 3300015265 Bacteria 1659
269 Ga0163161_10337850 3300017792 Bacteria 1194
270 Ga0213873_10110658 3300021358 Bacteria 798
271 Ga0213876_10111314 3300021384 Bacteria 1453
272 Ga0207697_10050993 3300025315 Bacteria 1709
273 Ga0207682_10002125 3300025893 Bacteria 8980
274 Ga0207692_10115675 3300025898 Bacteria 1494
275 Ga0207642_10327930 3300025899 Bacteria 896
276 Ga0207710_10242908 3300025900 Bacteria 899
277 Ga0207688_10101160 3300025901 Bacteria 1665
278 Ga0207688_10188214 3300025901 Bacteria 1233
279 Ga0207680_10722066 3300025903 Bacteria 714
280 Ga0207647_10734796 3300025904 Bacteria 535
281 Ga0207699_10001108 3300025906 Bacteria 12731
282 Ga0207699_10248184 3300025906 Bacteria 1226
283 Ga0207645_10134096 3300025907 Bacteria 1612
284 Ga0207645_10647892 3300025907 Bacteria 718
285 Ga0207643_10050970 3300025908 Bacteria 2349
286 Ga0207643_10439118 3300025908 Bacteria 829
287 Ga0207684_10009258 3300025910 Bacteria 8702
288 Ga0207684_10044765 3300025910 Bacteria 3754
289 Ga0207684_10066104 3300025910 Bacteria 3071
290 Ga0207684_10184284 3300025910 Bacteria 1800
291 Ga0207684_10375156 3300025910 Bacteria 1224
292 Ga0207684_10626707 3300025910 Bacteria 917
293 Ga0207684_11015593 3300025910 Unclassified 693
294 Ga0207671_10486810 3300025914 Bacteria 983
295 Ga0207693_10000733 3300025915 Bacteria 29584
296 Ga0207663_10265450 3300025916 Bacteria 1269
297 Ga0207662_10051642 3300025918 Bacteria 2446
298 Ga0207649_10798258 3300025920 Bacteria 737
299 Ga0207649_11016512 3300025920 Bacteria 653
300 Ga0207646_10000118 3300025922 Bacteria 109016
301 Ga0207646_10012736 3300025922 Bacteria 8068
302 Ga0207681_10046877 3300025923 Bacteria 2908
303 Ga0207694_10511532 3300025924 Bacteria 1006
304 Ga0207694_10654271 3300025924 Bacteria 885
305 Ga0207650_10391932 3300025925 Bacteria 1148
306 Ga0207650_10460550 3300025925 Bacteria 1059
307 Ga0207650_10550349 3300025925 Bacteria 967
308 Ga0207659_10069238 3300025926 Bacteria 2569
309 Ga0207659_10487983 3300025926 Bacteria 1042
310 Ga0207687_10265229 3300025927 Bacteria 1371
311 Ga0207700_10000020 3300025928 Bacteria 176182
312 Ga0207664_10249827 3300025929 Bacteria 1548
313 Ga0207644_10647755 3300025931 Bacteria 879
314 Ga0207644_11436174 3300025931 Bacteria 579
315 Ga0207690_10628602 3300025932 Bacteria 878
316 Ga0207706_10478546 3300025933 Bacteria 1076
317 Ga0207706_10535015 3300025933 Bacteria 1010
318 Ga0207686_10100182 3300025934 Unclassified 1933
319 Ga0207686_10761886 3300025934 Bacteria 773
320 Ga0207709_10410107 3300025935 Bacteria 1038
321 Ga0207709_10413753 3300025935 Bacteria 1034
322 Ga0207709_11071918 3300025935 Bacteria 661
323 Ga0207670_10170090 3300025936 Bacteria 1633
324 Ga0207670_10275351 3300025936 Bacteria 1310
325 Ga0207670_10996313 3300025936 Bacteria 705
326 Ga0207669_10002829 3300025937 Bacteria 7436
327 Ga0207704_10168736 3300025938 Bacteria 1567
328 Ga0207665_10120692 3300025939 Bacteria 1851
329 Ga0207665_10240239 3300025939 Bacteria 1334
330 Ga0207691_10042023 3300025940 Bacteria 4217
331 Ga0207691_10420043 3300025940 Bacteria 1140
332 Ga0207689_10046398 3300025942 Bacteria 3591
333 Ga0207689_10333176 3300025942 Bacteria 1260
334 Ga0207661_10408220 3300025944 Bacteria 1232
335 Ga0207661_12018460 3300025944 Bacteria 523
336 Ga0207679_10066797 3300025945 Bacteria 2696
337 Ga0207679_10258952 3300025945 Bacteria 1483
338 Ga0207651_10467750 3300025960 Bacteria 1084
