F460738
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 335 | 515 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10001272|JGI25153J46596_100012727 |
| Length | 113 |
| Sequence | MPLDTIRRLAKYDAMSKVFRALSDPTRRRVLQLLRHGPLSAGELSDQFDVSKPTMSAHFAVLKEADLVHAEKAGKSVIYHLKLSVLEEALLGFVHSFGVGEEVRAPRKKGIAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 6 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 9 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 10 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 11 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 12 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 13 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 14 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 15 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 16 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 17 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 18 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 19 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 20 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 21 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 22 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 215 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 216 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 220 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 221 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 222 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 288 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 298 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 300 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 306 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 309 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 312 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 316 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 317 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 318 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 324 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 325 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 326 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 329 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 334 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 335 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.44 |
| Nodule | 0 |
| Rhizoplane | 4.29 |
| Rhizosphere | 62.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2736812 | 2162886007 | Bacteria | 4611 |
| 2 | JGI24740J21852_10075146 | 3300001979 | Bacteria | 896 |
| 3 | JGI24739J22299_10001183 | 3300001989 | Bacteria | 9764 |
| 4 | JGI24743J22301_10118917 | 3300001991 | Bacteria | 578 |
| 5 | JGI24735J21928_10003038 | 3300002067 | Bacteria | 5758 |
| 6 | JGI24738J21930_10136936 | 3300002075 | Bacteria | 539 |
| 7 | JGI25164J39214_1003440 | 3300002772 | Bacteria | 2014 |
| 8 | JGI25152J39213_1002331 | 3300002773 | Bacteria | 7291 |
| 9 | JGI25150J39212_1004882 | 3300002774 | Bacteria | 2922 |
| 10 | JGI25153J46596_10001272 | 3300003215 | Bacteria | 15159 |
| 11 | JGI25153J46596_10006782 | 3300003215 | Bacteria | 5737 |
| 12 | JGI25153J46596_10036913 | 3300003215 | Bacteria | 1560 |
| 13 | rootH1_10182079 | 3300003316 | Bacteria | 1274 |
| 14 | rootH2_10079885 | 3300003320 | Bacteria | 4764 |
| 15 | rootL2_10276713 | 3300003322 | Bacteria | 1541 |
| 16 | rootH1_10027111 | 3300003323 | Bacteria | 9435 |
| 17 | rootH1_10338797 | 3300003323 | Bacteria | 1678 |
| 18 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 19 | Ga0055542_1011773 | 3300003762 | Bacteria | 1538 |
| 20 | Ga0055526_1003401 | 3300003771 | Bacteria | 10125 |
| 21 | Ga0055524_1023360 | 3300003775 | Bacteria | 1993 |
| 22 | Ga0055536_1002972 | 3300003781 | Bacteria | 9293 |
| 23 | Ga0055536_1060793 | 3300003781 | Bacteria | 783 |
| 24 | Ga0055528_1067848 | 3300003790 | Bacteria | 652 |
| 25 | Ga0055530_10000167 | 3300003791 | Bacteria | 59916 |
| 26 | Ga0055531_10000002 | 3300003794 | Bacteria | 421971 |
| 27 | Ga0055531_10000896 | 3300003794 | Bacteria | 24336 |
| 28 | Ga0055531_10112652 | 3300003794 | Bacteria | 541 |
| 29 | Ga0055543_1075536 | 3300004625 | Bacteria | 524 |
| 30 | Ga0065165_1001318 | 3300005262 | Bacteria | 27669 |
| 31 | Ga0065165_1038550 | 3300005262 | Bacteria | 1439 |
| 32 | Ga0065165_1138841 | 3300005262 | Bacteria | 576 |
| 33 | Ga0065165_1152313 | 3300005262 | Bacteria | 539 |
| 34 | Ga0065704_10071248 | 3300005289 | Bacteria | 12252 |
| 35 | Ga0065704_10352318 | 3300005289 | Bacteria | 808 |
| 36 | Ga0065715_10454941 | 3300005293 | Bacteria | 774 |
| 37 | Ga0070658_11507123 | 3300005327 | Unclassified | 583 |
| 38 | Ga0070676_10001392 | 3300005328 | Bacteria | 12200 |
| 39 | Ga0070676_10193869 | 3300005328 | Bacteria | 1328 |
| 40 | Ga0070690_100018230 | 3300005330 | Bacteria | 4236 |
| 41 | Ga0070670_100132960 | 3300005331 | Bacteria | 2149 |
| 42 | Ga0068869_100000033 | 3300005334 | Bacteria | 57379 |
| 43 | Ga0068869_100000585 | 3300005334 | Bacteria | 20482 |
| 44 | Ga0068869_100042537 | 3300005334 | Bacteria | 3257 |
| 45 | Ga0068868_100001180 | 3300005338 | Bacteria | 17892 |
| 46 | Ga0068868_101594966 | 3300005338 | Bacteria | 613 |
| 47 | Ga0070660_101037397 | 3300005339 | Bacteria | 693 |
| 48 | Ga0070687_100449152 | 3300005343 | Bacteria | 857 |
| 49 | Ga0070661_101878784 | 3300005344 | Bacteria | 509 |
| 50 | Ga0070668_100698212 | 3300005347 | Bacteria | 895 |
| 51 | Ga0070675_100022171 | 3300005354 | Bacteria | 5073 |
| 52 | Ga0070675_100180853 | 3300005354 | Bacteria | 1823 |
| 53 | Ga0070674_101756344 | 3300005356 | Bacteria | 562 |
| 54 | Ga0070673_100000001 | 3300005364 | Bacteria | 239842 |
| 55 | Ga0070673_100001138 | 3300005364 | Bacteria | 15291 |
| 56 | Ga0070673_100573264 | 3300005364 | Unclassified | 1027 |
| 57 | Ga0070673_101277086 | 3300005364 | Bacteria | 689 |
| 58 | Ga0070659_100003135 | 3300005366 | Bacteria | 11766 |
| 59 | Ga0070659_100191651 | 3300005366 | Bacteria | 1680 |
| 60 | Ga0070659_102149875 | 3300005366 | Bacteria | 502 |
| 61 | Ga0070667_100016302 | 3300005367 | Bacteria | 6146 |
| 62 | Ga0070663_100337894 | 3300005455 | Bacteria | 1216 |
| 63 | Ga0070663_101895823 | 3300005455 | Bacteria | 535 |
| 64 | Ga0070662_100000441 | 3300005457 | Bacteria | 24553 |
| 65 | Ga0068867_100006941 | 3300005459 | Bacteria | 8012 |
| 66 | Ga0068867_100007822 | 3300005459 | Bacteria | 7560 |
| 67 | Ga0068867_100024268 | 3300005459 | Bacteria | 4345 |
| 68 | Ga0068853_100015751 | 3300005539 | Bacteria | 6210 |
| 69 | Ga0068853_101643761 | 3300005539 | Bacteria | 622 |
| 70 | Ga0070672_100121273 | 3300005543 | Bacteria | 2140 |
| 71 | Ga0070693_100452927 | 3300005547 | Bacteria | 901 |
| 72 | Ga0070665_100010366 | 3300005548 | Bacteria | 9430 |
| 73 | Ga0070665_100597176 | 3300005548 | Bacteria | 1117 |
| 74 | Ga0068855_101272769 | 3300005563 | Bacteria | 762 |
| 75 | Ga0068857_100683552 | 3300005577 | Bacteria | 974 |
| 76 | Ga0068854_101186868 | 3300005578 | Bacteria | 683 |
| 77 | Ga0068854_101331747 | 3300005578 | Bacteria | 647 |
| 78 | Ga0068854_101437099 | 3300005578 | Bacteria | 624 |
| 79 | Ga0068854_101753741 | 3300005578 | Bacteria | 568 |
| 80 | Ga0068856_100396322 | 3300005614 | Bacteria | 1400 |
| 81 | Ga0068859_101078247 | 3300005617 | Bacteria | 883 |
| 82 | Ga0068864_101701361 | 3300005618 | Bacteria | 635 |
| 83 | Ga0068864_101706788 | 3300005618 | Bacteria | 634 |
| 84 | Ga0068866_10034076 | 3300005718 | Bacteria | 2477 |
| 85 | Ga0068861_101240571 | 3300005719 | Bacteria | 722 |
| 86 | Ga0068851_10014275 | 3300005834 | Bacteria | 3770 |
| 87 | Ga0068851_10396686 | 3300005834 | Bacteria | 811 |
| 88 | Ga0068870_10359823 | 3300005840 | Bacteria | 936 |
| 89 | Ga0068858_100002113 | 3300005842 | Bacteria | 20168 |
| 90 | Ga0068862_100480030 | 3300005844 | Bacteria | 1176 |
| 91 | Ga0081455_10655614 | 3300005937 | Bacteria | 675 |
| 92 | Ga0075368_10038279 | 3300006042 | Bacteria | 1877 |
| 93 | Ga0075363_100202401 | 3300006048 | Bacteria | 1135 |
| 94 | Ga0075363_100563853 | 3300006048 | Bacteria | 680 |
| 95 | Ga0075367_10000083 | 3300006178 | Bacteria | 25187 |
| 96 | Ga0075367_11045040 | 3300006178 | Bacteria | 522 |
| 97 | Ga0075366_10101612 | 3300006195 | Bacteria | 1725 |
| 98 | Ga0075366_10150500 | 3300006195 | Bacteria | 1409 |
| 99 | Ga0097621_101632394 | 3300006237 | Bacteria | 613 |
| 100 | Ga0075370_10070179 | 3300006353 | Bacteria | 2004 |
| 101 | Ga0068871_100146807 | 3300006358 | Bacteria | 2009 |
| 102 | Ga0068871_100911099 | 3300006358 | Bacteria | 815 |
| 103 | Ga0068865_100000078 | 3300006881 | Bacteria | 51512 |
| 104 | Ga0068865_100120598 | 3300006881 | Bacteria | 1949 |
| 105 | Ga0068865_100607367 | 3300006881 | Bacteria | 925 |
| 106 | Ga0097620_101078535 | 3300006931 | Bacteria | 883 |
| 107 | Ga0105240_10057515 | 3300009093 | Bacteria | 4858 |
| 108 | Ga0105240_10234423 | 3300009093 | Bacteria | 2131 |
| 109 | Ga0105240_10527867 | 3300009093 | Bacteria | 1309 |
| 110 | Ga0105245_10000529 | 3300009098 | Bacteria | 35001 |
| 111 | Ga0105245_10001532 | 3300009098 | Bacteria | 20946 |