339 Ga0207712_10327251 3300025961 Bacteria 1267
340 Ga0207712_10521481 3300025961 Bacteria 1018
341 Ga0207668_11096897 3300025972 Bacteria 713
342 Ga0207668_11648473 3300025972 Bacteria 579
343 Ga0207640_11347156 3300025981 Bacteria 638
344 Ga0207658_10213695 3300025986 Bacteria 1618
345 Ga0207703_10159270 3300026035 Bacteria 1976
346 Ga0207703_10161825 3300026035 Bacteria 1961
347 Ga0207639_10203306 3300026041 Bacteria 1700
348 Ga0207639_10254785 3300026041 Bacteria 1532
349 Ga0207708_10912146 3300026075 Bacteria 761
350 Ga0207702_10000030 3300026078 Bacteria 178718
351 Ga0207702_12118197 3300026078 Bacteria 552
352 Ga0207641_10577034 3300026088 Bacteria 1099
353 Ga0207641_12309679 3300026088 Bacteria 537
354 Ga0207648_10007671 3300026089 Bacteria 10560
355 Ga0207676_10067256 3300026095 Bacteria 2861
356 Ga0207676_10709563 3300026095 Bacteria 975
357 Ga0207676_10845356 3300026095 Bacteria 895
358 Ga0207674_10182963 3300026116 Bacteria 2047
359 Ga0207674_10413899 3300026116 Bacteria 1302
360 Ga0207674_11369235 3300026116 Bacteria 677
361 Ga0207675_100924471 3300026118 Bacteria 889
362 Ga0207675_100999083 3300026118 Bacteria 855
363 Ga0207675_102496642 3300026118 Unclassified 528
364 Ga0207683_10055511 3300026121 Bacteria 3473
365 Ga0209588_1044306 3300027671 Bacteria 1439
366 Ga0209588_1099829 3300027671 Unclassified 934
367 Ga0209588_1264367 3300027671 Bacteria 523
368 Ga0207428_10001295 3300027907 Bacteria 26654
369 Ga0207428_10168183 3300027907 Bacteria 1661
370 Ga0268266_10595021 3300028379 Bacteria 1062
371 Ga0268265_11213416 3300028380 Bacteria 752
372 Ga0268265_11603614 3300028380 Bacteria 656
373 Ga0268265_11910593 3300028380 Bacteria 600
374 Ga0268264_10933206 3300028381 Unclassified 872
375 Ga0307408_100029853 3300031548 Bacteria 3781
376 Ga0307408_100933477 3300031548 Bacteria 796
377 Ga0307405_10072324 3300031731 Bacteria 2222
378 Ga0307413_10015794 3300031824 Bacteria 3879
379 Ga0307413_11695914 3300031824 Bacteria 563
380 Ga0307410_10027141 3300031852 Bacteria 3615
381 Ga0307406_10005438 3300031901 Bacteria 6971
382 Ga0307406_10134053 3300031901 Bacteria 1743
383 Ga0307406_10579990 3300031901 Bacteria 922
384 Ga0307407_10030275 3300031903 Bacteria 2918
385 Ga0307412_10012619 3300031911 Bacteria 4930
386 Ga0307409_100010749 3300031995 Bacteria 5716
387 Ga0307409_101020932 3300031995 Bacteria 846
388 Ga0307416_100035348 3300032002 Bacteria 3814
389 Ga0307416_100659071 3300032002 Bacteria 1132
390 Ga0307416_103770472 3300032002 Bacteria 507
391 Ga0307414_10026937 3300032004 Bacteria 3706
392 Ga0307411_10106668 3300032005 Bacteria 1994
393 Ga0307411_10573166 3300032005 Bacteria 966
394 Ga0307411_12169984 3300032005 Bacteria 520
395 Ga0307415_100010452 3300032126 Bacteria 5258
396 Ga0307415_100515565 3300032126 Bacteria 1048
397 Ga0373929_0194890 3300035085 Bacteria 565
398 Ga0373932_0172979 3300035112 Bacteria 753
399 Ga0373941_0051485 3300035115 Bacteria 1310
400 Ga0373931_0030384 3300035691 Bacteria 2781
401 Ga0373935_0114758 3300035692 Bacteria 1792
402 Ga0373935_0393882 3300035692 Bacteria 994
403 Ga0373935_1522233 3300035692 Bacteria 501
404 Ga0373927_0273562 3300035695 Bacteria 1111
405 Ga0373947_0868336 3300035725 Unclassified 616
406 Ga0373937_0287765 3300036401 Bacteria 1552
407 Ga0373925_0022523 3300037068 Bacteria 4596
408 Ga0373925_0363016 3300037068 Bacteria 1177