| 112 | Ga0105245_13135511 | 3300009098 | Bacteria | 512 |
| 113 | Ga0105243_10004390 | 3300009148 | Bacteria | 11157 |
| 114 | Ga0105243_10057983 | 3300009148 | Bacteria | 3085 |
| 115 | Ga0105243_10123717 | 3300009148 | Bacteria | 2185 |
| 116 | Ga0105241_12329064 | 3300009174 | Bacteria | 533 |
| 117 | Ga0105242_10002194 | 3300009176 | Bacteria | 15417 |
| 118 | Ga0105242_10580279 | 3300009176 | Bacteria | 1080 |
| 119 | Ga0105242_11281774 | 3300009176 | Bacteria | 756 |
| 120 | Ga0105248_10001159 | 3300009177 | Bacteria | 29428 |
| 121 | Ga0105237_10489066 | 3300009545 | Bacteria | 1237 |
| 122 | Ga0105237_12042638 | 3300009545 | Bacteria | 582 |
| 123 | Ga0105238_10027548 | 3300009551 | Bacteria | 5792 |
| 124 | Ga0105238_10391830 | 3300009551 | Bacteria | 1381 |
| 125 | Ga0105238_10599187 | 3300009551 | Bacteria | 1110 |
| 126 | Ga0105249_10033345 | 3300009553 | Bacteria | 4662 |
| 127 | Ga0105249_13361060 | 3300009553 | Bacteria | 515 |
| 128 | Ga0105239_10030351 | 3300010375 | Bacteria | 5943 |
| 129 | Ga0105239_10223035 | 3300010375 | Bacteria | 2114 |
| 130 | Ga0105246_10000923 | 3300011119 | Bacteria | 16832 |
| 131 | Ga0105246_10008877 | 3300011119 | Bacteria | 6186 |
| 132 | Ga0157371_10002150 | 3300013102 | Bacteria | 19210 |
| 133 | Ga0157370_10000056 | 3300013104 | Bacteria | 118279 |
| 134 | Ga0157369_10003565 | 3300013105 | Bacteria | 18495 |
| 135 | Ga0157369_10047585 | 3300013105 | Bacteria | 4655 |
| 136 | Ga0157374_10009868 | 3300013296 | Bacteria | 8196 |
| 137 | Ga0157374_10147985 | 3300013296 | Bacteria | 2282 |
| 138 | Ga0157374_12381982 | 3300013296 | Bacteria | 557 |
| 139 | Ga0157378_10005832 | 3300013297 | Bacteria | 10797 |
| 140 | Ga0157378_10091580 | 3300013297 | Bacteria | 2765 |
| 141 | Ga0157378_12055049 | 3300013297 | Bacteria | 622 |
| 142 | Ga0163162_11252296 | 3300013306 | Bacteria | 842 |
| 143 | Ga0163162_12417299 | 3300013306 | Bacteria | 604 |
| 144 | Ga0157372_11537769 | 3300013307 | Bacteria | 766 |
| 145 | Ga0157375_10004502 | 3300013308 | Bacteria | 12116 |
| 146 | Ga0157375_12377419 | 3300013308 | Bacteria | 632 |
| 147 | Ga0157380_12951369 | 3300014326 | Bacteria | 542 |
| 148 | Ga0157377_10005234 | 3300014745 | Bacteria | 6073 |
| 149 | Ga0157376_10001712 | 3300014969 | Bacteria | 14592 |
| 150 | Ga0157376_12887462 | 3300014969 | Bacteria | 520 |
| 151 | Ga0163161_10715897 | 3300017792 | Bacteria | 835 |
| 152 | Ga0213872_10000172 | 3300021361 | Bacteria | 58334 |
| 153 | Ga0213872_10013414 | 3300021361 | Bacteria | 3839 |
| 154 | Ga0209674_109371 | 3300025226 | Bacteria | 1094 |
| 155 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 156 | Ga0207427_100931 | 3300025231 | Bacteria | 12483 |
| 157 | Ga0207425_1000131 | 3300025245 | Bacteria | 68511 |
| 158 | Ga0207425_1056314 | 3300025245 | Bacteria | 704 |
| 159 | Ga0209026_1011815 | 3300025250 | Bacteria | 1549 |
| 160 | Ga0209148_1000332 | 3300025254 | Bacteria | 64492 |
| 161 | Ga0209148_1022003 | 3300025254 | Bacteria | 1029 |
| 162 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 163 | Ga0209129_1008618 | 3300025258 | Bacteria | 2812 |
| 164 | Ga0209565_1000332 | 3300025263 | Bacteria | 42136 |
| 165 | Ga0209673_1000523 | 3300025273 | Bacteria | 62816 |
| 166 | Ga0209673_1033257 | 3300025273 | Bacteria | 1576 |
| 167 | Ga0207673_1005779 | 3300025290 | Bacteria | 1517 |
| 168 | Ga0209675_1015162 | 3300025291 | Bacteria | 2305 |
| 169 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 170 | Ga0209676_1005342 | 3300025292 | Bacteria | 6761 |
| 171 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 172 | Ga0209564_1026721 | 3300025295 | Bacteria | 1897 |
| 173 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 174 | Ga0209758_1000287 | 3300025297 | Bacteria | 99234 |
| 175 | Ga0209758_1016468 | 3300025297 | Bacteria | 3752 |
| 176 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 177 | Ga0209050_1003202 | 3300025298 | Bacteria | 12395 |
| 178 | Ga0209256_1003899 | 3300025299 | Bacteria | 9870 |
| 179 | Ga0209256_1005097 | 3300025299 | Bacteria | 7798 |
| 180 | Ga0209256_1007063 | 3300025299 | Bacteria | 5682 |
| 181 | Ga0209256_1032603 | 3300025299 | Bacteria | 1411 |
| 182 | Ga0209051_1050566 | 3300025303 | Bacteria | 1391 |
| 183 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 184 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 185 | Ga0209257_1015881 | 3300025304 | Bacteria | 3091 |
| 186 | Ga0209257_1085851 | 3300025304 | Bacteria | 797 |
| 187 | Ga0207656_10005766 | 3300025321 | Bacteria | 4406 |
| 188 | Ga0207688_10619541 | 3300025901 | Bacteria | 683 |
| 189 | Ga0207647_10476709 | 3300025904 | Bacteria | 697 |
| 190 | Ga0207645_10001428 | 3300025907 | Bacteria | 19558 |
| 191 | Ga0207645_10292979 | 3300025907 | Bacteria | 1082 |
| 192 | Ga0207643_10341411 | 3300025908 | Bacteria | 939 |
| 193 | Ga0207643_10528321 | 3300025908 | Bacteria | 756 |
| 194 | Ga0207654_10582487 | 3300025911 | Bacteria | 797 |
| 195 | Ga0207695_10057651 | 3300025913 | Bacteria | 4034 |
| 196 | Ga0207695_10067305 | 3300025913 | Bacteria | 3674 |
| 197 | Ga0207671_10644109 | 3300025914 | Bacteria | 844 |
| 198 | Ga0207662_10047693 | 3300025918 | Bacteria | 2537 |
| 199 | Ga0207657_10839498 | 3300025919 | Bacteria | 709 |
| 200 | Ga0207649_10099226 | 3300025920 | Bacteria | 1923 |
| 201 | Ga0207681_10356034 | 3300025923 | Bacteria | 1173 |
| 202 | Ga0207694_10333006 | 3300025924 | Bacteria | 1254 |
| 203 | Ga0207694_10831463 | 3300025924 | Bacteria | 780 |
| 204 | Ga0207650_10357359 | 3300025925 | Bacteria | 1203 |
| 205 | Ga0207659_10842996 | 3300025926 | Bacteria | 788 |
| 206 | Ga0207687_10000580 | 3300025927 | Bacteria | 24742 |
| 207 | Ga0207687_10009324 | 3300025927 | Bacteria | 6420 |
| 208 | Ga0207687_11842274 | 3300025927 | Bacteria | 517 |
| 209 | Ga0207690_10080528 | 3300025932 | Bacteria | 2273 |
| 210 | Ga0207686_10022514 | 3300025934 | Bacteria | 3630 |
| 211 | Ga0207709_10001739 | 3300025935 | Bacteria | 14660 |
| 212 | Ga0207709_10033031 | 3300025935 | Bacteria | 3034 |
| 213 | Ga0207709_10102499 | 3300025935 | Bacteria | 1895 |
| 214 | Ga0207709_11430758 | 3300025935 | Bacteria | 573 |
| 215 | Ga0207704_10000090 | 3300025938 | Bacteria | 53065 |
| 216 | Ga0207704_10105724 | 3300025938 | Bacteria | 1889 |
| 217 | Ga0207691_10064421 | 3300025940 | Bacteria | 3321 |
| 218 | Ga0207691_10147694 | 3300025940 | Bacteria | 2068 |
| 219 | Ga0207689_10006914 | 3300025942 | Bacteria | 9978 |
| 220 | Ga0207689_10043592 | 3300025942 | Bacteria | 3709 |
| 221 | Ga0207689_11250952 | 3300025942 | Bacteria | 624 |
| 222 | Ga0207667_10251618 | 3300025949 | Bacteria | 1807 |
| 223 | Ga0207667_10428206 | 3300025949 | Bacteria | 1346 |
| 224 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 225 | Ga0207651_11284819 | 3300025960 | Bacteria | 658 |
| 226 | Ga0207712_10019779 | 3300025961 | Bacteria | 4400 |
| 227 | Ga0207668_11389680 | 3300025972 | Bacteria | 633 |
| 228 | Ga0207640_11679082 | 3300025981 | Bacteria | 573 |
| 229 | Ga0207640_12008003 | 3300025981 | Bacteria | 524 |
| 230 | Ga0207658_10678286 | 3300025986 | Bacteria | 930 |
| 231 | Ga0207677_10000016 | 3300026023 | Bacteria | 153771 |
| 232 | Ga0207703_10001637 | 3300026035 | Bacteria | 20186 |
| 233 | Ga0207639_10050398 | 3300026041 | Bacteria | 3162 |
| 234 | Ga0207639_10254507 | 3300026041 | Bacteria | 1533 |
| 235 | Ga0207678_10335663 | 3300026067 | Bacteria | 1302 |
| 236 | Ga0207678_11112074 | 3300026067 | Bacteria | 700 |
| 237 | Ga0207702_10336571 | 3300026078 | Bacteria | 1441 |
| 238 | Ga0207702_11583182 | 3300026078 | Bacteria | 648 |
| 239 | Ga0207648_10005425 | 3300026089 | Bacteria | 12850 |
| 240 | Ga0207648_10008458 | 3300026089 | Bacteria | 9962 |
| 241 | Ga0207676_11910516 | 3300026095 | Bacteria | 592 |
| 242 | Ga0207674_10886641 | 3300026116 | Bacteria | 860 |
| 243 | Ga0207683_10467799 | 3300026121 | Bacteria | 1163 |
| 244 | Ga0209813_10000043 | 3300027866 | Bacteria | 51426 |
| 245 | Ga0209974_10365157 | 3300027876 | Bacteria | 562 |
| 246 | Ga0209974_10402231 | 3300027876 | Bacteria | 538 |
| 247 | Ga0268266_10005532 | 3300028379 | Bacteria | 11761 |
| 248 | Ga0268266_12074212 | 3300028379 | Bacteria | 542 |
| 249 | Ga0307517_10019346 | 3300028786 | Bacteria | 8744 |
| 250 | Ga0307515_10053013 | 3300028794 | Bacteria | 5998 |
| 251 | Ga0307515_10113322 | 3300028794 | Bacteria | 3145 |
| 252 | Ga0307515_10284843 | 3300028794 | Bacteria | 1355 |
| 253 | Ga0265338_10048741 | 3300028800 | Bacteria | 3850 |
| 254 | Ga0265338_10140397 | 3300028800 | Bacteria | 1893 |
| 255 | Ga0316182_1131368 | 3300030745 | Bacteria | 870 |
| 256 | Ga0265327_10000290 | 3300031251 | Bacteria | 98475 |
| 257 | Ga0265327_10000702 | 3300031251 | Bacteria | 53097 |
| 258 | Ga0307513_10147629 | 3300031456 | Bacteria | 2267 |
| 259 | Ga0307513_10636155 | 3300031456 | Bacteria | 774 |
| 260 | Ga0265314_10003206 | 3300031711 | Bacteria | 16012 |
| 261 | Ga0265342_10618058 | 3300031712 | Bacteria | 546 |
| 262 | Ga0307405_11749400 | 3300031731 | Bacteria | 552 |
| 263 | Ga0307413_10121332 | 3300031824 | Bacteria | 1771 |
| 264 | Ga0307413_10220281 | 3300031824 | Bacteria | 1386 |
| 265 | Ga0307413_10396785 | 3300031824 | Bacteria | 1080 |
| 266 | Ga0307413_11083508 | 3300031824 | Bacteria | 691 |
| 267 | Ga0307410_10045490 | 3300031852 | Bacteria | 2923 |
| 268 | Ga0307410_10143015 | 3300031852 | Bacteria | 1772 |
| 269 | Ga0307406_10989903 | 3300031901 | Bacteria | 721 |
| 270 | Ga0307407_10600143 | 3300031903 | Bacteria | 820 |
| 271 | Ga0307412_12060284 | 3300031911 | Bacteria | 529 |
| 272 | Ga0307409_100038700 | 3300031995 | Bacteria | 3530 |
| 273 | Ga0307409_100293277 | 3300031995 | Bacteria | 1509 |
| 274 | Ga0307416_103866628 | 3300032002 | Bacteria | 501 |
| 275 | Ga0307414_10010314 | 3300032004 | Bacteria | 5413 |
| 276 | Ga0307414_10052971 | 3300032004 | Bacteria | 2827 |
| 277 | Ga0307414_10085765 | 3300032004 | Bacteria | 2321 |
| 278 | Ga0307414_10116115 | 3300032004 | Bacteria | 2048 |
| 279 | Ga0307414_10357257 | 3300032004 | Bacteria | 1256 |
| 280 | Ga0307414_10399930 | 3300032004 | Bacteria | 1193 |
| 281 | Ga0307414_10547886 | 3300032004 | Bacteria | 1030 |
| 282 | Ga0307414_10767849 | 3300032004 | Bacteria | 877 |
| 283 | Ga0307414_10910841 | 3300032004 | Bacteria | 806 |
| 284 | Ga0307414_11554518 | 3300032004 | Bacteria | 616 |
| 285 | Ga0307411_10073937 | 3300032005 | Bacteria | 2320 |
| 286 | Ga0307411_10100595 | 3300032005 | Bacteria | 2043 |
| 287 | Ga0307411_10130612 | 3300032005 | Bacteria | 1835 |
| 288 | Ga0307510_10059467 | 3300033180 | Bacteria | 3946 |
| 289 | Ga0373937_1100562 | 3300036401 | Bacteria | 743 |
| 290 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 291 | Ga0395899_0000396 | 3300037312 | Bacteria | 51696 |
| 292 | Ga0395899_0064555 | 3300037312 | Unclassified | 2692 |
| 293 | Ga0395900_0022028 | 3300037418 | Bacteria | 6517 |
| 294 | Ga0395900_0107277 | 3300037418 | Unclassified | 2869 |
| 295 | Ga0395900_1556749 | 3300037418 | Bacteria | 573 |
| 296 | Ga0395898_0418021 | 3300037466 | Unclassified | 1278 |
| 297 | Ga0395905_0023541 | 3300037471 | Bacteria | 5819 |
| 298 | Ga0395905_0046113 | 3300037471 | Unclassified | 4087 |
| 299 | Ga0395905_0170727 | 3300037471 | Bacteria | 2043 |
| 300 | Ga0395905_0242517 | 3300037471 | Bacteria | 1684 |
| 301 | Ga0395905_0284048 | 3300037471 | Bacteria | 1541 |
| 302 | Ga0395905_1695993 | 3300037471 | Bacteria | 537 |
| 303 | Ga0436364_0060956 | 3300037853 | Bacteria | 741 |
| 304 | Ga0436364_1262744 | 3300037853 | Bacteria | 898 |
| 305 | Ga0436364_1361719 | 3300037853 | Bacteria | 573 |
| 306 | Ga0395901_0104646 | 3300038443 | Unclassified | 2970 |
| 307 | Ga0436360_0958655 | 3300039438 | Bacteria | 1126 |
| 308 | Ga0436361_0046862 | 3300039447 | Bacteria | 14392 |
| 309 | Ga0436361_0167979 | 3300039447 | Bacteria | 86419 |
| 310 | Ga0436361_0375780 | 3300039447 | Bacteria | 2453 |
| 311 | Ga0436361_0801110 | 3300039447 | Bacteria | 8625 |
| 312 | Ga0436361_1065063 | 3300039447 | Bacteria | 1824 |
| 313 | Ga0439461_0000039 | 3300041410 | Bacteria | 16229 |
| 314 | Ga0439465_0000942 | 3300041413 | Bacteria | 9220 |
| 315 | Ga0439465_0080580 | 3300041413 | Bacteria | 1103 |
| 316 | Ga0451787_822558 | 3300041441 | Bacteria | 669 |
| 317 | Ga0451789_0139606 | 3300041443 | Bacteria | 767 |
| 318 | Ga0451789_0925911 | 3300041443 | Bacteria | 980 |
| 319 | Ga0451791_1437851 | 3300041451 | Bacteria | 873 |
| 320 | Ga0451793_0951445 | 3300041452 | Bacteria | 1200 |
| 321 | Ga0451797_1017601 | 3300041453 | Bacteria | 804 |
| 322 | Ga0451795_1411656 | 3300041456 | Bacteria | 2045 |
| 323 | Ga0451798_0809346 | 3300041458 | Bacteria | 823 |
| 324 | Ga0451800_1237296 | 3300041459 | Bacteria | 3056 |
| 325 | Ga0451804_0035446 | 3300041463 | Bacteria | 4630 |
| 326 | Ga0451804_0086716 | 3300041463 | Bacteria | 594 |
| 327 | Ga0451807_0828075 | 3300041486 | Bacteria | 507 |
| 328 | Ga0451807_1637974 | 3300041486 | Bacteria | 844 |
| 329 | Ga0451837_0051540 | 3300041494 | Bacteria | 1536 |
| 330 | Ga0451837_1068148 | 3300041494 | Bacteria | 1287 |
| 331 | Ga0451851_0076720 | 3300041507 | Bacteria | 831 |
| 332 | Ga0451843_0000599 | 3300041509 | Bacteria | 1522 |
| 333 | Ga0451843_1174303 | 3300041509 | Bacteria | 514 |
| 334 | Ga0451853_0513266 | 3300041512 | Bacteria | 647 |
| 335 | Ga0451853_1089291 | 3300041512 | Bacteria | 1130 |
| 336 | Ga0439431_0000534 | 3300041997 | Bacteria | 8052 |
| 337 | Ga0439442_002952 | 3300042002 | Bacteria | 3353 |
| 338 | Ga0439445_0000291 | 3300042004 | Bacteria | 9728 |
| 339 | Ga0439448_0023672 | 3300042005 | Bacteria | 1918 |
| 340 | Ga0439432_000049 | 3300042006 | Bacteria | 36738 |
| 341 | Ga0439449_0065406 | 3300042007 | Bacteria | 1341 |
| 342 | Ga0439462_0000923 | 3300042015 | Bacteria | 6220 |
| 343 | Ga0466969_0001050 | 3300044656 | Bacteria | 14907 |
| 344 | Ga0466966_0000221 | 3300044684 | Bacteria | 38296 |
| 345 | Ga0466961_0000899 | 3300044693 | Bacteria | 18467 |
| 346 | Ga0466971_0000345 | 3300044719 | Bacteria | 17795 |
| 347 | Ga0466970_0013168 | 3300044765 | Bacteria | 4238 |
| 348 | Ga0466957_0002771 | 3300044842 | Bacteria | 9481 |
| 349 | Ga0466959_0000451 | 3300045049 | Bacteria | 23920 |
| 350 | Ga0451576_1008262 | 3300045051 | Bacteria | 873 |
| 351 | Ga0466967_1079561 | 3300045976 | Bacteria | 800 |
| 352 | Ga0495590_0003562 | 3300046457 | Bacteria | 6340 |
| 353 | Ga0495629_0291535 | 3300046459 | Bacteria | 1118 |
| 354 | Ga0495638_0000478 | 3300046460 | Bacteria | 47960 |
| 355 | Ga0495638_0000500 | 3300046460 | Bacteria | 46497 |
| 356 | Ga0495638_0001983 | 3300046460 | Bacteria | 17473 |
| 357 | Ga0495638_0156316 | 3300046460 | Bacteria | 1319 |
| 358 | Ga0495638_0406245 | 3300046460 | Bacteria | 705 |
| 359 | Ga0495650_0000068 | 3300046471 | Bacteria | 266671 |
| 360 | Ga0495650_0000196 | 3300046471 | Bacteria | 131306 |
| 361 | Ga0495650_0010372 | 3300046471 | Bacteria | 5203 |
| 362 | Ga0495650_0106021 | 3300046471 | Bacteria | 1049 |
| 363 | Ga0495583_0000122 | 3300046506 | Bacteria | 132255 |
| 364 | Ga0495606_0093367 | 3300046507 | Bacteria | 1846 |
| 365 | Ga0495610_0000534 | 3300046512 | Bacteria | 38300 |
| 366 | Ga0495610_0009932 | 3300046512 | Bacteria | 5954 |
| 367 | Ga0495610_0386521 | 3300046512 | Bacteria | 519 |
| 368 | Ga0495616_0064198 | 3300046513 | Bacteria | 1792 |
| 369 | Ga0495616_0099401 | 3300046513 | Bacteria | 1366 |
| 370 | Ga0495616_0404895 | 3300046513 | Bacteria | 560 |
| 371 | Ga0495628_0877590 | 3300046516 | Bacteria | 624 |
| 372 | Ga0495631_0016339 | 3300046518 | Bacteria | 3541 |
| 373 | Ga0495632_0093217 | 3300046519 | Bacteria | 1425 |
| 374 | Ga0495632_0212570 | 3300046519 | Bacteria | 877 |
| 375 | Ga0495637_0084203 | 3300046520 | Bacteria | 1263 |
| 376 | Ga0495637_0241355 | 3300046520 | Bacteria | 652 |
| 377 | Ga0495643_0225919 | 3300046522 | Bacteria | 885 |
| 378 | Ga0495644_0121441 | 3300046523 | Bacteria | 994 |
| 379 | Ga0495648_0000389 | 3300046524 | Bacteria | 48263 |
| 380 | Ga0495648_0023826 | 3300046524 | Bacteria | 4181 |
| 381 | Ga0495648_0179807 | 3300046524 | Bacteria | 1076 |
| 382 | Ga0495663_0026945 | 3300046525 | Bacteria | 1684 |
| 383 | Ga0495663_0171104 | 3300046525 | Bacteria | 749 |
| 384 | Ga0495666_0355129 | 3300046526 | Bacteria | 660 |
| 385 | Ga0495654_0000051 | 3300046530 | Bacteria | 145932 |
| 386 | Ga0495654_0098467 | 3300046530 | Bacteria | 1349 |
| 387 | Ga0495587_0013979 | 3300046536 | Bacteria | 5039 |
| 388 | Ga0495622_0002767 | 3300046557 | Bacteria | 8383 |
| 389 | Ga0495633_0032350 | 3300046558 | Bacteria | 2528 |
| 390 | Ga0495668_0006012 | 3300046616 | Bacteria | 8053 |
| 391 | Ga0495668_0037735 | 3300046616 | Bacteria | 2703 |
| 392 | Ga0495625_0000876 | 3300046660 | Bacteria | 40885 |
| 393 | Ga0495625_0002001 | 3300046660 | Bacteria | 22996 |
| 394 | Ga0495625_0002592 | 3300046660 | Bacteria | 19355 |
| 395 | Ga0495625_0007475 | 3300046660 | Bacteria | 9500 |
| 396 | Ga0495625_0023099 | 3300046660 | Bacteria | 4755 |
| 397 | Ga0495625_0028435 | 3300046660 | Bacteria | 4192 |
| 398 | Ga0495625_0037594 | 3300046660 | Bacteria | 3550 |
| 399 | Ga0495661_0095747 | 3300046665 | Bacteria | 1680 |
| 400 | Ga0495658_0775569 | 3300046683 | Bacteria | 614 |
| 401 | Ga0495670_0000033 | 3300046691 | Bacteria | 81716 |
| 402 | Ga0495670_0143723 | 3300046691 | Bacteria | 1249 |
| 403 | Ga0495649_0387705 | 3300046694 | Bacteria | 702 |
| 404 | Ga0495600_0042379 | 3300046809 | Bacteria | 2967 |
| 405 | Ga0495604_0902912 | 3300047317 | Bacteria | 552 |
| 406 | Ga0495636_0233253 | 3300047318 | Bacteria | 847 |
| 407 | Ga0495683_0143548 | 3300047323 | Bacteria | 1117 |
| 408 | Ga0495679_009923 | 3300047446 | Bacteria | 3776 |
| 409 | Ga0495673_0000420 | 3300047469 | Bacteria | 48299 |
| 410 | Ga0495673_0016299 | 3300047469 | Bacteria | 3802 |
| 411 | Ga0495681_0136649 | 3300047470 | Bacteria | 1039 |
| 412 | Ga0495681_0150112 | 3300047470 | Bacteria | 978 |
| 413 | Ga0495681_0209914 | 3300047470 | Bacteria | 785 |
| 414 | Ga0495686_0000164 | 3300047472 | Bacteria | 126101 |
| 415 | Ga0495686_0009474 | 3300047472 | Bacteria | 7010 |
| 416 | Ga0495686_0038556 | 3300047472 | Bacteria | 3055 |
| 417 | Ga0495615_0049315 | 3300048090 | Bacteria | 1079 |
| 418 | Ga0496102_0916790 | 3300048905 | Bacteria | 798 |