409 Ga0436364_0766290 3300037853 Bacteria 668
410 Ga0436364_0997179 3300037853 Bacteria 953
411 Ga0436364_1531751 3300037853 Bacteria 911
412 Ga0395901_1608124 3300038443 Unclassified 603
413 Ga0436365_0199808 3300039437 Bacteria 1437
414 Ga0436365_1163122 3300039437 Bacteria 2252
415 Ga0436365_1652111 3300039437 Bacteria 985
416 Ga0436360_1245158 3300039438 Bacteria 795
417 Ga0436361_0336154 3300039447 Bacteria 4313
418 Ga0436363_0134975 3300039450 Bacteria 733
419 Ga0436362_0525440 3300039453 Bacteria 1423
420 Ga0439453_0015274 3300041408 Bacteria 1326
421 Ga0439441_125880 3300042001 Bacteria 590
422 Ga0439443_017415 3300042003 Bacteria 1105
423 Ga0450923_135728 3300042125 Bacteria 588
424 Ga0439460_0010041 3300042461 Bacteria 2415
425 Ga0451577_1786150 3300042876 Unclassified 540
426 Ga0453683_0220228 3300044673 Unclassified 1206
427 Ga0453683_0541915 3300044673 Bacteria 757
428 Ga0466963_1024519 3300044694 Bacteria 581
429 Ga0466963_1345970 3300044694 Bacteria 501
430 Ga0453684_0150342 3300044712 Bacteria 2768
431 Ga0466957_0158253 3300044842 Bacteria 1470
432 Ga0466960_0896925 3300044901 Bacteria 541
433 Ga0451576_0050224 3300045051 Bacteria 4374
434 Ga0451576_0406900 3300045051 Bacteria 1427
435 Ga0495592_0847758 3300046454 Unclassified 540
436 Ga0495590_0322665 3300046457 Bacteria 584
437 Ga0495638_0021590 3300046460 Bacteria 4240
438 Ga0495580_0118687 3300046472 Bacteria 1836
439 Ga0495580_0324786 3300046472 Bacteria 1046
440 Ga0495594_0167977 3300046499 Bacteria 1248
441 Ga0495663_0034704 3300046525 Bacteria 1512
442 Ga0495586_0122028 3300046535 Bacteria 1456
443 Ga0495587_0757305 3300046536 Unclassified 531
444 Ga0495598_0028607 3300046537 Bacteria 1547
445 Ga0495598_0142597 3300046537 Bacteria 830
446 Ga0495621_0007650 3300046539 Bacteria 3207
447 Ga0495633_0513171 3300046558 Bacteria 540
448 Ga0495656_0035636 3300046615 Bacteria 2045
449 Ga0495611_0223541 3300046648 Bacteria 876
450 Ga0495659_0252620 3300046664 Bacteria 735
451 Ga0495599_0464019 3300046678 Bacteria 749
452 Ga0495613_0135962 3300046689 Bacteria 1759
453 Ga0495674_0124621 3300047319 Bacteria 2175
454 Ga0495674_0795976 3300047319 Unclassified 736
455 Ga0495672_0411079 3300047320 Bacteria 617
456 Ga0495685_035657 3300047447 Bacteria 1709
457 Ga0495615_0003814 3300048090 Bacteria 2563
458 Ga0496102_1749742 3300048905 Bacteria 539
459 Ga0496103_0829089 3300048906 Bacteria 582
460 Ga0496107_0616453 3300048910 Bacteria 801
461 Ga0496110_1909163 3300048913 Bacteria 504
462 Ga0496110_1920538 3300048913 Bacteria 502
463 Ga0501036_0157433 3300049572 Unclassified 1916
464 Ga0501038_0829059 3300049574 Bacteria 686
465 Ga0501040_0462990 3300049576 Bacteria 913
466 Ga0501041_0311319 3300049577 Bacteria 993
467 Ga0501042_0860622 3300049578 Bacteria 660
468 Ga0501042_0992602 3300049578 Bacteria 612
469 Ga0501043_0332590 3300049579 Bacteria 1157
470 Ga0501046_0470738 3300049580 Unclassified 902
471 Ga0501048_0221964 3300049582 Bacteria 1341
472 Ga0501048_0461622 3300049582 Bacteria 910
473 Ga0501068_0476405 3300049584 Bacteria 809
474 Ga0501071_0445442 3300049587 Unclassified 991
475 Ga0501072_0126406 3300049588 Bacteria 2037
476 Ga0501072_0776110 3300049588 Unclassified 751
477 Ga0501072_1108965 3300049588 Bacteria 616
478 Ga0501075_0518690 3300049591 Bacteria 909
479 Ga0501076_0052723 3300049592 Bacteria 3223