| 419 | Ga0496105_0866277 | 3300048908 | Bacteria | 683 |
| 420 | Ga0496106_0974155 | 3300048909 | Bacteria | 668 |
| 421 | Ga0496107_0621367 | 3300048910 | Bacteria | 798 |
| 422 | Ga0496108_1603106 | 3300048911 | Bacteria | 539 |
| 423 | Ga0496109_0831055 | 3300048912 | Bacteria | 862 |
| 424 | Ga0496114_0106473 | 3300048917 | Bacteria | 2399 |
| 425 | Ga0496114_1384996 | 3300048917 | Bacteria | 591 |
| 426 | Ga0496115_0004250 | 3300048918 | Bacteria | 10357 |
| 427 | Ga0496115_0006370 | 3300048918 | Bacteria | 8647 |
| 428 | Ga0496117_0343017 | 3300048920 | Bacteria | 774 |
| 429 | Ga0496118_0009455 | 3300048921 | Bacteria | 9842 |
| 430 | Ga0496120_0135823 | 3300048923 | Bacteria | 1254 |
| 431 | Ga0496122_0003882 | 3300048925 | Bacteria | 19164 |
| 432 | Ga0496123_0004295 | 3300048926 | Bacteria | 15142 |
| 433 | Ga0496126_0022494 | 3300048929 | Bacteria | 6134 |
| 434 | Ga0496126_0241664 | 3300048929 | Bacteria | 1508 |
| 435 | Ga0496126_0373697 | 3300048929 | Bacteria | 1162 |
| 436 | Ga0496126_0653427 | 3300048929 | Bacteria | 822 |
| 437 | Ga0496126_0866690 | 3300048929 | Bacteria | 687 |
| 438 | Ga0495678_006172 | 3300049459 | Bacteria | 6423 |
| 439 | Ga0501033_0564832 | 3300049570 | Bacteria | 783 |
| 440 | Ga0501034_1370757 | 3300049571 | Bacteria | 583 |
| 441 | Ga0501238_001405 | 3300049671 | Bacteria | 2792 |
| 442 | Ga0501241_014161 | 3300049758 | Bacteria | 1449 |
| 443 | Ga0501241_051977 | 3300049758 | Bacteria | 811 |
| 444 | Ga0501035_0246319 | 3300049822 | Bacteria | 1519 |
| 445 | nmdc:mga03n38_26584_c1 | 3300050490 | Bacteria | 2391 |
| 446 | nmdc:mga0k408_567105_c1 | 3300050493 | Bacteria | 670 |
| 447 | nmdc:mga0k408_93449_c1 | 3300050493 | Bacteria | 1768 |
| 448 | nmdc:mga06z11_56_c1 | 3300050494 | Bacteria | 48168 |
| 449 | nmdc:mga06z11_667900_c1 | 3300050494 | Bacteria | 633 |
| 450 | nmdc:mga04h51_99_c1 | 3300050495 | Bacteria | 26211 |
| 451 | nmdc:mga07m45_125786_c1 | 3300050496 | Bacteria | 1482 |
| 452 | nmdc:mga0rr50_1099666_c1 | 3300050513 | Bacteria | 676 |
| 453 | Ga0500578_0009669 | 3300053086 | Bacteria | 6259 |
| 454 | Ga0500643_002645 | 3300053087 | Bacteria | 9052 |
| 455 | Ga0500643_026043 | 3300053087 | Bacteria | 1836 |
| 456 | Ga0500643_033461 | 3300053087 | Bacteria | 1554 |
| 457 | Ga0500643_095655 | 3300053087 | Bacteria | 808 |
| 458 | Ga0500644_0000046 | 3300053088 | Bacteria | 73850 |
| 459 | Ga0500644_0014985 | 3300053088 | Bacteria | 2199 |
| 460 | Ga0500644_0100689 | 3300053088 | Bacteria | 1097 |
| 461 | Ga0500646_0000881 | 3300053090 | Bacteria | 8275 |
| 462 | Ga0500646_0207621 | 3300053090 | Bacteria | 675 |
| 463 | Ga0500646_0283928 | 3300053090 | Bacteria | 590 |
| 464 | Ga0500583_0042065 | 3300053092 | Bacteria | 2080 |
| 465 | Ga0500651_0036779 | 3300053093 | Bacteria | 3084 |
| 466 | Ga0500651_0372704 | 3300053093 | Bacteria | 806 |
| 467 | Ga0500566_0164461 | 3300053094 | Bacteria | 1153 |
| 468 | Ga0500641_0104220 | 3300053096 | Bacteria | 1218 |
| 469 | Ga0500650_0005141 | 3300053098 | Bacteria | 4834 |
| 470 | Ga0500554_004877 | 3300053102 | Bacteria | 2883 |
| 471 | Ga0500555_105332 | 3300053103 | Bacteria | 713 |
| 472 | Ga0500556_0002085 | 3300053104 | Bacteria | 6875 |
| 473 | Ga0500556_0339619 | 3300053104 | Bacteria | 583 |
| 474 | Ga0500562_006292 | 3300053108 | Bacteria | 2995 |
| 475 | Ga0500594_0000812 | 3300053118 | Bacteria | 6668 |
| 476 | Ga0500595_001959 | 3300053119 | Bacteria | 10581 |
| 477 | Ga0500607_080950 | 3300053121 | Bacteria | 1656 |
| 478 | Ga0500614_008918 | 3300053123 | Bacteria | 2133 |
| 479 | Ga0500618_000064 | 3300053125 | Bacteria | 91120 |
| 480 | Ga0500623_142026 | 3300053127 | Bacteria | 1006 |
| 481 | Ga0500628_000584 | 3300053129 | Bacteria | 6666 |
| 482 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 483 | Ga0500642_0001707 | 3300053130 | Bacteria | 6334 |
| 484 | Ga0500652_000108 | 3300053131 | Bacteria | 32608 |
| 485 | Ga0500652_290617 | 3300053131 | Bacteria | 635 |
| 486 | Ga0500655_021563 | 3300053133 | Bacteria | 1208 |
| 487 | Ga0500655_049691 | 3300053133 | Bacteria | 834 |
| 488 | Ga0500658_0007011 | 3300053134 | Bacteria | 4169 |
| 489 | Ga0500658_0288133 | 3300053134 | Bacteria | 755 |
| 490 | Ga0500559_0008081 | 3300053136 | Bacteria | 4629 |
| 491 | Ga0500559_0062639 | 3300053136 | Bacteria | 1661 |
| 492 | Ga0500559_0172435 | 3300053136 | Bacteria | 1017 |
| 493 | Ga0500564_000125 | 3300053138 | Bacteria | 19515 |
| 494 | Ga0500568_0004910 | 3300053139 | Bacteria | 7040 |
| 495 | Ga0500573_0041383 | 3300053140 | Bacteria | 2660 |
| 496 | Ga0500579_132331 | 3300053143 | Bacteria | 1161 |
| 497 | Ga0500589_257988 | 3300053147 | Bacteria | 636 |
| 498 | Ga0500589_332379 | 3300053147 | Bacteria | 527 |
| 499 | Ga0500604_0000062 | 3300053151 | Bacteria | 39474 |
| 500 | Ga0500604_0001250 | 3300053151 | Bacteria | 7088 |
| 501 | Ga0500616_0000087 | 3300053153 | Bacteria | 192225 |
| 502 | Ga0500622_0000682 | 3300053156 | Bacteria | 30044 |
| 503 | Ga0500622_0001458 | 3300053156 | Bacteria | 18891 |
| 504 | Ga0500622_0029990 | 3300053156 | Bacteria | 2857 |
| 505 | Ga0500622_0160965 | 3300053156 | Bacteria | 1052 |
| 506 | Ga0500627_0155497 | 3300053158 | Bacteria | 1032 |
| 507 | Ga0500627_0171786 | 3300053158 | Bacteria | 976 |
| 508 | Ga0500584_085249 | 3300053726 | Bacteria | 1341 |
| 509 | Ga0500645_000064 | 3300053730 | Bacteria | 84824 |
| 510 | Ga0500645_003167 | 3300053730 | Bacteria | 6836 |
| 511 | Ga0500645_135043 | 3300053730 | Bacteria | 684 |
| 512 | Ga0500596_000155 | 3300053735 | Bacteria | 10552 |
| 513 | Ga0500587_000479 | 3300053739 | Bacteria | 4790 |
| 514 | Ga0500661_043802 | 3300055283 | Bacteria | 794 |
| 515 | Ga0466962_0082210 | 3300061719 | Bacteria | 1540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046471 | Ga0495650_0000068 | Ga0495650_0000068_151594_151902 | 90 |
| 2 | 3300046513 | Ga0495616_0404895 | Ga0495616_0404895_86_394 | 90 |
| 3 | 3300046524 | Ga0495648_0023826 | Ga0495648_0023826_1510_1818 | 90 |
| 4 | 3300046525 | Ga0495663_0026945 | Ga0495663_0026945_1185_1493 | 90 |
| 5 | 3300046530 | Ga0495654_0000051 | Ga0495654_0000051_30838_31146 | 90 |
| 6 | 3300046660 | Ga0495625_0037594 | Ga0495625_0037594_2596_2904 | 90 |
| 7 | 3300047470 | Ga0495681_0150112 | Ga0495681_0150112_268_576 | 90 |
| 8 | 3300053158 | Ga0500627_0155497 | Ga0500627_0155497_283_591 | 90 |
| 9 | 3300005328 | Ga0070676_10193869 | Ga0070676_101938692 | 91 |
| 10 | 3300005347 | Ga0070668_100698212 | Ga0070668_1006982122 | 91 |
| 11 | 3300005455 | Ga0070663_100337894 | Ga0070663_1003378942 | 91 |
| 12 | 3300005459 | Ga0068867_100024268 | Ga0068867_1000242687 | 91 |
| 13 | 3300005548 | Ga0070665_100597176 | Ga0070665_1005971762 | 91 |
| 14 | 3300005834 | Ga0068851_10014275 | Ga0068851_100142752 | 91 |
| 15 | 3300025321 | Ga0207656_10005766 | Ga0207656_100057664 | 91 |
| 16 | 3300025907 | Ga0207645_10292979 | Ga0207645_102929791 | 91 |
| 17 | 3300026041 | Ga0207639_10254507 | Ga0207639_102545074 | 91 |
| 18 | 3300026067 | Ga0207678_10335663 | Ga0207678_103356632 | 91 |
| 19 | 3300026089 | Ga0207648_10008458 | Ga0207648_100084587 | 91 |
| 20 | 3300005578 | Ga0068854_101331747 | Ga0068854_1013317472 | 92 |
| 21 | 3300025940 | Ga0207691_10064421 | Ga0207691_100644215 | 92 |
| 22 | 3300025972 | Ga0207668_11389680 | Ga0207668_113896802 | 92 |
| 23 | 3300027876 | Ga0209974_10365157 | Ga0209974_103651571 | 92 |
| 24 | iso_pu_bacteria | 2585428058 | 2587736255 | 93 |
| 25 | 3300031901 | Ga0307406_10989903 | Ga0307406_109899032 | 94 |
| 26 | 3300031911 | Ga0307412_12060284 | Ga0307412_120602841 | 94 |
| 27 | 3300032002 | Ga0307416_103866628 | Ga0307416_1038666281 | 94 |
| 28 | 3300045976 | Ga0466967_1079561 | Ga0466967_1079561_303_596 | 94 |
| 29 | iso_pu_bacteria | 2512564014 | 2512641822 | 94 |
| 30 | iso_pu_bacteria | 2582581279 | 2585147828 | 94 |
| 31 | iso_pu_bacteria | 2643221579 | 2643907963 | 94 |
| 32 | iso_pu_bacteria | 2643221581 | 2643915831 | 94 |
| 33 | iso_pu_bacteria | 2643221585 | 2643936094 | 94 |
| 34 | iso_pu_bacteria | 2643221625 | 2644141390 | 94 |
| 35 | iso_pu_bacteria | 2643221629 | 2644165598 | 94 |
| 36 | iso_pu_bacteria | 2643221639 | 2644221858 | 94 |
| 37 | iso_pu_bacteria | 2643221646 | 2644257349 | 94 |
| 38 | iso_pu_bacteria | 2643221648 | 2644274302 | 94 |
| 39 | iso_pu_bacteria | 2643221656 | 2644316739 | 94 |
| 40 | iso_pu_bacteria | 2643221662 | 2644348518 | 94 |
| 41 | iso_pu_bacteria | 2738541337 | 2739053408 | 94 |
| 42 | iso_pu_bacteria | 2791355048 | 2792460189 | 94 |
| 43 | iso_pu_bacteria | 2843744320 | 2843746758 | 94 |
| 44 | iso_pu_bacteria | 2849560528 | 2849562841 | 94 |
| 45 | iso_pu_bacteria | 2849573788 | 2849576732 | 94 |
| 46 | iso_pu_bacteria | 2851153111 | 2851154041 | 94 |
| 47 | iso_pu_bacteria | 2894414249 | 2894417806 | 94 |
| 48 | iso_pu_bacteria | 2898329390 | 2898333348 | 94 |
| 49 | 3300005327 | Ga0070658_11507123 | Ga0070658_115071231 | 95 |
| 50 | 3300005364 | Ga0070673_100573264 | Ga0070673_1005732643 | 95 |
| 51 | 3300013308 | Ga0157375_12377419 | Ga0157375_123774192 | 95 |
| 52 | 3300025250 | Ga0209026_1011815 | Ga0209026_10118152 | 95 |
| 53 | 3300032004 | Ga0307414_10399930 | Ga0307414_103999302 | 95 |
| 54 | 3300037853 | Ga0436364_1262744 | Ga0436364_1262744_301_597 | 95 |
| 55 | 3300046513 | Ga0495616_0099401 | Ga0495616_0099401_486_782 | 95 |
| 56 | 3300041458 | Ga0451798_0809346 | Ga0451798_0809346_386_685 | 96 |
| 57 | 3300044656 | Ga0466969_0001050 | Ga0466969_0001050_13415_13717 | 96 |
| 58 | 3300044684 | Ga0466966_0000221 | Ga0466966_0000221_7490_7792 | 96 |
| 59 | 3300044693 | Ga0466961_0000899 | Ga0466961_0000899_17379_17681 | 96 |
| 60 | 3300044719 | Ga0466971_0000345 | Ga0466971_0000345_5480_5782 | 96 |
| 61 | 3300044765 | Ga0466970_0013168 | Ga0466970_0013168_2481_2783 | 96 |
| 62 | 3300044842 | Ga0466957_0002771 | Ga0466957_0002771_600_902 | 96 |
| 63 | 3300045049 | Ga0466959_0000451 | Ga0466959_0000451_22937_23239 | 96 |
| 64 | 3300045051 | Ga0451576_1008262 | Ga0451576_1008262_543_839 | 96 |
| 65 | 3300048929 | Ga0496126_0653427 | Ga0496126_0653427_261_554 | 96 |
| 66 | 3300061719 | Ga0466962_0082210 | Ga0466962_0082210_997_1299 | 96 |
| 67 | 3300002773 | JGI25152J39213_1002331 | JGI25152J39213_10023313 | 97 |
| 68 | 3300002774 | JGI25150J39212_1004882 | JGI25150J39212_10048823 | 97 |
| 69 | 3300003215 | JGI25153J46596_10006782 | JGI25153J46596_100067825 | 97 |
| 70 | 3300003323 | rootH1_10027111 | rootH1_100271114 | 97 |
| 71 | 3300003771 | Ga0055526_1003401 | Ga0055526_10034012 | 97 |
| 72 | 3300003790 | Ga0055528_1067848 | Ga0055528_10678482 | 97 |
| 73 | 3300003794 | Ga0055531_10112652 | Ga0055531_101126521 | 97 |
| 74 | 3300005331 | Ga0070670_100132960 | Ga0070670_1001329602 | 97 |
| 75 | 3300005334 | Ga0068869_100042537 | Ga0068869_1000425375 | 97 |
| 76 | 3300005338 | Ga0068868_101594966 | Ga0068868_1015949662 | 97 |
| 77 | 3300005354 | Ga0070675_100180853 | Ga0070675_1001808532 | 97 |
| 78 | 3300005366 | Ga0070659_102149875 | Ga0070659_1021498751 | 97 |
| 79 | 3300005455 | Ga0070663_101895823 | Ga0070663_1018958231 | 97 |
| 80 | 3300005548 | Ga0070665_100010366 | Ga0070665_1000103668 | 97 |
| 81 | 3300005617 | Ga0068859_101078247 | Ga0068859_1010782472 | 97 |
| 82 | 3300005840 | Ga0068870_10359823 | Ga0068870_103598232 | 97 |
| 83 | 3300005937 | Ga0081455_10655614 | Ga0081455_106556141 | 97 |
| 84 | 3300006048 | Ga0075363_100202401 | Ga0075363_1002024013 | 97 |
| 85 | 3300006178 | Ga0075367_11045040 | Ga0075367_110450402 | 97 |
| 86 | 3300006195 | Ga0075366_10101612 | Ga0075366_101016122 | 97 |
| 87 | 3300006931 | Ga0097620_101078535 | Ga0097620_1010785352 | 97 |
| 88 | 3300017792 | Ga0163161_10715897 | Ga0163161_107158972 | 97 |
| 89 | 3300025245 | Ga0207425_1000131 | Ga0207425_100013139 | 97 |
| 90 | 3300025258 | Ga0209129_1000075 | Ga0209129_100007561 | 97 |
| 91 | 3300025273 | Ga0209673_1033257 | Ga0209673_10332572 | 97 |
| 92 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046225 | 97 |
| 93 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052238 | 97 |
| 94 | 3300025299 | Ga0209256_1032603 | Ga0209256_10326031 | 97 |
| 95 | 3300025304 | Ga0209257_1085851 | Ga0209257_10858511 | 97 |
| 96 | 3300025908 | Ga0207643_10341411 | Ga0207643_103414112 | 97 |
| 97 | 3300025908 | Ga0207643_10528321 | Ga0207643_105283212 | 97 |
| 98 | 3300025925 | Ga0207650_10357359 | Ga0207650_103573591 | 97 |
| 99 | 3300025926 | Ga0207659_10842996 | Ga0207659_108429961 | 97 |
| 100 | 3300025935 | Ga0207709_10033031 | Ga0207709_100330313 | 97 |
| 101 | 3300025942 | Ga0207689_10043592 | Ga0207689_100435925 | 97 |
| 102 | 3300025942 | Ga0207689_11250952 | Ga0207689_112509521 | 97 |
| 103 | 3300026067 | Ga0207678_11112074 | Ga0207678_111120741 | 97 |
| 104 | 3300028379 | Ga0268266_10005532 | Ga0268266_100055327 | 97 |
| 105 | 3300028379 | Ga0268266_12074212 | Ga0268266_120742121 | 97 |
| 106 | 3300041413 | Ga0439465_0080580 | Ga0439465_0080580_742_1050 | 97 |
| 107 | 3300041507 | Ga0451851_0076720 | Ga0451851_0076720_274_570 | 97 |
| 108 | 3300041512 | Ga0451853_1089291 | Ga0451853_1089291_321_617 | 97 |
| 109 | 3300046460 | Ga0495638_0406245 | Ga0495638_0406245_43_357 | 97 |
| 110 | 3300046616 | Ga0495668_0037735 | Ga0495668_0037735_1419_1733 | 97 |
| 111 | 3300046660 | Ga0495625_0023099 | Ga0495625_0023099_4290_4604 | 97 |
| 112 | 3300046694 | Ga0495649_0387705 | Ga0495649_0387705_276_569 | 97 |
| 113 | 3300047318 | Ga0495636_0233253 | Ga0495636_0233253_192_485 | 97 |
| 114 | 3300050493 | nmdc:mga0k408_93449_c1 | nmdc:mga0k408_93449_c1_701_997 | 97 |
| 115 | 3300053087 | Ga0500643_002645 | Ga0500643_002645_6233_6526 | 97 |
| 116 | 3300053087 | Ga0500643_026043 | Ga0500643_026043_231_545 | 97 |
| 117 | 3300053087 | Ga0500643_033461 | Ga0500643_033461_932_1246 | 97 |
| 118 | 3300053104 | Ga0500556_0339619 | Ga0500556_0339619_151_465 | 97 |
| 119 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_670726_671040 | 97 |
| 120 | 3300053134 | Ga0500658_0288133 | Ga0500658_0288133_300_611 | 97 |
| 121 | 3300053139 | Ga0500568_0004910 | Ga0500568_0004910_4423_4728 | 97 |
| 122 | 3300053151 | Ga0500604_0000062 | Ga0500604_0000062_17841_18146 | 97 |
| 123 | 3300053153 | Ga0500616_0000087 | Ga0500616_0000087_16538_16843 | 97 |
| 124 | 3300053730 | Ga0500645_000064 | Ga0500645_000064_68183_68497 | 97 |
| 125 | 3300053739 | Ga0500587_000479 | Ga0500587_000479_1862_2167 | 97 |
| 126 | 2162886007 | SwRhRL2b_contig_2736812 | SwRhRL2b_0391.00004500 | 98 |
| 127 | 3300001979 | JGI24740J21852_10075146 | JGI24740J21852_100751461 | 98 |
| 128 | 3300001989 | JGI24739J22299_10001183 | JGI24739J22299_100011832 | 98 |
| 129 | 3300001991 | JGI24743J22301_10118917 | JGI24743J22301_101189172 | 98 |
| 130 | 3300002067 | JGI24735J21928_10003038 | JGI24735J21928_100030387 | 98 |
| 131 | 3300002075 | JGI24738J21930_10136936 | JGI24738J21930_101369361 | 98 |
| 132 | 3300002772 | JGI25164J39214_1003440 | JGI25164J39214_10034402 | 98 |
| 133 | 3300003215 | JGI25153J46596_10001272 | JGI25153J46596_100012727 | 98 |
| 134 | 3300003215 | JGI25153J46596_10036913 | JGI25153J46596_100369133 | 98 |
| 135 | 3300003316 | rootH1_10182079 | rootH1_101820792 | 98 |
| 136 | 3300003320 | rootH2_10079885 | rootH2_100798854 | 98 |
| 137 | 3300003322 | rootL2_10276713 | rootL2_102767131 | 98 |
| 138 | 3300003323 | rootH1_10338797 | rootH1_103387973 | 98 |
| 139 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013252 | 98 |
| 140 | 3300003762 | Ga0055542_1011773 | Ga0055542_10117732 | 98 |
| 141 | 3300003775 | Ga0055524_1023360 | Ga0055524_10233602 | 98 |
| 142 | 3300003781 | Ga0055536_1002972 | Ga0055536_10029725 | 98 |
| 143 | 3300003781 | Ga0055536_1060793 | Ga0055536_10607932 | 98 |
| 144 | 3300003791 | Ga0055530_10000167 | Ga0055530_1000016716 | 98 |
| 145 | 3300003794 | Ga0055531_10000002 | Ga0055531_10000002239 | 98 |
| 146 | 3300003794 | Ga0055531_10000896 | Ga0055531_1000089616 | 98 |
| 147 | 3300004625 | Ga0055543_1075536 | Ga0055543_10755361 | 98 |
| 148 | 3300005262 | Ga0065165_1001318 | Ga0065165_100131813 | 98 |
| 149 | 3300005262 | Ga0065165_1038550 | Ga0065165_10385502 | 98 |
| 150 | 3300005262 | Ga0065165_1138841 | Ga0065165_11388411 | 98 |
| 151 | 3300005262 | Ga0065165_1152313 | Ga0065165_11523132 | 98 |
| 152 | 3300005289 | Ga0065704_10071248 | Ga0065704_100712486 | 98 |
| 153 | 3300005289 | Ga0065704_10352318 | Ga0065704_103523181 | 98 |
| 154 | 3300005293 | Ga0065715_10454941 | Ga0065715_104549412 | 98 |
| 155 | 3300005328 | Ga0070676_10001392 | Ga0070676_1000139210 | 98 |
| 156 | 3300005330 | Ga0070690_100018230 | Ga0070690_1000182301 | 98 |
| 157 | 3300005334 | Ga0068869_100000033 | Ga0068869_10000003361 | 98 |
| 158 | 3300005334 | Ga0068869_100000585 | Ga0068869_10000058516 | 98 |
| 159 | 3300005338 | Ga0068868_100001180 | Ga0068868_1000011808 | 98 |
| 160 | 3300005339 | Ga0070660_101037397 | Ga0070660_1010373972 | 98 |
| 161 | 3300005343 | Ga0070687_100449152 | Ga0070687_1004491521 | 98 |
| 162 | 3300005344 | Ga0070661_101878784 | Ga0070661_1018787842 | 98 |
| 163 | 3300005354 | Ga0070675_100022171 | Ga0070675_1000221712 | 98 |
| 164 | 3300005356 | Ga0070674_101756344 | Ga0070674_1017563442 | 98 |
| 165 | 3300005364 | Ga0070673_100000001 | Ga0070673_100000001194 | 98 |
| 166 | 3300005364 | Ga0070673_100001138 | Ga0070673_10000113815 | 98 |
| 167 | 3300005364 | Ga0070673_101277086 | Ga0070673_1012770862 | 98 |
| 168 | 3300005366 | Ga0070659_100003135 | Ga0070659_1000031352 | 98 |
| 169 | 3300005366 | Ga0070659_100191651 | Ga0070659_1001916512 | 98 |
| 170 | 3300005367 | Ga0070667_100016302 | Ga0070667_10001630211 | 98 |
| 171 | 3300005457 | Ga0070662_100000441 | Ga0070662_1000004418 | 98 |
| 172 | 3300005459 | Ga0068867_100006941 | Ga0068867_1000069413 | 98 |
| 173 | 3300005459 | Ga0068867_100007822 | Ga0068867_1000078226 | 98 |
| 174 | 3300005539 | Ga0068853_100015751 | Ga0068853_1000157516 | 98 |
| 175 | 3300005539 | Ga0068853_101643761 | Ga0068853_1016437612 | 98 |
| 176 | 3300005543 | Ga0070672_100121273 | Ga0070672_1001212732 | 98 |
| 177 | 3300005547 | Ga0070693_100452927 | Ga0070693_1004529272 | 98 |
| 178 | 3300005563 | Ga0068855_101272769 | Ga0068855_1012727692 | 98 |
| 179 | 3300005577 | Ga0068857_100683552 | Ga0068857_1006835522 | 98 |
| 180 | 3300005578 | Ga0068854_101186868 | Ga0068854_1011868681 | 98 |