480 Ga0501076_0409531 3300049592 Bacteria 1115
481 Ga0501076_1102216 3300049592 Bacteria 654
482 Ga0501077_0332334 3300049593 Unclassified 969
483 Ga0501243_048625 3300049675 Bacteria 761
484 Ga0501253_187367 3300049683 Bacteria 541
485 Ga0501079_0853792 3300049741 Bacteria 717
486 Ga0501080_0789112 3300049742 Bacteria 834
487 Ga0501035_0241312 3300049822 Unclassified 1537
488 Ga0501045_0092892 3300049824 Bacteria 2232
489 nmdc:mga03683_170448_c1 3300050489 Bacteria 989
490 nmdc:mga03683_54567_c1 3300050489 Bacteria 1676
491 nmdc:mga03n38_290413_c1 3300050490 Bacteria 875
492 nmdc:mga03n38_55705_c1 3300050490 Bacteria 1782
493 nmdc:mga0yw44_86773_c1 3300050492 Bacteria 1971
494 nmdc:mga0k408_594777_c1 3300050493 Bacteria 653
495 nmdc:mga0k408_604875_c1 3300050493 Bacteria 646
496 nmdc:mga06z11_255868_c1 3300050494 Bacteria 1032
497 nmdc:mga04h51_102785_c1 3300050495 Bacteria 1043
498 nmdc:mga07m45_561302_c1 3300050496 Bacteria 660
499 nmdc:mga07m45_76957_c1 3300050496 Bacteria 1902
500 nmdc:mga05p37_1164856_c1 3300050507 Bacteria 800
501 nmdc:mga05p37_1452668_c1 3300050507 Bacteria 686
502 nmdc:mga05p37_251017_c1 3300050507 Bacteria 2122
503 nmdc:mga05p37_317_c1 3300050507 Bacteria 51164
504 nmdc:mga05p37_34073_c1 3300050507 Bacteria 6238
505 nmdc:mga05p37_80067_c1 3300050507 Bacteria 4023
506 nmdc:mga09592_237594_c1 3300050508 Bacteria 1579
507 nmdc:mga09592_769_c1 3300050508 Bacteria 24725
508 nmdc:mga0qj67_287249_c1 3300050509 Bacteria 1333
509 nmdc:mga0qj67_57131_c1 3300050509 Bacteria 3093
510 nmdc:mga06r32_1166_c1 3300050510 Bacteria 23655
511 nmdc:mga06r32_190686_c1 3300050510 Bacteria 2037
512 nmdc:mga08y16_119_c1 3300050511 Bacteria 67766
513 nmdc:mga08y16_42973_c1 3300050511 Bacteria 4734
514 nmdc:mga0n895_272313_c1 3300050512 Bacteria 1717
515 nmdc:mga0n895_788316_c1 3300050512 Bacteria 941
516 nmdc:mga0n895_796036_c1 3300050512 Unclassified 936
517 nmdc:mga0rr50_47781_c1 3300050513 Bacteria 3160
518 nmdc:mga08x19_460_c1 3300050514 Bacteria 27547
519 nmdc:mga0a205_1121303_c1 3300050515 Bacteria 634
520 nmdc:mga0a205_340561_c1 3300050515 Bacteria 1368
521 nmdc:mga0sz30_103078_c1 3300050516 Bacteria 1247
522 Ga0500610_0237149 3300053079 Bacteria 851
523 Ga0500635_0133259 3300053080 Bacteria 938
524 Ga0500578_0238678 3300053086 Bacteria 1099
525 Ga0500646_0406747 3300053090 Bacteria 503
526 Ga0500651_0377052 3300053093 Bacteria 801
527 Ga0500641_0068723 3300053096 Bacteria 1487
528 Ga0500562_063444 3300053108 Bacteria 994
529 Ga0500642_0140600 3300053130 Bacteria 1132
530 Ga0500655_058762 3300053133 Bacteria 773
531 Ga0500568_0017863 3300053139 Bacteria 3120
532 Ga0500577_0101328 3300053142 Bacteria 1177
533 Ga0500604_0092887 3300053151 Bacteria 987
534 Ga0501082_0750026 3300060353 Unclassified 854
535 Ga0530510_0228151 3300061734 Bacteria 1385
536 Ga0530510_0532155 3300061734 Unclassified 892
537 Ga0213872_10198389
538 MBSR1b_contig_5614685
539 JGI24749J21850_1035230
540 JGI24034J26672_10086862
541 JGI24742J22300_10079977
542 JGI24751J29686_10041250
543 JGI25406J46586_10027635
544 Ga0065714_10200348
545 Ga0065704_10621437
546 Ga0065712_10012808
547 Ga0065715_10003643
548 Ga0065715_10261123
549 Ga0065715_10349525
550 Ga0065707_10207415
551 Ga0065707_10289782
552 Ga0070676_10346145
553 Ga0070676_10407162
554 Ga0070676_11103258
555 Ga0070683_100323465
556 Ga0070690_100020704
557 Ga0070690_100070596