| 181 | 3300005578 | Ga0068854_101437099 | Ga0068854_1014370992 | 98 |
| 182 | 3300005578 | Ga0068854_101753741 | Ga0068854_1017537412 | 98 |
| 183 | 3300005614 | Ga0068856_100396322 | Ga0068856_1003963222 | 98 |
| 184 | 3300005618 | Ga0068864_101701361 | Ga0068864_1017013612 | 98 |
| 185 | 3300005618 | Ga0068864_101706788 | Ga0068864_1017067882 | 98 |
| 186 | 3300005718 | Ga0068866_10034076 | Ga0068866_100340762 | 98 |
| 187 | 3300005719 | Ga0068861_101240571 | Ga0068861_1012405712 | 98 |
| 188 | 3300005834 | Ga0068851_10396686 | Ga0068851_103966862 | 98 |
| 189 | 3300005842 | Ga0068858_100002113 | Ga0068858_1000021135 | 98 |
| 190 | 3300005844 | Ga0068862_100480030 | Ga0068862_1004800302 | 98 |
| 191 | 3300006042 | Ga0075368_10038279 | Ga0075368_100382793 | 98 |
| 192 | 3300006048 | Ga0075363_100563853 | Ga0075363_1005638532 | 98 |
| 193 | 3300006178 | Ga0075367_10000083 | Ga0075367_1000008320 | 98 |
| 194 | 3300006195 | Ga0075366_10150500 | Ga0075366_101505003 | 98 |
| 195 | 3300006237 | Ga0097621_101632394 | Ga0097621_1016323942 | 98 |
| 196 | 3300006353 | Ga0075370_10070179 | Ga0075370_100701793 | 98 |
| 197 | 3300006358 | Ga0068871_100146807 | Ga0068871_1001468074 | 98 |
| 198 | 3300006358 | Ga0068871_100911099 | Ga0068871_1009110992 | 98 |
| 199 | 3300006881 | Ga0068865_100000078 | Ga0068865_1000000784 | 98 |
| 200 | 3300006881 | Ga0068865_100120598 | Ga0068865_1001205982 | 98 |
| 201 | 3300006881 | Ga0068865_100607367 | Ga0068865_1006073672 | 98 |
| 202 | 3300009093 | Ga0105240_10057515 | Ga0105240_100575155 | 98 |
| 203 | 3300009093 | Ga0105240_10234423 | Ga0105240_102344231 | 98 |
| 204 | 3300009093 | Ga0105240_10527867 | Ga0105240_105278672 | 98 |
| 205 | 3300009098 | Ga0105245_10000529 | Ga0105245_1000052914 | 98 |
| 206 | 3300009098 | Ga0105245_10001532 | Ga0105245_1000153219 | 98 |
| 207 | 3300009098 | Ga0105245_13135511 | Ga0105245_131355112 | 98 |
| 208 | 3300009148 | Ga0105243_10004390 | Ga0105243_100043908 | 98 |
| 209 | 3300009148 | Ga0105243_10057983 | Ga0105243_100579834 | 98 |
| 210 | 3300009148 | Ga0105243_10123717 | Ga0105243_101237172 | 98 |
| 211 | 3300009174 | Ga0105241_12329064 | Ga0105241_123290641 | 98 |
| 212 | 3300009176 | Ga0105242_10002194 | Ga0105242_1000219411 | 98 |
| 213 | 3300009176 | Ga0105242_10580279 | Ga0105242_105802791 | 98 |
| 214 | 3300009176 | Ga0105242_11281774 | Ga0105242_112817742 | 98 |
| 215 | 3300009177 | Ga0105248_10001159 | Ga0105248_1000115922 | 98 |
| 216 | 3300009545 | Ga0105237_10489066 | Ga0105237_104890662 | 98 |
| 217 | 3300009545 | Ga0105237_12042638 | Ga0105237_120426382 | 98 |
| 218 | 3300009551 | Ga0105238_10027548 | Ga0105238_100275487 | 98 |
| 219 | 3300009551 | Ga0105238_10391830 | Ga0105238_103918304 | 98 |
| 220 | 3300009551 | Ga0105238_10599187 | Ga0105238_105991872 | 98 |
| 221 | 3300009553 | Ga0105249_10033345 | Ga0105249_100333453 | 98 |
| 222 | 3300009553 | Ga0105249_13361060 | Ga0105249_133610601 | 98 |
| 223 | 3300010375 | Ga0105239_10030351 | Ga0105239_100303515 | 98 |
| 224 | 3300010375 | Ga0105239_10223035 | Ga0105239_102230354 | 98 |
| 225 | 3300011119 | Ga0105246_10000923 | Ga0105246_100009235 | 98 |
| 226 | 3300011119 | Ga0105246_10008877 | Ga0105246_100088774 | 98 |
| 227 | 3300013102 | Ga0157371_10002150 | Ga0157371_1000215022 | 98 |
| 228 | 3300013104 | Ga0157370_10000056 | Ga0157370_1000005613 | 98 |
| 229 | 3300013105 | Ga0157369_10003565 | Ga0157369_100035654 | 98 |
| 230 | 3300013105 | Ga0157369_10047585 | Ga0157369_100475855 | 98 |
| 231 | 3300013296 | Ga0157374_10009868 | Ga0157374_100098683 | 98 |
| 232 | 3300013296 | Ga0157374_10147985 | Ga0157374_101479852 | 98 |
| 233 | 3300013296 | Ga0157374_12381982 | Ga0157374_123819822 | 98 |
| 234 | 3300013297 | Ga0157378_10005832 | Ga0157378_100058323 | 98 |
| 235 | 3300013297 | Ga0157378_10091580 | Ga0157378_100915802 | 98 |
| 236 | 3300013297 | Ga0157378_12055049 | Ga0157378_120550492 | 98 |
| 237 | 3300013306 | Ga0163162_11252296 | Ga0163162_112522962 | 98 |
| 238 | 3300013306 | Ga0163162_12417299 | Ga0163162_124172991 | 98 |
| 239 | 3300013307 | Ga0157372_11537769 | Ga0157372_115377691 | 98 |
| 240 | 3300013308 | Ga0157375_10004502 | Ga0157375_100045028 | 98 |
| 241 | 3300014326 | Ga0157380_12951369 | Ga0157380_129513692 | 98 |
| 242 | 3300014745 | Ga0157377_10005234 | Ga0157377_100052342 | 98 |
| 243 | 3300014969 | Ga0157376_10001712 | Ga0157376_1000171213 | 98 |
| 244 | 3300014969 | Ga0157376_12887462 | Ga0157376_128874622 | 98 |
| 245 | 3300021361 | Ga0213872_10000172 | Ga0213872_1000017220 | 98 |
| 246 | 3300021361 | Ga0213872_10013414 | Ga0213872_100134145 | 98 |
| 247 | 3300025226 | Ga0209674_109371 | Ga0209674_1093712 | 98 |
| 248 | 3300025230 | Ga0209563_100025 | Ga0209563_100025334 | 98 |
| 249 | 3300025231 | Ga0207427_100931 | Ga0207427_10093112 | 98 |
| 250 | 3300025245 | Ga0207425_1056314 | Ga0207425_10563141 | 98 |
| 251 | 3300025254 | Ga0209148_1000332 | Ga0209148_10003328 | 98 |
| 252 | 3300025254 | Ga0209148_1022003 | Ga0209148_10220032 | 98 |
| 253 | 3300025258 | Ga0209129_1008618 | Ga0209129_10086182 | 98 |
| 254 | 3300025263 | Ga0209565_1000332 | Ga0209565_100033222 | 98 |
| 255 | 3300025273 | Ga0209673_1000523 | Ga0209673_100052317 | 98 |
| 256 | 3300025290 | Ga0207673_1005779 | Ga0207673_10057792 | 98 |
| 257 | 3300025291 | Ga0209675_1015162 | Ga0209675_10151623 | 98 |
| 258 | 3300025292 | Ga0209676_1000086 | Ga0209676_10000868 | 98 |
| 259 | 3300025292 | Ga0209676_1005342 | Ga0209676_10053422 | 98 |
| 260 | 3300025295 | Ga0209564_1026721 | Ga0209564_10267213 | 98 |
| 261 | 3300025297 | Ga0209758_1000287 | Ga0209758_100028761 | 98 |
| 262 | 3300025297 | Ga0209758_1016468 | Ga0209758_10164683 | 98 |
| 263 | 3300025298 | Ga0209050_1000039 | Ga0209050_100003916 | 98 |
| 264 | 3300025298 | Ga0209050_1003202 | Ga0209050_10032023 | 98 |
| 265 | 3300025299 | Ga0209256_1003899 | Ga0209256_10038999 | 98 |
| 266 | 3300025299 | Ga0209256_1005097 | Ga0209256_10050972 | 98 |
| 267 | 3300025299 | Ga0209256_1007063 | Ga0209256_10070634 | 98 |
| 268 | 3300025303 | Ga0209051_1050566 | Ga0209051_10505663 | 98 |
| 269 | 3300025304 | Ga0209257_1000049 | Ga0209257_1000049275 | 98 |
| 270 | 3300025304 | Ga0209257_1000051 | Ga0209257_100005116 | 98 |
| 271 | 3300025304 | Ga0209257_1015881 | Ga0209257_10158814 | 98 |
| 272 | 3300025901 | Ga0207688_10619541 | Ga0207688_106195412 | 98 |
| 273 | 3300025904 | Ga0207647_10476709 | Ga0207647_104767091 | 98 |
| 274 | 3300025907 | Ga0207645_10001428 | Ga0207645_100014284 | 98 |
| 275 | 3300025911 | Ga0207654_10582487 | Ga0207654_105824872 | 98 |
| 276 | 3300025913 | Ga0207695_10057651 | Ga0207695_100576513 | 98 |
| 277 | 3300025913 | Ga0207695_10067305 | Ga0207695_100673053 | 98 |
| 278 | 3300025914 | Ga0207671_10644109 | Ga0207671_106441092 | 98 |
| 279 | 3300025918 | Ga0207662_10047693 | Ga0207662_100476932 | 98 |
| 280 | 3300025919 | Ga0207657_10839498 | Ga0207657_108394981 | 98 |
| 281 | 3300025920 | Ga0207649_10099226 | Ga0207649_100992262 | 98 |
| 282 | 3300025923 | Ga0207681_10356034 | Ga0207681_103560342 | 98 |
| 283 | 3300025924 | Ga0207694_10333006 | Ga0207694_103330061 | 98 |
| 284 | 3300025924 | Ga0207694_10831463 | Ga0207694_108314632 | 98 |
| 285 | 3300025927 | Ga0207687_10000580 | Ga0207687_1000058014 | 98 |
| 286 | 3300025927 | Ga0207687_10009324 | Ga0207687_100093243 | 98 |
| 287 | 3300025927 | Ga0207687_11842274 | Ga0207687_118422742 | 98 |
| 288 | 3300025932 | Ga0207690_10080528 | Ga0207690_100805282 | 98 |
| 289 | 3300025934 | Ga0207686_10022514 | Ga0207686_100225141 | 98 |
| 290 | 3300025935 | Ga0207709_10001739 | Ga0207709_100017394 | 98 |
| 291 | 3300025935 | Ga0207709_10102499 | Ga0207709_101024993 | 98 |
| 292 | 3300025935 | Ga0207709_11430758 | Ga0207709_114307582 | 98 |
| 293 | 3300025938 | Ga0207704_10000090 | Ga0207704_100000903 | 98 |
| 294 | 3300025938 | Ga0207704_10105724 | Ga0207704_101057242 | 98 |
| 295 | 3300025940 | Ga0207691_10147694 | Ga0207691_101476942 | 98 |
| 296 | 3300025942 | Ga0207689_10006914 | Ga0207689_100069146 | 98 |
| 297 | 3300025949 | Ga0207667_10251618 | Ga0207667_102516184 | 98 |
| 298 | 3300025949 | Ga0207667_10428206 | Ga0207667_104282061 | 98 |
| 299 | 3300025960 | Ga0207651_10000001 | Ga0207651_10000001276 | 98 |
| 300 | 3300025960 | Ga0207651_11284819 | Ga0207651_112848192 | 98 |
| 301 | 3300025961 | Ga0207712_10019779 | Ga0207712_100197794 | 98 |
| 302 | 3300025981 | Ga0207640_11679082 | Ga0207640_116790822 | 98 |
| 303 | 3300025981 | Ga0207640_12008003 | Ga0207640_120080032 | 98 |
| 304 | 3300025986 | Ga0207658_10678286 | Ga0207658_106782862 | 98 |
| 305 | 3300026023 | Ga0207677_10000016 | Ga0207677_100000164 | 98 |
| 306 | 3300026035 | Ga0207703_10001637 | Ga0207703_1000163715 | 98 |
| 307 | 3300026041 | Ga0207639_10050398 | Ga0207639_100503985 | 98 |
| 308 | 3300026078 | Ga0207702_10336571 | Ga0207702_103365712 | 98 |
| 309 | 3300026078 | Ga0207702_11583182 | Ga0207702_115831822 | 98 |
| 310 | 3300026089 | Ga0207648_10005425 | Ga0207648_100054259 | 98 |
| 311 | 3300026095 | Ga0207676_11910516 | Ga0207676_119105162 | 98 |
| 312 | 3300026116 | Ga0207674_10886641 | Ga0207674_108866412 | 98 |
| 313 | 3300026121 | Ga0207683_10467799 | Ga0207683_104677992 | 98 |
| 314 | 3300027866 | Ga0209813_10000043 | Ga0209813_1000004333 | 98 |
| 315 | 3300027876 | Ga0209974_10402231 | Ga0209974_104022312 | 98 |
| 316 | 3300028786 | Ga0307517_10019346 | Ga0307517_100193462 | 98 |
| 317 | 3300028794 | Ga0307515_10053013 | Ga0307515_100530136 | 98 |
| 318 | 3300028794 | Ga0307515_10113322 | Ga0307515_101133224 | 98 |
| 319 | 3300028794 | Ga0307515_10284843 | Ga0307515_102848433 | 98 |
| 320 | 3300028800 | Ga0265338_10048741 | Ga0265338_100487414 | 98 |
| 321 | 3300028800 | Ga0265338_10140397 | Ga0265338_101403973 | 98 |
| 322 | 3300030745 | Ga0316182_1131368 | Ga0316182_11313681 | 98 |
| 323 | 3300031251 | Ga0265327_10000290 | Ga0265327_1000029014 | 98 |
| 324 | 3300031251 | Ga0265327_10000702 | Ga0265327_100007022 | 98 |
| 325 | 3300031456 | Ga0307513_10147629 | Ga0307513_101476292 | 98 |
| 326 | 3300031456 | Ga0307513_10636155 | Ga0307513_106361552 | 98 |
| 327 | 3300031711 | Ga0265314_10003206 | Ga0265314_1000320610 | 98 |
| 328 | 3300031712 | Ga0265342_10618058 | Ga0265342_106180582 | 98 |
| 329 | 3300031731 | Ga0307405_11749400 | Ga0307405_117494002 | 98 |
| 330 | 3300031824 | Ga0307413_10121332 | Ga0307413_101213321 | 98 |
| 331 | 3300031824 | Ga0307413_10220281 | Ga0307413_102202813 | 98 |
| 332 | 3300031824 | Ga0307413_10396785 | Ga0307413_103967852 | 98 |
| 333 | 3300031824 | Ga0307413_11083508 | Ga0307413_110835082 | 98 |
| 334 | 3300031852 | Ga0307410_10045490 | Ga0307410_100454904 | 98 |
| 335 | 3300031852 | Ga0307410_10143015 | Ga0307410_101430153 | 98 |
| 336 | 3300031903 | Ga0307407_10600143 | Ga0307407_106001431 | 98 |
| 337 | 3300031995 | Ga0307409_100038700 | Ga0307409_1000387004 | 98 |
| 338 | 3300031995 | Ga0307409_100293277 | Ga0307409_1002932772 | 98 |
| 339 | 3300032004 | Ga0307414_10010314 | Ga0307414_100103145 | 98 |
| 340 | 3300032004 | Ga0307414_10052971 | Ga0307414_100529714 | 98 |
| 341 | 3300032004 | Ga0307414_10085765 | Ga0307414_100857653 | 98 |
| 342 | 3300032004 | Ga0307414_10116115 | Ga0307414_101161153 | 98 |
| 343 | 3300032004 | Ga0307414_10357257 | Ga0307414_103572572 | 98 |
| 344 | 3300032004 | Ga0307414_10547886 | Ga0307414_105478862 | 98 |
| 345 | 3300032004 | Ga0307414_10767849 | Ga0307414_107678492 | 98 |
| 346 | 3300032004 | Ga0307414_10910841 | Ga0307414_109108412 | 98 |
| 347 | 3300032004 | Ga0307414_11554518 | Ga0307414_115545182 | 98 |
| 348 | 3300032005 | Ga0307411_10073937 | Ga0307411_100739372 | 98 |
| 349 | 3300032005 | Ga0307411_10100595 | Ga0307411_101005952 | 98 |
| 350 | 3300032005 | Ga0307411_10130612 | Ga0307411_101306122 | 98 |
| 351 | 3300033180 | Ga0307510_10059467 | Ga0307510_100594674 | 98 |
| 352 | 3300036401 | Ga0373937_1100562 | Ga0373937_1100562_136_432 | 98 |
| 353 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_780959_781261 | 98 |
| 354 | 3300037312 | Ga0395899_0000396 | Ga0395899_0000396_38829_39125 | 98 |
| 355 | 3300037312 | Ga0395899_0064555 | Ga0395899_0064555_281_577 | 98 |
| 356 | 3300037418 | Ga0395900_0022028 | Ga0395900_0022028_5790_6086 | 98 |
| 357 | 3300037418 | Ga0395900_0107277 | Ga0395900_0107277_261_557 | 98 |
| 358 | 3300037418 | Ga0395900_1556749 | Ga0395900_1556749_29_325 | 98 |
| 359 | 3300037466 | Ga0395898_0418021 | Ga0395898_0418021_311_607 | 98 |
| 360 | 3300037471 | Ga0395905_0023541 | Ga0395905_0023541_3344_3640 | 98 |
| 361 | 3300037471 | Ga0395905_0046113 | Ga0395905_0046113_281_577 | 98 |
| 362 | 3300037471 | Ga0395905_0170727 | Ga0395905_0170727_502_798 | 98 |
| 363 | 3300037471 | Ga0395905_0242517 | Ga0395905_0242517_359_655 | 98 |
| 364 | 3300037471 | Ga0395905_0284048 | Ga0395905_0284048_408_710 | 98 |
| 365 | 3300037471 | Ga0395905_1695993 | Ga0395905_1695993_171_473 | 98 |
| 366 | 3300037853 | Ga0436364_0060956 | Ga0436364_0060956_250_546 | 98 |
| 367 | 3300037853 | Ga0436364_1361719 | Ga0436364_1361719_247_543 | 98 |
| 368 | 3300038443 | Ga0395901_0104646 | Ga0395901_0104646_276_572 | 98 |
| 369 | 3300039438 | Ga0436360_0958655 | Ga0436360_0958655_784_1080 | 98 |
| 370 | 3300039447 | Ga0436361_0046862 | Ga0436361_0046862_5391_5687 | 98 |
| 371 | 3300039447 | Ga0436361_0167979 | Ga0436361_0167979_28576_28872 | 98 |
| 372 | 3300039447 | Ga0436361_0375780 | Ga0436361_0375780_2123_2422 | 98 |
| 373 | 3300039447 | Ga0436361_0801110 | Ga0436361_0801110_15_311 | 98 |
| 374 | 3300039447 | Ga0436361_1065063 | Ga0436361_1065063_478_774 | 98 |
| 375 | 3300041410 | Ga0439461_0000039 | Ga0439461_0000039_5995_6291 | 98 |
| 376 | 3300041413 | Ga0439465_0000942 | Ga0439465_0000942_5962_6258 | 98 |
| 377 | 3300041441 | Ga0451787_822558 | Ga0451787_822558_257_553 | 98 |
| 378 | 3300041443 | Ga0451789_0139606 | Ga0451789_0139606_183_479 | 98 |
| 379 | 3300041443 | Ga0451789_0925911 | Ga0451789_0925911_83_424 | 98 |
| 380 | 3300041451 | Ga0451791_1437851 | Ga0451791_1437851_145_441 | 98 |
| 381 | 3300041452 | Ga0451793_0951445 | Ga0451793_0951445_227_526 | 98 |
| 382 | 3300041453 | Ga0451797_1017601 | Ga0451797_1017601_374_670 | 98 |
| 383 | 3300041456 | Ga0451795_1411656 | Ga0451795_1411656_1595_1894 | 98 |
| 384 | 3300041459 | Ga0451800_1237296 | Ga0451800_1237296_552_851 | 98 |
| 385 | 3300041463 | Ga0451804_0035446 | Ga0451804_0035446_3870_4169 | 98 |
| 386 | 3300041463 | Ga0451804_0086716 | Ga0451804_0086716_130_438 | 98 |
| 387 | 3300041486 | Ga0451807_0828075 | Ga0451807_0828075_173_469 | 98 |
| 388 | 3300041486 | Ga0451807_1637974 | Ga0451807_1637974_11_310 | 98 |
| 389 | 3300041494 | Ga0451837_0051540 | Ga0451837_0051540_147_449 | 98 |
| 390 | 3300041494 | Ga0451837_1068148 | Ga0451837_1068148_143_439 | 98 |
| 391 | 3300041509 | Ga0451843_0000599 | Ga0451843_0000599_701_997 | 98 |
| 392 | 3300041509 | Ga0451843_1174303 | Ga0451843_1174303_137_439 | 98 |
| 393 | 3300041512 | Ga0451853_0513266 | Ga0451853_0513266_83_379 | 98 |
| 394 | 3300041997 | Ga0439431_0000534 | Ga0439431_0000534_1789_2085 | 98 |
| 395 | 3300042002 | Ga0439442_002952 | Ga0439442_002952_128_424 | 98 |
| 396 | 3300042004 | Ga0439445_0000291 | Ga0439445_0000291_6617_6913 | 98 |
| 397 | 3300042005 | Ga0439448_0023672 | Ga0439448_0023672_1253_1549 | 98 |
| 398 | 3300042006 | Ga0439432_000049 | Ga0439432_000049_29826_30122 | 98 |
| 399 | 3300042007 | Ga0439449_0065406 | Ga0439449_0065406_997_1293 | 98 |
| 400 | 3300042015 | Ga0439462_0000923 | Ga0439462_0000923_3109_3405 | 98 |
| 401 | 3300046457 | Ga0495590_0003562 | Ga0495590_0003562_3557_3853 | 98 |
| 402 | 3300046459 | Ga0495629_0291535 | Ga0495629_0291535_619_915 | 98 |
| 403 | 3300046460 | Ga0495638_0000478 | Ga0495638_0000478_16870_17166 | 98 |
| 404 | 3300046460 | Ga0495638_0000500 | Ga0495638_0000500_15019_15315 | 98 |
| 405 | 3300046460 | Ga0495638_0001983 | Ga0495638_0001983_12896_13192 | 98 |
| 406 | 3300046460 | Ga0495638_0156316 | Ga0495638_0156316_742_1041 | 98 |
| 407 | 3300046471 | Ga0495650_0000196 | Ga0495650_0000196_36489_36785 | 98 |
| 408 | 3300046471 | Ga0495650_0010372 | Ga0495650_0010372_2983_3279 | 98 |
| 409 | 3300046471 | Ga0495650_0106021 | Ga0495650_0106021_504_800 | 98 |
| 410 | 3300046506 | Ga0495583_0000122 | Ga0495583_0000122_30410_30706 | 98 |
| 411 | 3300046507 | Ga0495606_0093367 | Ga0495606_0093367_565_861 | 98 |
| 412 | 3300046512 | Ga0495610_0000534 | Ga0495610_0000534_5809_6111 | 98 |
| 413 | 3300046512 | Ga0495610_0009932 | Ga0495610_0009932_4225_4521 | 98 |
| 414 | 3300046512 | Ga0495610_0386521 | Ga0495610_0386521_166_462 | 98 |
| 415 | 3300046513 | Ga0495616_0064198 | Ga0495616_0064198_626_928 | 98 |
| 416 | 3300046516 | Ga0495628_0877590 | Ga0495628_0877590_272_568 | 98 |
| 417 | 3300046518 | Ga0495631_0016339 | Ga0495631_0016339_1359_1655 | 98 |
| 418 | 3300046519 | Ga0495632_0093217 | Ga0495632_0093217_851_1153 | 98 |
| 419 | 3300046519 | Ga0495632_0212570 | Ga0495632_0212570_379_720 | 98 |
| 420 | 3300046520 | Ga0495637_0084203 | Ga0495637_0084203_65_367 | 98 |
| 421 | 3300046520 | Ga0495637_0241355 | Ga0495637_0241355_302_598 | 98 |
| 422 | 3300046522 | Ga0495643_0225919 | Ga0495643_0225919_422_724 | 98 |
| 423 | 3300046523 | Ga0495644_0121441 | Ga0495644_0121441_474_782 | 98 |
| 424 | 3300046524 | Ga0495648_0000389 | Ga0495648_0000389_27803_28099 | 98 |
| 425 | 3300046524 | Ga0495648_0179807 | Ga0495648_0179807_414_710 | 98 |
| 426 | 3300046525 | Ga0495663_0171104 | Ga0495663_0171104_48_344 | 98 |
| 427 | 3300046526 | Ga0495666_0355129 | Ga0495666_0355129_260_556 | 98 |
| 428 | 3300046530 | Ga0495654_0098467 | Ga0495654_0098467_455_751 | 98 |
| 429 | 3300046536 | Ga0495587_0013979 | Ga0495587_0013979_4615_4911 | 98 |
| 430 | 3300046557 | Ga0495622_0002767 | Ga0495622_0002767_8000_8296 | 98 |
| 431 | 3300046558 | Ga0495633_0032350 | Ga0495633_0032350_1754_2050 | 98 |
| 432 | 3300046616 | Ga0495668_0006012 | Ga0495668_0006012_419_715 | 98 |
| 433 | 3300046660 | Ga0495625_0000876 | Ga0495625_0000876_9734_10030 | 98 |
| 434 | 3300046660 | Ga0495625_0002001 | Ga0495625_0002001_15907_16203 | 98 |
| 435 | 3300046660 | Ga0495625_0002592 | Ga0495625_0002592_8427_8723 | 98 |
| 436 | 3300046660 | Ga0495625_0007475 | Ga0495625_0007475_1812_2114 | 98 |