558 Ga0070670_100015535
559 Ga0070670_100160259
560 Ga0070670_100225776
561 Ga0070670_100888349
562 Ga0070670_101348140
563 Ga0070677_10002563
564 Ga0068869_100310281
565 Ga0070666_10130001
566 Ga0070682_100139883
567 Ga0068868_100525793
568 Ga0068868_102382108
569 Ga0070689_100120786
570 Ga0070689_100217394
571 Ga0070687_100392553
572 Ga0070687_100622187
573 Ga0070661_101119067
574 Ga0070661_101619566
575 Ga0070692_10311831
576 Ga0070668_100972709
577 Ga0070669_100040063
578 Ga0070675_100008155
579 Ga0070675_100028335
580 Ga0070671_100210181
581 Ga0070671_101684340
582 Ga0070674_100001825
583 Ga0070674_100172505
584 Ga0070674_101373640
585 Ga0070673_100040494
586 Ga0070673_100199540
587 Ga0070673_100603147
588 Ga0070688_100022452
589 Ga0070688_101150620
590 Ga0070659_101219118
591 Ga0070667_100606809
592 Ga0070709_10768337
593 Ga0070709_10865222
594 Ga0070714_100112590
595 Ga0070714_100164943
596 Ga0070713_100000006
597 Ga0070710_11049761
598 Ga0070710_11263477
599 Ga0070701_10399111
600 Ga0070701_10952905
601 Ga0070711_100520588
602 Ga0070705_100051787
603 Ga0070705_100128557
604 Ga0070700_100504334
605 Ga0070700_101254151
606 Ga0070708_100167063
607 Ga0070708_100305672
608 Ga0070678_100266218
609 Ga0070662_100016669
610 Ga0070662_100669105
611 Ga0068867_100398920
612 Ga0068867_101919904
613 Ga0070685_10044467
614 Ga0070685_10073654
615 Ga0070685_10559200
616 Ga0070706_100013082
617 Ga0070706_100031985
618 Ga0070706_100039502
619 Ga0070706_100209464
620 Ga0070706_100252742
621 Ga0070706_100426518
622 Ga0070706_101629627
623 Ga0070707_100000601
624 Ga0070707_100019911
625 Ga0070698_100060961
626 Ga0070698_100327783
627 Ga0070698_101422550
628 Ga0070698_101744501
629 Ga0070699_100195154
630 Ga0070699_100562193
631 Ga0070699_101179299
632 Ga0070699_102158217
633 Ga0070684_100278391
634 Ga0070684_100282516
635 Ga0070684_101670710
636 Ga0070697_100051333
637 Ga0070697_100628015
638 Ga0070697_100957224
639 Ga0068853_100327623
640 Ga0068853_100519136
641 Ga0068853_102159993
642 Ga0070672_100010875
643 Ga0070672_100019782
644 Ga0070672_101906925
645 Ga0070686_100024976
646 Ga0070695_100423414
647 Ga0070695_100587224
648 Ga0070695_101317016
649 Ga0070696_100033378
650 Ga0070696_100360140
651 Ga0070693_100075004
652 Ga0070665_100610609
653 Ga0070665_100688014
654 Ga0070704_100525473
655 Ga0070704_100855995
656 Ga0070664_100011022
657 Ga0070664_100233437
658 Ga0070664_100801532
659 Ga0068857_100162246
660 Ga0068857_101065872
661 Ga0068857_101482156
662 Ga0068854_101034737
663 Ga0068854_101941822
664 Ga0068856_100000280
665 Ga0070702_100168154
666 Ga0068852_100345426
667 Ga0068859_100189257
668 Ga0068859_101621444
669 Ga0068859_102026777
670 Ga0068864_100047976
671 Ga0068864_101227134
672 Ga0068864_102675588
673 Ga0068866_10278211
674 Ga0068861_100228880
675 Ga0068861_100658215
676 Ga0068861_100855977
677 Ga0068861_102040238
678 Ga0068851_10978370
679 Ga0068870_10007214
680 Ga0068870_10238495
681 Ga0068870_11102981
682 Ga0068863_100430366
683 Ga0068863_100758657
684 Ga0068858_100429053
685 Ga0068858_102529212
686 Ga0068860_100493584
687 Ga0068860_100647654
688 Ga0068860_102191316
689 Ga0068862_101061283
690 Ga0068862_101526802
691 Ga0068862_102457210
692 Ga0081455_10094124
693 Ga0081455_10761413
694 Ga0081540_1309420
695 Ga0081539_10005816
696 Ga0070717_10763797
697 Ga0075365_10661020
698 Ga0075365_11328610
699 Ga0075368_10225529
700 Ga0075363_100000325
701 Ga0075363_100686213
702 Ga0070716_100020933
703 Ga0070716_100092753
704 Ga0070716_100183663
705 Ga0070712_100000184
706 Ga0075362_10001083
707 Ga0075367_10012652
708 Ga0075369_10155739
709 Ga0075366_10003248
710 Ga0097621_100198463
711 Ga0097621_100837912
712 Ga0075370_10255458
713 Ga0075370_10282719
714 Ga0068871_100284383
715 Ga0068871_100562606
716 Ga0068871_101856128
717 Ga0068871_102327879
718 Ga0075428_100002731
719 Ga0075428_100057425
720 Ga0075430_100499332
721 Ga0075430_100527695
722 Ga0075431_100000191
723 Ga0075431_100498751
724 Ga0075431_100877292
725 Ga0075433_11404449
726 Ga0075433_11465506
727 Ga0075434_100693642
728 Ga0075434_100702170
729 Ga0075434_101669453
730 Ga0075434_101915474
731 Ga0075429_100009144
732 Ga0068865_100431710
733 Ga0075436_100001960
734 Ga0097620_100189255
735 Ga0097620_101621372
736 Ga0097620_102026688
737 Ga0075435_100045236
738 Ga0099794_10034672
739 Ga0099794_10045888
740 Ga0099794_10111552
741 Ga0099794_10122606
742 Ga0099795_10623691
743 Ga0105251_10377323
744 Ga0105240_10111829
745 Ga0105240_12543597
746 Ga0111539_10000066
747 Ga0111539_10058861
748 Ga0111539_10339608
749 Ga0111539_12685961
750 Ga0111539_13465844
751 Ga0105245_10328875
752 Ga0105245_10662882
753 Ga0105245_12369284
754 Ga0105247_10080320
755 Ga0114129_10000159
756 Ga0114129_10358999
757 Ga0114129_10438191
758 Ga0114129_10465988
759 Ga0114129_12002665
760 Ga0105243_10253699
761 Ga0105243_10570195
762 Ga0105241_10686488
763 Ga0105242_10166763
764 Ga0105242_10557845
765 Ga0105242_11018615
766 Ga0105242_11887040
767 Ga0105248_10750135
768 Ga0105248_10921817
769 Ga0105248_12226649
770 Ga0105248_12308031
771 Ga0105237_11595230
772 Ga0105238_10249657
773 Ga0105238_10322593
774 Ga0105238_12021242
775 Ga0105249_10625719
776 Ga0105249_10990797
777 Ga0099796_10058261
778 Ga0105239_12591265
779 Ga0105246_10048741
780 Ga0105246_10626086
781 Ga0105246_11034963
782 Ga0105246_11340097
783 Ga0157378_10025427
784 Ga0157378_10281403
785 Ga0157378_10807270
786 Ga0157378_11009566
787 Ga0157378_11226265
788 Ga0163162_10431918
789 Ga0163162_10875830
790 Ga0163162_11066243
791 Ga0157372_11000459
792 Ga0157375_11042019
793 Ga0157375_11739139
794 Ga0163163_10139302
795 Ga0163163_10277896
796 Ga0163163_10373123
797 Ga0157380_11192451
798 Ga0157380_13209295
799 Ga0182008_10448904
800 Ga0157377_10104422
801 Ga0157377_10736235
802 Ga0157379_10046138
803 Ga0157379_12418987
804 Ga0182005_1024214
805 Ga0163161_10337850
806 Ga0213873_10110658
807 Ga0213876_10111314
808 Ga0207697_10050993
809 Ga0207682_10002125
810 Ga0207692_10115675
811 Ga0207642_10327930
812 Ga0207710_10242908
813 Ga0207688_10101160
814 Ga0207688_10188214
815 Ga0207680_10722066
816 Ga0207647_10734796
817 Ga0207699_10001108
818 Ga0207699_10248184
819 Ga0207645_10134096
820 Ga0207645_10647892
821 Ga0207643_10050970
822 Ga0207643_10439118
823 Ga0207684_10009258
824 Ga0207684_10044765
825 Ga0207684_10066104
826 Ga0207684_10184284
827 Ga0207684_10375156
828 Ga0207684_10626707
829 Ga0207684_11015593
830 Ga0207671_10486810
831 Ga0207693_10000733
832 Ga0207663_10265450
833 Ga0207662_10051642
834 Ga0207649_10798258
835 Ga0207649_11016512
836 Ga0207646_10000118
837 Ga0207646_10012736
838 Ga0207681_10046877
839 Ga0207694_10511532
840 Ga0207694_10654271
841 Ga0207650_10391932
842 Ga0207650_10460550
843 Ga0207650_10550349
844 Ga0207659_10069238
845 Ga0207659_10487983
846 Ga0207687_10265229
847 Ga0207700_10000020
848 Ga0207664_10249827
849 Ga0207644_10647755
850 Ga0207644_11436174
851 Ga0207690_10628602
852 Ga0207706_10478546
853 Ga0207706_10535015
854 Ga0207686_10100182
855 Ga0207686_10761886
856 Ga0207709_10410107
857 Ga0207709_10413753
858 Ga0207709_11071918
859 Ga0207670_10170090
860 Ga0207670_10275351
861 Ga0207670_10996313
862 Ga0207669_10002829
863 Ga0207704_10168736
864 Ga0207665_10120692
865 Ga0207665_10240239
866 Ga0207691_10042023
867 Ga0207691_10420043
868 Ga0207689_10046398
869 Ga0207689_10333176
870 Ga0207661_10408220
871 Ga0207661_12018460
872 Ga0207679_10066797
873 Ga0207679_10258952
874 Ga0207651_10467750
875 Ga0207712_10327251
876 Ga0207712_10521481
877 Ga0207668_11096897
878 Ga0207668_11648473
879 Ga0207640_11347156
880 Ga0207658_10213695
881 Ga0207703_10159270
882 Ga0207703_10161825
883 Ga0207639_10203306
884 Ga0207639_10254785
885 Ga0207708_10912146
886 Ga0207702_10000030
887 Ga0207702_12118197
888 Ga0207641_10577034
889 Ga0207641_12309679
890 Ga0207648_10007671
891 Ga0207676_10067256
892 Ga0207676_10709563
893 Ga0207676_10845356
894 Ga0207674_10182963
895 Ga0207674_10413899
896 Ga0207674_11369235
897 Ga0207675_100924471
898 Ga0207675_100999083
899 Ga0207675_102496642
900 Ga0207683_10055511
901 Ga0209588_1044306
902 Ga0209588_1099829
903 Ga0209588_1264367
904 Ga0207428_10001295
905 Ga0207428_10168183
906 Ga0268266_10595021
907 Ga0268265_11213416
908 Ga0268265_11603614
909 Ga0268265_11910593
910 Ga0268264_10933206
911 Ga0307408_100029853
912 Ga0307408_100933477
913 Ga0307405_10072324
914 Ga0307413_10015794
915 Ga0307413_11695914
916 Ga0307410_10027141
917 Ga0307406_10005438
918 Ga0307406_10134053
919 Ga0307406_10579990
920 Ga0307407_10030275
921 Ga0307412_10012619
922 Ga0307409_100010749
923 Ga0307409_101020932
924 Ga0307416_100035348
925 Ga0307416_100659071
926 Ga0307416_103770472
927 Ga0307414_10026937
928 Ga0307411_10106668
929 Ga0307411_10573166
930 Ga0307411_12169984
931 Ga0307415_100010452
932 Ga0307415_100515565
933 Ga0373929_0194890
934 Ga0373932_0172979
935 Ga0373941_0051485
936 Ga0373931_0030384
937 Ga0373935_0114758
938 Ga0373935_0393882
939 Ga0373935_1522233
940 Ga0373927_0273562
941 Ga0373947_0868336
942 Ga0373937_0287765
943 Ga0373925_0022523
944 Ga0373925_0363016
945 Ga0436364_0766290
946 Ga0436364_0997179
947 Ga0436364_1531751
948 Ga0395901_1608124
949 Ga0436365_0199808
950 Ga0436365_1163122
951 Ga0436365_1652111
952 Ga0436360_1245158
953 Ga0436361_0336154
954 Ga0436363_0134975
955 Ga0436362_0525440
956 Ga0439453_0015274
957 Ga0439441_125880
958 Ga0439443_017415
959 Ga0450923_135728
960 Ga0439460_0010041
961 Ga0451577_1786150
962 Ga0453683_0220228
963 Ga0453683_0541915
964 Ga0466963_1024519
965 Ga0466963_1345970
966 Ga0453684_0150342
967 Ga0466957_0158253
968 Ga0466960_0896925
969 Ga0451576_0050224
970 Ga0451576_0406900
971 Ga0495592_0847758
972 Ga0495590_0322665
973 Ga0495638_0021590
974 Ga0495580_0118687
975 Ga0495580_0324786
976 Ga0495594_0167977
977 Ga0495663_0034704
978 Ga0495586_0122028
979 Ga0495587_0757305
980 Ga0495598_0028607
981 Ga0495598_0142597
982 Ga0495621_0007650
983 Ga0495633_0513171
984 Ga0495656_0035636
985 Ga0495611_0223541
986 Ga0495659_0252620
987 Ga0495599_0464019
988 Ga0495613_0135962
989 Ga0495674_0124621
990 Ga0495674_0795976
991 Ga0495672_0411079
992 Ga0495685_035657
993 Ga0495615_0003814
994 Ga0496102_1749742
995 Ga0496103_0829089
996 Ga0496107_0616453
997 Ga0496110_1909163
998 Ga0496110_1920538
999 Ga0501036_0157433
1000 Ga0501038_0829059
1001 Ga0501040_0462990
1002 Ga0501041_0311319
1003 Ga0501042_0860622
1004 Ga0501042_0992602
1005 Ga0501043_0332590
1006 Ga0501046_0470738
1007 Ga0501048_0221964
1008 Ga0501048_0461622
1009 Ga0501068_0476405
1010 Ga0501071_0445442
1011 Ga0501072_0126406
1012 Ga0501072_0776110
1013 Ga0501072_1108965
1014 Ga0501075_0518690
1015 Ga0501076_0052723
1016 Ga0501076_0409531
1017 Ga0501076_1102216
1018 Ga0501077_0332334
1019 Ga0501243_048625
1020 Ga0501253_187367
1021 Ga0501079_0853792
1022 Ga0501080_0789112
1023 Ga0501035_0241312
1024 Ga0501045_0092892
1025 nmdc:mga03683_170448_c1
1026 nmdc:mga03683_54567_c1
1027 nmdc:mga03n38_290413_c1
1028 nmdc:mga03n38_55705_c1
1029 nmdc:mga0yw44_86773_c1
1030 nmdc:mga0k408_594777_c1
1031 nmdc:mga0k408_604875_c1
1032 nmdc:mga06z11_255868_c1
1033 nmdc:mga04h51_102785_c1
1034 nmdc:mga07m45_561302_c1
1035 nmdc:mga07m45_76957_c1
1036 nmdc:mga05p37_1164856_c1
1037 nmdc:mga05p37_1452668_c1
1038 nmdc:mga05p37_251017_c1
1039 nmdc:mga05p37_317_c1
1040 nmdc:mga05p37_34073_c1
1041 nmdc:mga05p37_80067_c1
1042 nmdc:mga09592_237594_c1
1043 nmdc:mga09592_769_c1
1044 nmdc:mga0qj67_287249_c1
1045 nmdc:mga0qj67_57131_c1
1046 nmdc:mga06r32_1166_c1
1047 nmdc:mga06r32_190686_c1
1048 nmdc:mga08y16_119_c1
1049 nmdc:mga08y16_42973_c1
1050 nmdc:mga0n895_272313_c1
1051 nmdc:mga0n895_788316_c1
1052 nmdc:mga0n895_796036_c1
1053 nmdc:mga0rr50_47781_c1
1054 nmdc:mga08x19_460_c1
1055 nmdc:mga0a205_1121303_c1
1056 nmdc:mga0a205_340561_c1
1057 nmdc:mga0sz30_103078_c1
1058 Ga0500610_0237149
1059 Ga0500635_0133259
1060 Ga0500578_0238678
1061 Ga0500646_0406747
1062 Ga0500651_0377052
1063 Ga0500641_0068723
1064 Ga0500562_063444
1065 Ga0500642_0140600
1066 Ga0500655_058762
1067 Ga0500568_0017863
1068 Ga0500577_0101328
1069 Ga0500604_0092887
1070 Ga0501082_0750026
1071 Ga0530510_0228151
1072 Ga0530510_0532155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11746

DUF3303

Domain of unknown function (DUF3303)

17

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7202 1 78
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7111 1 78
2qmw-assembly1.cif.gz_B-2 the crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50 0.6629 2 74
4lub-assembly1.cif.gz_B x-ray structure of prephenate dehydratase from streptococcus mutans 0.6467 2 73
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6433 1 78
ID Description Score Start End Superfamily
af_P76092_330_583_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7281 31 53 3.40.50.150
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.6844 3 76 3.30.70.3090
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.672 32 54 3.40.430.10
af_F4K0K4_7_79_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.67 1 75 3.30.70.100
4waoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.6521 1 76 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A838DMF1-F1-model_v4 DUF3303 family protein 1.003 1 87
AF-A0A521H3A0-F1-model_v4 DUF3303 domain-containing protein 0.997 5 87
AF-A0A2V6U4X1-F1-model_v4 DUF3303 domain-containing protein 0.9967 1 85
AF-A0A7V8XRM9-F1-model_v4 DUF3303 family protein 0.9966 2 87
AF-A0A6A6I690-F1-model_v4 DUF3303 domain-containing protein 0.9949 1 86

Map