| 437 | 3300046660 | Ga0495625_0028435 | Ga0495625_0028435_583_885 | 98 |
| 438 | 3300046665 | Ga0495661_0095747 | Ga0495661_0095747_853_1149 | 98 |
| 439 | 3300046683 | Ga0495658_0775569 | Ga0495658_0775569_53_349 | 98 |
| 440 | 3300046691 | Ga0495670_0000033 | Ga0495670_0000033_75992_76288 | 98 |
| 441 | 3300046691 | Ga0495670_0143723 | Ga0495670_0143723_316_618 | 98 |
| 442 | 3300046809 | Ga0495600_0042379 | Ga0495600_0042379_761_1057 | 98 |
| 443 | 3300047317 | Ga0495604_0902912 | Ga0495604_0902912_210_506 | 98 |
| 444 | 3300047323 | Ga0495683_0143548 | Ga0495683_0143548_290_592 | 98 |
| 445 | 3300047446 | Ga0495679_009923 | Ga0495679_009923_904_1200 | 98 |
| 446 | 3300047469 | Ga0495673_0000420 | Ga0495673_0000420_17019_17315 | 98 |
| 447 | 3300047469 | Ga0495673_0016299 | Ga0495673_0016299_1517_1813 | 98 |
| 448 | 3300047470 | Ga0495681_0136649 | Ga0495681_0136649_485_787 | 98 |
| 449 | 3300047470 | Ga0495681_0209914 | Ga0495681_0209914_231_527 | 98 |
| 450 | 3300047472 | Ga0495686_0000164 | Ga0495686_0000164_121121_121417 | 98 |
| 451 | 3300047472 | Ga0495686_0009474 | Ga0495686_0009474_6126_6434 | 98 |
| 452 | 3300047472 | Ga0495686_0038556 | Ga0495686_0038556_1281_1577 | 98 |
| 453 | 3300048090 | Ga0495615_0049315 | Ga0495615_0049315_379_711 | 98 |
| 454 | 3300048905 | Ga0496102_0916790 | Ga0496102_0916790_328_624 | 98 |
| 455 | 3300048908 | Ga0496105_0866277 | Ga0496105_0866277_205_501 | 98 |
| 456 | 3300048909 | Ga0496106_0974155 | Ga0496106_0974155_252_554 | 98 |
| 457 | 3300048910 | Ga0496107_0621367 | Ga0496107_0621367_202_498 | 98 |
| 458 | 3300048911 | Ga0496108_1603106 | Ga0496108_1603106_113_409 | 98 |
| 459 | 3300048912 | Ga0496109_0831055 | Ga0496109_0831055_206_502 | 98 |
| 460 | 3300048917 | Ga0496114_0106473 | Ga0496114_0106473_98_394 | 98 |
| 461 | 3300048917 | Ga0496114_1384996 | Ga0496114_1384996_225_521 | 98 |
| 462 | 3300048918 | Ga0496115_0004250 | Ga0496115_0004250_8813_9109 | 98 |
| 463 | 3300048918 | Ga0496115_0006370 | Ga0496115_0006370_5362_5664 | 98 |
| 464 | 3300048920 | Ga0496117_0343017 | Ga0496117_0343017_421_717 | 98 |
| 465 | 3300048921 | Ga0496118_0009455 | Ga0496118_0009455_3936_4232 | 98 |
| 466 | 3300048923 | Ga0496120_0135823 | Ga0496120_0135823_217_513 | 98 |
| 467 | 3300048925 | Ga0496122_0003882 | Ga0496122_0003882_17083_17379 | 98 |
| 468 | 3300048926 | Ga0496123_0004295 | Ga0496123_0004295_12096_12392 | 98 |
| 469 | 3300048929 | Ga0496126_0022494 | Ga0496126_0022494_3670_3966 | 98 |
| 470 | 3300048929 | Ga0496126_0241664 | Ga0496126_0241664_836_1132 | 98 |
| 471 | 3300048929 | Ga0496126_0373697 | Ga0496126_0373697_543_839 | 98 |
| 472 | 3300048929 | Ga0496126_0866690 | Ga0496126_0866690_95_391 | 98 |
| 473 | 3300049459 | Ga0495678_006172 | Ga0495678_006172_3993_4289 | 98 |
| 474 | 3300049570 | Ga0501033_0564832 | Ga0501033_0564832_421_717 | 98 |
| 475 | 3300049571 | Ga0501034_1370757 | Ga0501034_1370757_179_487 | 98 |
| 476 | 3300049671 | Ga0501238_001405 | Ga0501238_001405_1754_2050 | 98 |
| 477 | 3300049758 | Ga0501241_014161 | Ga0501241_014161_180_476 | 98 |
| 478 | 3300049758 | Ga0501241_051977 | Ga0501241_051977_214_510 | 98 |
| 479 | 3300049822 | Ga0501035_0246319 | Ga0501035_0246319_535_831 | 98 |
| 480 | 3300050490 | nmdc:mga03n38_26584_c1 | nmdc:mga03n38_26584_c1_2064_2372 | 98 |
| 481 | 3300050493 | nmdc:mga0k408_567105_c1 | nmdc:mga0k408_567105_c1_14_310 | 98 |
| 482 | 3300050494 | nmdc:mga06z11_56_c1 | nmdc:mga06z11_56_c1_18876_19184 | 98 |
| 483 | 3300050494 | nmdc:mga06z11_667900_c1 | nmdc:mga06z11_667900_c1_78_386 | 98 |
| 484 | 3300050495 | nmdc:mga04h51_99_c1 | nmdc:mga04h51_99_c1_7039_7347 | 98 |
| 485 | 3300050496 | nmdc:mga07m45_125786_c1 | nmdc:mga07m45_125786_c1_581_889 | 98 |
| 486 | 3300050513 | nmdc:mga0rr50_1099666_c1 | nmdc:mga0rr50_1099666_c1_203_505 | 98 |
| 487 | 3300053086 | Ga0500578_0009669 | Ga0500578_0009669_1638_1934 | 98 |
| 488 | 3300053087 | Ga0500643_095655 | Ga0500643_095655_488_787 | 98 |
| 489 | 3300053088 | Ga0500644_0000046 | Ga0500644_0000046_9544_9840 | 98 |
| 490 | 3300053088 | Ga0500644_0014985 | Ga0500644_0014985_1480_1776 | 98 |
| 491 | 3300053088 | Ga0500644_0100689 | Ga0500644_0100689_311_610 | 98 |
| 492 | 3300053090 | Ga0500646_0000881 | Ga0500646_0000881_7544_7843 | 98 |
| 493 | 3300053090 | Ga0500646_0207621 | Ga0500646_0207621_216_512 | 98 |
| 494 | 3300053090 | Ga0500646_0283928 | Ga0500646_0283928_216_512 | 98 |
| 495 | 3300053092 | Ga0500583_0042065 | Ga0500583_0042065_122_421 | 98 |
| 496 | 3300053093 | Ga0500651_0036779 | Ga0500651_0036779_2664_2963 | 98 |
| 497 | 3300053093 | Ga0500651_0372704 | Ga0500651_0372704_16_315 | 98 |
| 498 | 3300053094 | Ga0500566_0164461 | Ga0500566_0164461_405_701 | 98 |
| 499 | 3300053096 | Ga0500641_0104220 | Ga0500641_0104220_402_698 | 98 |
| 500 | 3300053098 | Ga0500650_0005141 | Ga0500650_0005141_4223_4522 | 98 |
| 501 | 3300053102 | Ga0500554_004877 | Ga0500554_004877_2133_2429 | 98 |
| 502 | 3300053103 | Ga0500555_105332 | Ga0500555_105332_304_600 | 98 |
| 503 | 3300053104 | Ga0500556_0002085 | Ga0500556_0002085_6347_6649 | 98 |
| 504 | 3300053108 | Ga0500562_006292 | Ga0500562_006292_311_607 | 98 |
| 505 | 3300053118 | Ga0500594_0000812 | Ga0500594_0000812_2150_2446 | 98 |
| 506 | 3300053119 | Ga0500595_001959 | Ga0500595_001959_5667_5963 | 98 |
| 507 | 3300053121 | Ga0500607_080950 | Ga0500607_080950_897_1193 | 98 |
| 508 | 3300053123 | Ga0500614_008918 | Ga0500614_008918_381_677 | 98 |
| 509 | 3300053125 | Ga0500618_000064 | Ga0500618_000064_25404_25700 | 98 |
| 510 | 3300053127 | Ga0500623_142026 | Ga0500623_142026_50_349 | 98 |
| 511 | 3300053129 | Ga0500628_000584 | Ga0500628_000584_3486_3785 | 98 |
| 512 | 3300053130 | Ga0500642_0001707 | Ga0500642_0001707_2082_2381 | 98 |
| 513 | 3300053131 | Ga0500652_000108 | Ga0500652_000108_28707_29006 | 98 |
| 514 | 3300053131 | Ga0500652_290617 | Ga0500652_290617_162_458 | 98 |
| 515 | 3300053133 | Ga0500655_021563 | Ga0500655_021563_574_873 | 98 |
| 516 | 3300053133 | Ga0500655_049691 | Ga0500655_049691_366_662 | 98 |
| 517 | 3300053134 | Ga0500658_0007011 | Ga0500658_0007011_933_1235 | 98 |
| 518 | 3300053136 | Ga0500559_0008081 | Ga0500559_0008081_984_1280 | 98 |
| 519 | 3300053136 | Ga0500559_0062639 | Ga0500559_0062639_1020_1316 | 98 |
| 520 | 3300053136 | Ga0500559_0172435 | Ga0500559_0172435_628_924 | 98 |
| 521 | 3300053138 | Ga0500564_000125 | Ga0500564_000125_6837_7133 | 98 |
| 522 | 3300053140 | Ga0500573_0041383 | Ga0500573_0041383_1899_2201 | 98 |
| 523 | 3300053143 | Ga0500579_132331 | Ga0500579_132331_413_712 | 98 |
| 524 | 3300053147 | Ga0500589_257988 | Ga0500589_257988_272_571 | 98 |
| 525 | 3300053147 | Ga0500589_332379 | Ga0500589_332379_129_425 | 98 |
| 526 | 3300053151 | Ga0500604_0001250 | Ga0500604_0001250_775_1074 | 98 |
| 527 | 3300053156 | Ga0500622_0000682 | Ga0500622_0000682_1275_1571 | 98 |
| 528 | 3300053156 | Ga0500622_0001458 | Ga0500622_0001458_7943_8242 | 98 |
| 529 | 3300053156 | Ga0500622_0029990 | Ga0500622_0029990_1403_1699 | 98 |
| 530 | 3300053156 | Ga0500622_0160965 | Ga0500622_0160965_686_982 | 98 |
| 531 | 3300053158 | Ga0500627_0171786 | Ga0500627_0171786_592_888 | 98 |
| 532 | 3300053726 | Ga0500584_085249 | Ga0500584_085249_12_308 | 98 |
| 533 | 3300053730 | Ga0500645_003167 | Ga0500645_003167_3922_4224 | 98 |
| 534 | 3300053730 | Ga0500645_135043 | Ga0500645_135043_57_356 | 98 |
| 535 | 3300053735 | Ga0500596_000155 | Ga0500596_000155_7655_7951 | 98 |
| 536 | 3300055283 | Ga0500661_043802 | Ga0500661_043802_295_591 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wq2-assembly1.cif.gz_A | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.9215 | 10 | 68 |
| 6ghb-assembly2.cif.gz_D | crystal structure of spx in complex with yjbh (oxidized) | 0.9076 | 24 | 67 |
| 6ghb-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh (oxidized) | 0.8983 | 24 | 67 |
| 1wq2-assembly1.cif.gz_B | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.898 | 10 | 68 |
| 3gw2-assembly1.cif.gz_A-2 | crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e. | 0.8936 | 2 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wq2A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9215 | 10 | 68 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9185 | 10 | 66 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9152 | 22 | 68 | 3.30.230.130 |
| af_Q9VD25_77_142_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.911 | 25 | 69 | 1.10.10.10 |
| af_P32910_88_152_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9052 | 25 | 69 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1TSR8-F1-model_v4 | ArsR family transcriptional regulator | 0.9132 | 4 | 82 |
GO:0003700
GO:0005737 |
| AF-A0A257V6W3-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9045 | 2 | 82 |
GO:0003700
|
| AF-A0A532TSH1-F1-model_v4 | ArsR family transcriptional regulator | 0.9031 | 4 | 85 |
GO:0003700
|
| AF-A0A1G3L7G9-F1-model_v4 | HTH arsR-type domain-containing protein | 0.8971 | 3 | 85 |
GO:0003700
|
| AF-A0A852VR53-F1-model_v4 | DNA-binding transcriptional ArsR family regulator | 0.8963 | 2 | 82 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar