F460738

General Info

Members Datasets Scaffolds Average Seq Length
536 335 515 99

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10001272|JGI25153J46596_100012727
Length 113
Sequence MPLDTIRRLAKYDAMSKVFRALSDPTRRRVLQLLRHGPLSAGELSDQFDVSKPTMSAHFAVLKEADLVHAEKAGKSVIYHLKLSVLEEALLGFVHSFGVGEEVRAPRKKGIAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221629 Devosia sp. Root105 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221656 Pelomonas sp. Root405 Isolate Unclassified
14 2643221662 Devosia sp. Root413D1 Isolate Unclassified
15 2738541337 Pelomonas sp. BT06 Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
288 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
304 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
305 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
309 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
315 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
324 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
325 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
330 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
333 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
334 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
335 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.44
Nodule 0
Rhizoplane 4.29
Rhizosphere 62.31
Stem 0
Stem Tuber 0
Unclassified 8.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2736812 2162886007 Bacteria 4611
2 JGI24740J21852_10075146 3300001979 Bacteria 896
3 JGI24739J22299_10001183 3300001989 Bacteria 9764
4 JGI24743J22301_10118917 3300001991 Bacteria 578
5 JGI24735J21928_10003038 3300002067 Bacteria 5758
6 JGI24738J21930_10136936 3300002075 Bacteria 539
7 JGI25164J39214_1003440 3300002772 Bacteria 2014
8 JGI25152J39213_1002331 3300002773 Bacteria 7291
9 JGI25150J39212_1004882 3300002774 Bacteria 2922
10 JGI25153J46596_10001272 3300003215 Bacteria 15159
11 JGI25153J46596_10006782 3300003215 Bacteria 5737
12 JGI25153J46596_10036913 3300003215 Bacteria 1560
13 rootH1_10182079 3300003316 Bacteria 1274
14 rootH2_10079885 3300003320 Bacteria 4764
15 rootL2_10276713 3300003322 Bacteria 1541
16 rootH1_10027111 3300003323 Bacteria 9435
17 rootH1_10338797 3300003323 Bacteria 1678
18 Ga0055525_1000013 3300003759 Bacteria 440870
19 Ga0055542_1011773 3300003762 Bacteria 1538
20 Ga0055526_1003401 3300003771 Bacteria 10125
21 Ga0055524_1023360 3300003775 Bacteria 1993
22 Ga0055536_1002972 3300003781 Bacteria 9293
23 Ga0055536_1060793 3300003781 Bacteria 783
24 Ga0055528_1067848 3300003790 Bacteria 652
25 Ga0055530_10000167 3300003791 Bacteria 59916
26 Ga0055531_10000002 3300003794 Bacteria 421971
27 Ga0055531_10000896 3300003794 Bacteria 24336
28 Ga0055531_10112652 3300003794 Bacteria 541
29 Ga0055543_1075536 3300004625 Bacteria 524
30 Ga0065165_1001318 3300005262 Bacteria 27669
31 Ga0065165_1038550 3300005262 Bacteria 1439
32 Ga0065165_1138841 3300005262 Bacteria 576
33 Ga0065165_1152313 3300005262 Bacteria 539
34 Ga0065704_10071248 3300005289 Bacteria 12252
35 Ga0065704_10352318 3300005289 Bacteria 808
36 Ga0065715_10454941 3300005293 Bacteria 774
37 Ga0070658_11507123 3300005327 Unclassified 583
38 Ga0070676_10001392 3300005328 Bacteria 12200
39 Ga0070676_10193869 3300005328 Bacteria 1328
40 Ga0070690_100018230 3300005330 Bacteria 4236
41 Ga0070670_100132960 3300005331 Bacteria 2149
42 Ga0068869_100000033 3300005334 Bacteria 57379
43 Ga0068869_100000585 3300005334 Bacteria 20482
44 Ga0068869_100042537 3300005334 Bacteria 3257
45 Ga0068868_100001180 3300005338 Bacteria 17892
46 Ga0068868_101594966 3300005338 Bacteria 613
47 Ga0070660_101037397 3300005339 Bacteria 693
48 Ga0070687_100449152 3300005343 Bacteria 857
49 Ga0070661_101878784 3300005344 Bacteria 509
50 Ga0070668_100698212 3300005347 Bacteria 895
51 Ga0070675_100022171 3300005354 Bacteria 5073
52 Ga0070675_100180853 3300005354 Bacteria 1823
53 Ga0070674_101756344 3300005356 Bacteria 562
54 Ga0070673_100000001 3300005364 Bacteria 239842
55 Ga0070673_100001138 3300005364 Bacteria 15291
56 Ga0070673_100573264 3300005364 Unclassified 1027
57 Ga0070673_101277086 3300005364 Bacteria 689
58 Ga0070659_100003135 3300005366 Bacteria 11766
59 Ga0070659_100191651 3300005366 Bacteria 1680
60 Ga0070659_102149875 3300005366 Bacteria 502
61 Ga0070667_100016302 3300005367 Bacteria 6146
62 Ga0070663_100337894 3300005455 Bacteria 1216
63 Ga0070663_101895823 3300005455 Bacteria 535
64 Ga0070662_100000441 3300005457 Bacteria 24553
65 Ga0068867_100006941 3300005459 Bacteria 8012
66 Ga0068867_100007822 3300005459 Bacteria 7560
67 Ga0068867_100024268 3300005459 Bacteria 4345
68 Ga0068853_100015751 3300005539 Bacteria 6210
69 Ga0068853_101643761 3300005539 Bacteria 622
70 Ga0070672_100121273 3300005543 Bacteria 2140
71 Ga0070693_100452927 3300005547 Bacteria 901
72 Ga0070665_100010366 3300005548 Bacteria 9430
73 Ga0070665_100597176 3300005548 Bacteria 1117
74 Ga0068855_101272769 3300005563 Bacteria 762
75 Ga0068857_100683552 3300005577 Bacteria 974
76 Ga0068854_101186868 3300005578 Bacteria 683
77 Ga0068854_101331747 3300005578 Bacteria 647
78 Ga0068854_101437099 3300005578 Bacteria 624
79 Ga0068854_101753741 3300005578 Bacteria 568
80 Ga0068856_100396322 3300005614 Bacteria 1400
81 Ga0068859_101078247 3300005617 Bacteria 883
82 Ga0068864_101701361 3300005618 Bacteria 635
83 Ga0068864_101706788 3300005618 Bacteria 634
84 Ga0068866_10034076 3300005718 Bacteria 2477
85 Ga0068861_101240571 3300005719 Bacteria 722
86 Ga0068851_10014275 3300005834 Bacteria 3770
87 Ga0068851_10396686 3300005834 Bacteria 811
88 Ga0068870_10359823 3300005840 Bacteria 936
89 Ga0068858_100002113 3300005842 Bacteria 20168
90 Ga0068862_100480030 3300005844 Bacteria 1176
91 Ga0081455_10655614 3300005937 Bacteria 675
92 Ga0075368_10038279 3300006042 Bacteria 1877
93 Ga0075363_100202401 3300006048 Bacteria 1135
94 Ga0075363_100563853 3300006048 Bacteria 680
95 Ga0075367_10000083 3300006178 Bacteria 25187
96 Ga0075367_11045040 3300006178 Bacteria 522
97 Ga0075366_10101612 3300006195 Bacteria 1725
98 Ga0075366_10150500 3300006195 Bacteria 1409
99 Ga0097621_101632394 3300006237 Bacteria 613
100 Ga0075370_10070179 3300006353 Bacteria 2004
101 Ga0068871_100146807 3300006358 Bacteria 2009
102 Ga0068871_100911099 3300006358 Bacteria 815
103 Ga0068865_100000078 3300006881 Bacteria 51512
104 Ga0068865_100120598 3300006881 Bacteria 1949
105 Ga0068865_100607367 3300006881 Bacteria 925
106 Ga0097620_101078535 3300006931 Bacteria 883
107 Ga0105240_10057515 3300009093 Bacteria 4858
108 Ga0105240_10234423 3300009093 Bacteria 2131
109 Ga0105240_10527867 3300009093 Bacteria 1309
110 Ga0105245_10000529 3300009098 Bacteria 35001
111 Ga0105245_10001532 3300009098 Bacteria 20946
112 Ga0105245_13135511 3300009098 Bacteria 512
113 Ga0105243_10004390 3300009148 Bacteria 11157
114 Ga0105243_10057983 3300009148 Bacteria 3085
115 Ga0105243_10123717 3300009148 Bacteria 2185
116 Ga0105241_12329064 3300009174 Bacteria 533
117 Ga0105242_10002194 3300009176 Bacteria 15417
118 Ga0105242_10580279 3300009176 Bacteria 1080
119 Ga0105242_11281774 3300009176 Bacteria 756
120 Ga0105248_10001159 3300009177 Bacteria 29428
121 Ga0105237_10489066 3300009545 Bacteria 1237
122 Ga0105237_12042638 3300009545 Bacteria 582
123 Ga0105238_10027548 3300009551 Bacteria 5792
124 Ga0105238_10391830 3300009551 Bacteria 1381
125 Ga0105238_10599187 3300009551 Bacteria 1110
126 Ga0105249_10033345 3300009553 Bacteria 4662
127 Ga0105249_13361060 3300009553 Bacteria 515
128 Ga0105239_10030351 3300010375 Bacteria 5943
129 Ga0105239_10223035 3300010375 Bacteria 2114
130 Ga0105246_10000923 3300011119 Bacteria 16832
131 Ga0105246_10008877 3300011119 Bacteria 6186
132 Ga0157371_10002150 3300013102 Bacteria 19210
133 Ga0157370_10000056 3300013104 Bacteria 118279
134 Ga0157369_10003565 3300013105 Bacteria 18495
135 Ga0157369_10047585 3300013105 Bacteria 4655
136 Ga0157374_10009868 3300013296 Bacteria 8196
137 Ga0157374_10147985 3300013296 Bacteria 2282
138 Ga0157374_12381982 3300013296 Bacteria 557
139 Ga0157378_10005832 3300013297 Bacteria 10797
140 Ga0157378_10091580 3300013297 Bacteria 2765
141 Ga0157378_12055049 3300013297 Bacteria 622
142 Ga0163162_11252296 3300013306 Bacteria 842
143 Ga0163162_12417299 3300013306 Bacteria 604
144 Ga0157372_11537769 3300013307 Bacteria 766
145 Ga0157375_10004502 3300013308 Bacteria 12116
146 Ga0157375_12377419 3300013308 Bacteria 632
147 Ga0157380_12951369 3300014326 Bacteria 542
148 Ga0157377_10005234 3300014745 Bacteria 6073
149 Ga0157376_10001712 3300014969 Bacteria 14592
150 Ga0157376_12887462 3300014969 Bacteria 520
151 Ga0163161_10715897 3300017792 Bacteria 835
152 Ga0213872_10000172 3300021361 Bacteria 58334
153 Ga0213872_10013414 3300021361 Bacteria 3839
154 Ga0209674_109371 3300025226 Bacteria 1094
155 Ga0209563_100025 3300025230 Bacteria 596456
156 Ga0207427_100931 3300025231 Bacteria 12483
157 Ga0207425_1000131 3300025245 Bacteria 68511
158 Ga0207425_1056314 3300025245 Bacteria 704
159 Ga0209026_1011815 3300025250 Bacteria 1549
160 Ga0209148_1000332 3300025254 Bacteria 64492
161 Ga0209148_1022003 3300025254 Bacteria 1029
162 Ga0209129_1000075 3300025258 Bacteria 201273
163 Ga0209129_1008618 3300025258 Bacteria 2812
164 Ga0209565_1000332 3300025263 Bacteria 42136
165 Ga0209673_1000523 3300025273 Bacteria 62816
166 Ga0209673_1033257 3300025273 Bacteria 1576
167 Ga0207673_1005779 3300025290 Bacteria 1517
168 Ga0209675_1015162 3300025291 Bacteria 2305
169 Ga0209676_1000086 3300025292 Bacteria 264155
170 Ga0209676_1005342 3300025292 Bacteria 6761
171 Ga0209564_1000046 3300025295 Bacteria 373787
172 Ga0209564_1026721 3300025295 Bacteria 1897
173 Ga0209758_1000052 3300025297 Bacteria 338962
174 Ga0209758_1000287 3300025297 Bacteria 99234
175 Ga0209758_1016468 3300025297 Bacteria 3752
176 Ga0209050_1000039 3300025298 Bacteria 410069
177 Ga0209050_1003202 3300025298 Bacteria 12395
178 Ga0209256_1003899 3300025299 Bacteria 9870
179 Ga0209256_1005097 3300025299 Bacteria 7798
180 Ga0209256_1007063 3300025299 Bacteria 5682
181 Ga0209256_1032603 3300025299 Bacteria 1411
182 Ga0209051_1050566 3300025303 Bacteria 1391
183 Ga0209257_1000049 3300025304 Bacteria 441224
184 Ga0209257_1000051 3300025304 Bacteria 434166
185 Ga0209257_1015881 3300025304 Bacteria 3091
186 Ga0209257_1085851 3300025304 Bacteria 797
187 Ga0207656_10005766 3300025321 Bacteria 4406
188 Ga0207688_10619541 3300025901 Bacteria 683
189 Ga0207647_10476709 3300025904 Bacteria 697
190 Ga0207645_10001428 3300025907 Bacteria 19558
191 Ga0207645_10292979 3300025907 Bacteria 1082
192 Ga0207643_10341411 3300025908 Bacteria 939
193 Ga0207643_10528321 3300025908 Bacteria 756
194 Ga0207654_10582487 3300025911 Bacteria 797
195 Ga0207695_10057651 3300025913 Bacteria 4034
196 Ga0207695_10067305 3300025913 Bacteria 3674
197 Ga0207671_10644109 3300025914 Bacteria 844
198 Ga0207662_10047693 3300025918 Bacteria 2537
199 Ga0207657_10839498 3300025919 Bacteria 709
200 Ga0207649_10099226 3300025920 Bacteria 1923
201 Ga0207681_10356034 3300025923 Bacteria 1173
202 Ga0207694_10333006 3300025924 Bacteria 1254
203 Ga0207694_10831463 3300025924 Bacteria 780
204 Ga0207650_10357359 3300025925 Bacteria 1203
205 Ga0207659_10842996 3300025926 Bacteria 788
206 Ga0207687_10000580 3300025927 Bacteria 24742
207 Ga0207687_10009324 3300025927 Bacteria 6420
208 Ga0207687_11842274 3300025927 Bacteria 517
209 Ga0207690_10080528 3300025932 Bacteria 2273
210 Ga0207686_10022514 3300025934 Bacteria 3630
211 Ga0207709_10001739 3300025935 Bacteria 14660
212 Ga0207709_10033031 3300025935 Bacteria 3034
213 Ga0207709_10102499 3300025935 Bacteria 1895
214 Ga0207709_11430758 3300025935 Bacteria 573
215 Ga0207704_10000090 3300025938 Bacteria 53065
216 Ga0207704_10105724 3300025938 Bacteria 1889
217 Ga0207691_10064421 3300025940 Bacteria 3321
218 Ga0207691_10147694 3300025940 Bacteria 2068
219 Ga0207689_10006914 3300025942 Bacteria 9978
220 Ga0207689_10043592 3300025942 Bacteria 3709
221 Ga0207689_11250952 3300025942 Bacteria 624
222 Ga0207667_10251618 3300025949 Bacteria 1807
223 Ga0207667_10428206 3300025949 Bacteria 1346
224 Ga0207651_10000001 3300025960 Bacteria 516823
225 Ga0207651_11284819 3300025960 Bacteria 658
226 Ga0207712_10019779 3300025961 Bacteria 4400
227 Ga0207668_11389680 3300025972 Bacteria 633
228 Ga0207640_11679082 3300025981 Bacteria 573
229 Ga0207640_12008003 3300025981 Bacteria 524
230 Ga0207658_10678286 3300025986 Bacteria 930
231 Ga0207677_10000016 3300026023 Bacteria 153771
232 Ga0207703_10001637 3300026035 Bacteria 20186
233 Ga0207639_10050398 3300026041 Bacteria 3162
234 Ga0207639_10254507 3300026041 Bacteria 1533
235 Ga0207678_10335663 3300026067 Bacteria 1302
236 Ga0207678_11112074 3300026067 Bacteria 700
237 Ga0207702_10336571 3300026078 Bacteria 1441
238 Ga0207702_11583182 3300026078 Bacteria 648
239 Ga0207648_10005425 3300026089 Bacteria 12850
240 Ga0207648_10008458 3300026089 Bacteria 9962
241 Ga0207676_11910516 3300026095 Bacteria 592
242 Ga0207674_10886641 3300026116 Bacteria 860
243 Ga0207683_10467799 3300026121 Bacteria 1163
244 Ga0209813_10000043 3300027866 Bacteria 51426
245 Ga0209974_10365157 3300027876 Bacteria 562
246 Ga0209974_10402231 3300027876 Bacteria 538
247 Ga0268266_10005532 3300028379 Bacteria 11761
248 Ga0268266_12074212 3300028379 Bacteria 542
249 Ga0307517_10019346 3300028786 Bacteria 8744
250 Ga0307515_10053013 3300028794 Bacteria 5998
251 Ga0307515_10113322 3300028794 Bacteria 3145
252 Ga0307515_10284843 3300028794 Bacteria 1355
253 Ga0265338_10048741 3300028800 Bacteria 3850
254 Ga0265338_10140397 3300028800 Bacteria 1893
255 Ga0316182_1131368 3300030745 Bacteria 870
256 Ga0265327_10000290 3300031251 Bacteria 98475
257 Ga0265327_10000702 3300031251 Bacteria 53097
258 Ga0307513_10147629 3300031456 Bacteria 2267
259 Ga0307513_10636155 3300031456 Bacteria 774
260 Ga0265314_10003206 3300031711 Bacteria 16012
261 Ga0265342_10618058 3300031712 Bacteria 546
262 Ga0307405_11749400 3300031731 Bacteria 552
263 Ga0307413_10121332 3300031824 Bacteria 1771
264 Ga0307413_10220281 3300031824 Bacteria 1386
265 Ga0307413_10396785 3300031824 Bacteria 1080
266 Ga0307413_11083508 3300031824 Bacteria 691
267 Ga0307410_10045490 3300031852 Bacteria 2923
268 Ga0307410_10143015 3300031852 Bacteria 1772
269 Ga0307406_10989903 3300031901 Bacteria 721
270 Ga0307407_10600143 3300031903 Bacteria 820
271 Ga0307412_12060284 3300031911 Bacteria 529
272 Ga0307409_100038700 3300031995 Bacteria 3530
273 Ga0307409_100293277 3300031995 Bacteria 1509
274 Ga0307416_103866628 3300032002 Bacteria 501
275 Ga0307414_10010314 3300032004 Bacteria 5413
276 Ga0307414_10052971 3300032004 Bacteria 2827
277 Ga0307414_10085765 3300032004 Bacteria 2321
278 Ga0307414_10116115 3300032004 Bacteria 2048
279 Ga0307414_10357257 3300032004 Bacteria 1256
280 Ga0307414_10399930 3300032004 Bacteria 1193
281 Ga0307414_10547886 3300032004 Bacteria 1030
282 Ga0307414_10767849 3300032004 Bacteria 877
283 Ga0307414_10910841 3300032004 Bacteria 806
284 Ga0307414_11554518 3300032004 Bacteria 616
285 Ga0307411_10073937 3300032005 Bacteria 2320
286 Ga0307411_10100595 3300032005 Bacteria 2043
287 Ga0307411_10130612 3300032005 Bacteria 1835
288 Ga0307510_10059467 3300033180 Bacteria 3946
289 Ga0373937_1100562 3300036401 Bacteria 743
290 Ga0395899_0000003 3300037312 Bacteria 1232684
291 Ga0395899_0000396 3300037312 Bacteria 51696
292 Ga0395899_0064555 3300037312 Unclassified 2692
293 Ga0395900_0022028 3300037418 Bacteria 6517
294 Ga0395900_0107277 3300037418 Unclassified 2869
295 Ga0395900_1556749 3300037418 Bacteria 573
296 Ga0395898_0418021 3300037466 Unclassified 1278
297 Ga0395905_0023541 3300037471 Bacteria 5819
298 Ga0395905_0046113 3300037471 Unclassified 4087
299 Ga0395905_0170727 3300037471 Bacteria 2043
300 Ga0395905_0242517 3300037471 Bacteria 1684
301 Ga0395905_0284048 3300037471 Bacteria 1541
302 Ga0395905_1695993 3300037471 Bacteria 537
303 Ga0436364_0060956 3300037853 Bacteria 741
304 Ga0436364_1262744 3300037853 Bacteria 898
305 Ga0436364_1361719 3300037853 Bacteria 573
306 Ga0395901_0104646 3300038443 Unclassified 2970
307 Ga0436360_0958655 3300039438 Bacteria 1126
308 Ga0436361_0046862 3300039447 Bacteria 14392
309 Ga0436361_0167979 3300039447 Bacteria 86419
310 Ga0436361_0375780 3300039447 Bacteria 2453
311 Ga0436361_0801110 3300039447 Bacteria 8625
312 Ga0436361_1065063 3300039447 Bacteria 1824
313 Ga0439461_0000039 3300041410 Bacteria 16229
314 Ga0439465_0000942 3300041413 Bacteria 9220
315 Ga0439465_0080580 3300041413 Bacteria 1103
316 Ga0451787_822558 3300041441 Bacteria 669
317 Ga0451789_0139606 3300041443 Bacteria 767
318 Ga0451789_0925911 3300041443 Bacteria 980
319 Ga0451791_1437851 3300041451 Bacteria 873
320 Ga0451793_0951445 3300041452 Bacteria 1200
321 Ga0451797_1017601 3300041453 Bacteria 804
322 Ga0451795_1411656 3300041456 Bacteria 2045
323 Ga0451798_0809346 3300041458 Bacteria 823
324 Ga0451800_1237296 3300041459 Bacteria 3056
325 Ga0451804_0035446 3300041463 Bacteria 4630
326 Ga0451804_0086716 3300041463 Bacteria 594
327 Ga0451807_0828075 3300041486 Bacteria 507
328 Ga0451807_1637974 3300041486 Bacteria 844
329 Ga0451837_0051540 3300041494 Bacteria 1536
330 Ga0451837_1068148 3300041494 Bacteria 1287
331 Ga0451851_0076720 3300041507 Bacteria 831
332 Ga0451843_0000599 3300041509 Bacteria 1522
333 Ga0451843_1174303 3300041509 Bacteria 514
334 Ga0451853_0513266 3300041512 Bacteria 647
335 Ga0451853_1089291 3300041512 Bacteria 1130
336 Ga0439431_0000534 3300041997 Bacteria 8052
337 Ga0439442_002952 3300042002 Bacteria 3353
338 Ga0439445_0000291 3300042004 Bacteria 9728
339 Ga0439448_0023672 3300042005 Bacteria 1918
340 Ga0439432_000049 3300042006 Bacteria 36738
341 Ga0439449_0065406 3300042007 Bacteria 1341
342 Ga0439462_0000923 3300042015 Bacteria 6220
343 Ga0466969_0001050 3300044656 Bacteria 14907
344 Ga0466966_0000221 3300044684 Bacteria 38296
345 Ga0466961_0000899 3300044693 Bacteria 18467
346 Ga0466971_0000345 3300044719 Bacteria 17795
347 Ga0466970_0013168 3300044765 Bacteria 4238
348 Ga0466957_0002771 3300044842 Bacteria 9481
349 Ga0466959_0000451 3300045049 Bacteria 23920
350 Ga0451576_1008262 3300045051 Bacteria 873
351 Ga0466967_1079561 3300045976 Bacteria 800
352 Ga0495590_0003562 3300046457 Bacteria 6340
353 Ga0495629_0291535 3300046459 Bacteria 1118
354 Ga0495638_0000478 3300046460 Bacteria 47960
355 Ga0495638_0000500 3300046460 Bacteria 46497
356 Ga0495638_0001983 3300046460 Bacteria 17473
357 Ga0495638_0156316 3300046460 Bacteria 1319
358 Ga0495638_0406245 3300046460 Bacteria 705
359 Ga0495650_0000068 3300046471 Bacteria 266671
360 Ga0495650_0000196 3300046471 Bacteria 131306
361 Ga0495650_0010372 3300046471 Bacteria 5203
362 Ga0495650_0106021 3300046471 Bacteria 1049
363 Ga0495583_0000122 3300046506 Bacteria 132255
364 Ga0495606_0093367 3300046507 Bacteria 1846
365 Ga0495610_0000534 3300046512 Bacteria 38300
366 Ga0495610_0009932 3300046512 Bacteria 5954
367 Ga0495610_0386521 3300046512 Bacteria 519
368 Ga0495616_0064198 3300046513 Bacteria 1792
369 Ga0495616_0099401 3300046513 Bacteria 1366
370 Ga0495616_0404895 3300046513 Bacteria 560
371 Ga0495628_0877590 3300046516 Bacteria 624
372 Ga0495631_0016339 3300046518 Bacteria 3541
373 Ga0495632_0093217 3300046519 Bacteria 1425
374 Ga0495632_0212570 3300046519 Bacteria 877
375 Ga0495637_0084203 3300046520 Bacteria 1263
376 Ga0495637_0241355 3300046520 Bacteria 652
377 Ga0495643_0225919 3300046522 Bacteria 885
378 Ga0495644_0121441 3300046523 Bacteria 994
379 Ga0495648_0000389 3300046524 Bacteria 48263
380 Ga0495648_0023826 3300046524 Bacteria 4181
381 Ga0495648_0179807 3300046524 Bacteria 1076
382 Ga0495663_0026945 3300046525 Bacteria 1684
383 Ga0495663_0171104 3300046525 Bacteria 749
384 Ga0495666_0355129 3300046526 Bacteria 660
385 Ga0495654_0000051 3300046530 Bacteria 145932
386 Ga0495654_0098467 3300046530 Bacteria 1349
387 Ga0495587_0013979 3300046536 Bacteria 5039
388 Ga0495622_0002767 3300046557 Bacteria 8383
389 Ga0495633_0032350 3300046558 Bacteria 2528
390 Ga0495668_0006012 3300046616 Bacteria 8053
391 Ga0495668_0037735 3300046616 Bacteria 2703
392 Ga0495625_0000876 3300046660 Bacteria 40885
393 Ga0495625_0002001 3300046660 Bacteria 22996
394 Ga0495625_0002592 3300046660 Bacteria 19355
395 Ga0495625_0007475 3300046660 Bacteria 9500
396 Ga0495625_0023099 3300046660 Bacteria 4755
397 Ga0495625_0028435 3300046660 Bacteria 4192
398 Ga0495625_0037594 3300046660 Bacteria 3550
399 Ga0495661_0095747 3300046665 Bacteria 1680
400 Ga0495658_0775569 3300046683 Bacteria 614
401 Ga0495670_0000033 3300046691 Bacteria 81716
402 Ga0495670_0143723 3300046691 Bacteria 1249
403 Ga0495649_0387705 3300046694 Bacteria 702
404 Ga0495600_0042379 3300046809 Bacteria 2967
405 Ga0495604_0902912 3300047317 Bacteria 552
406 Ga0495636_0233253 3300047318 Bacteria 847
407 Ga0495683_0143548 3300047323 Bacteria 1117
408 Ga0495679_009923 3300047446 Bacteria 3776
409 Ga0495673_0000420 3300047469 Bacteria 48299
410 Ga0495673_0016299 3300047469 Bacteria 3802
411 Ga0495681_0136649 3300047470 Bacteria 1039
412 Ga0495681_0150112 3300047470 Bacteria 978
413 Ga0495681_0209914 3300047470 Bacteria 785
414 Ga0495686_0000164 3300047472 Bacteria 126101
415 Ga0495686_0009474 3300047472 Bacteria 7010
416 Ga0495686_0038556 3300047472 Bacteria 3055
417 Ga0495615_0049315 3300048090 Bacteria 1079
418 Ga0496102_0916790 3300048905 Bacteria 798
419 Ga0496105_0866277 3300048908 Bacteria 683
420 Ga0496106_0974155 3300048909 Bacteria 668
421 Ga0496107_0621367 3300048910 Bacteria 798
422 Ga0496108_1603106 3300048911 Bacteria 539
423 Ga0496109_0831055 3300048912 Bacteria 862
424 Ga0496114_0106473 3300048917 Bacteria 2399
425 Ga0496114_1384996 3300048917 Bacteria 591
426 Ga0496115_0004250 3300048918 Bacteria 10357
427 Ga0496115_0006370 3300048918 Bacteria 8647
428 Ga0496117_0343017 3300048920 Bacteria 774
429 Ga0496118_0009455 3300048921 Bacteria 9842
430 Ga0496120_0135823 3300048923 Bacteria 1254
431 Ga0496122_0003882 3300048925 Bacteria 19164
432 Ga0496123_0004295 3300048926 Bacteria 15142
433 Ga0496126_0022494 3300048929 Bacteria 6134
434 Ga0496126_0241664 3300048929 Bacteria 1508
435 Ga0496126_0373697 3300048929 Bacteria 1162
436 Ga0496126_0653427 3300048929 Bacteria 822
437 Ga0496126_0866690 3300048929 Bacteria 687
438 Ga0495678_006172 3300049459 Bacteria 6423
439 Ga0501033_0564832 3300049570 Bacteria 783
440 Ga0501034_1370757 3300049571 Bacteria 583
441 Ga0501238_001405 3300049671 Bacteria 2792
442 Ga0501241_014161 3300049758 Bacteria 1449
443 Ga0501241_051977 3300049758 Bacteria 811
444 Ga0501035_0246319 3300049822 Bacteria 1519
445 nmdc:mga03n38_26584_c1 3300050490 Bacteria 2391
446 nmdc:mga0k408_567105_c1 3300050493 Bacteria 670
447 nmdc:mga0k408_93449_c1 3300050493 Bacteria 1768
448 nmdc:mga06z11_56_c1 3300050494 Bacteria 48168
449 nmdc:mga06z11_667900_c1 3300050494 Bacteria 633
450 nmdc:mga04h51_99_c1 3300050495 Bacteria 26211
451 nmdc:mga07m45_125786_c1 3300050496 Bacteria 1482
452 nmdc:mga0rr50_1099666_c1 3300050513 Bacteria 676
453 Ga0500578_0009669 3300053086 Bacteria 6259
454 Ga0500643_002645 3300053087 Bacteria 9052
455 Ga0500643_026043 3300053087 Bacteria 1836
456 Ga0500643_033461 3300053087 Bacteria 1554
457 Ga0500643_095655 3300053087 Bacteria 808
458 Ga0500644_0000046 3300053088 Bacteria 73850
459 Ga0500644_0014985 3300053088 Bacteria 2199
460 Ga0500644_0100689 3300053088 Bacteria 1097
461 Ga0500646_0000881 3300053090 Bacteria 8275
462 Ga0500646_0207621 3300053090 Bacteria 675
463 Ga0500646_0283928 3300053090 Bacteria 590
464 Ga0500583_0042065 3300053092 Bacteria 2080
465 Ga0500651_0036779 3300053093 Bacteria 3084
466 Ga0500651_0372704 3300053093 Bacteria 806
467 Ga0500566_0164461 3300053094 Bacteria 1153
468 Ga0500641_0104220 3300053096 Bacteria 1218
469 Ga0500650_0005141 3300053098 Bacteria 4834
470 Ga0500554_004877 3300053102 Bacteria 2883
471 Ga0500555_105332 3300053103 Bacteria 713
472 Ga0500556_0002085 3300053104 Bacteria 6875
473 Ga0500556_0339619 3300053104 Bacteria 583
474 Ga0500562_006292 3300053108 Bacteria 2995
475 Ga0500594_0000812 3300053118 Bacteria 6668
476 Ga0500595_001959 3300053119 Bacteria 10581
477 Ga0500607_080950 3300053121 Bacteria 1656
478 Ga0500614_008918 3300053123 Bacteria 2133
479 Ga0500618_000064 3300053125 Bacteria 91120
480 Ga0500623_142026 3300053127 Bacteria 1006
481 Ga0500628_000584 3300053129 Bacteria 6666
482 Ga0500642_0000002 3300053130 Bacteria 795093
483 Ga0500642_0001707 3300053130 Bacteria 6334
484 Ga0500652_000108 3300053131 Bacteria 32608
485 Ga0500652_290617 3300053131 Bacteria 635
486 Ga0500655_021563 3300053133 Bacteria 1208
487 Ga0500655_049691 3300053133 Bacteria 834
488 Ga0500658_0007011 3300053134 Bacteria 4169
489 Ga0500658_0288133 3300053134 Bacteria 755
490 Ga0500559_0008081 3300053136 Bacteria 4629
491 Ga0500559_0062639 3300053136 Bacteria 1661
492 Ga0500559_0172435 3300053136 Bacteria 1017
493 Ga0500564_000125 3300053138 Bacteria 19515
494 Ga0500568_0004910 3300053139 Bacteria 7040
495 Ga0500573_0041383 3300053140 Bacteria 2660
496 Ga0500579_132331 3300053143 Bacteria 1161
497 Ga0500589_257988 3300053147 Bacteria 636
498 Ga0500589_332379 3300053147 Bacteria 527
499 Ga0500604_0000062 3300053151 Bacteria 39474
500 Ga0500604_0001250 3300053151 Bacteria 7088
501 Ga0500616_0000087 3300053153 Bacteria 192225
502 Ga0500622_0000682 3300053156 Bacteria 30044
503 Ga0500622_0001458 3300053156 Bacteria 18891
504 Ga0500622_0029990 3300053156 Bacteria 2857
505 Ga0500622_0160965 3300053156 Bacteria 1052
506 Ga0500627_0155497 3300053158 Bacteria 1032
507 Ga0500627_0171786 3300053158 Bacteria 976
508 Ga0500584_085249 3300053726 Bacteria 1341
509 Ga0500645_000064 3300053730 Bacteria 84824
510 Ga0500645_003167 3300053730 Bacteria 6836
511 Ga0500645_135043 3300053730 Bacteria 684
512 Ga0500596_000155 3300053735 Bacteria 10552
513 Ga0500587_000479 3300053739 Bacteria 4790
514 Ga0500661_043802 3300055283 Bacteria 794
515 Ga0466962_0082210 3300061719 Bacteria 1540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0000068 Ga0495650_0000068_151594_151902 90
2 3300046513 Ga0495616_0404895 Ga0495616_0404895_86_394 90
3 3300046524 Ga0495648_0023826 Ga0495648_0023826_1510_1818 90
4 3300046525 Ga0495663_0026945 Ga0495663_0026945_1185_1493 90
5 3300046530 Ga0495654_0000051 Ga0495654_0000051_30838_31146 90
6 3300046660 Ga0495625_0037594 Ga0495625_0037594_2596_2904 90
7 3300047470 Ga0495681_0150112 Ga0495681_0150112_268_576 90
8 3300053158 Ga0500627_0155497 Ga0500627_0155497_283_591 90
9 3300005328 Ga0070676_10193869 Ga0070676_101938692 91
10 3300005347 Ga0070668_100698212 Ga0070668_1006982122 91
11 3300005455 Ga0070663_100337894 Ga0070663_1003378942 91
12 3300005459 Ga0068867_100024268 Ga0068867_1000242687 91
13 3300005548 Ga0070665_100597176 Ga0070665_1005971762 91
14 3300005834 Ga0068851_10014275 Ga0068851_100142752 91
15 3300025321 Ga0207656_10005766 Ga0207656_100057664 91
16 3300025907 Ga0207645_10292979 Ga0207645_102929791 91
17 3300026041 Ga0207639_10254507 Ga0207639_102545074 91
18 3300026067 Ga0207678_10335663 Ga0207678_103356632 91
19 3300026089 Ga0207648_10008458 Ga0207648_100084587 91
20 3300005578 Ga0068854_101331747 Ga0068854_1013317472 92
21 3300025940 Ga0207691_10064421 Ga0207691_100644215 92
22 3300025972 Ga0207668_11389680 Ga0207668_113896802 92
23 3300027876 Ga0209974_10365157 Ga0209974_103651571 92
24 iso_pu_bacteria 2585428058 2587736255 93
25 3300031901 Ga0307406_10989903 Ga0307406_109899032 94
26 3300031911 Ga0307412_12060284 Ga0307412_120602841 94
27 3300032002 Ga0307416_103866628 Ga0307416_1038666281 94
28 3300045976 Ga0466967_1079561 Ga0466967_1079561_303_596 94
29 iso_pu_bacteria 2512564014 2512641822 94
30 iso_pu_bacteria 2582581279 2585147828 94
31 iso_pu_bacteria 2643221579 2643907963 94
32 iso_pu_bacteria 2643221581 2643915831 94
33 iso_pu_bacteria 2643221585 2643936094 94
34 iso_pu_bacteria 2643221625 2644141390 94
35 iso_pu_bacteria 2643221629 2644165598 94
36 iso_pu_bacteria 2643221639 2644221858 94
37 iso_pu_bacteria 2643221646 2644257349 94
38 iso_pu_bacteria 2643221648 2644274302 94
39 iso_pu_bacteria 2643221656 2644316739 94
40 iso_pu_bacteria 2643221662 2644348518 94
41 iso_pu_bacteria 2738541337 2739053408 94
42 iso_pu_bacteria 2791355048 2792460189 94
43 iso_pu_bacteria 2843744320 2843746758 94
44 iso_pu_bacteria 2849560528 2849562841 94
45 iso_pu_bacteria 2849573788 2849576732 94
46 iso_pu_bacteria 2851153111 2851154041 94
47 iso_pu_bacteria 2894414249 2894417806 94
48 iso_pu_bacteria 2898329390 2898333348 94
49 3300005327 Ga0070658_11507123 Ga0070658_115071231 95
50 3300005364 Ga0070673_100573264 Ga0070673_1005732643 95
51 3300013308 Ga0157375_12377419 Ga0157375_123774192 95
52 3300025250 Ga0209026_1011815 Ga0209026_10118152 95
53 3300032004 Ga0307414_10399930 Ga0307414_103999302 95
54 3300037853 Ga0436364_1262744 Ga0436364_1262744_301_597 95
55 3300046513 Ga0495616_0099401 Ga0495616_0099401_486_782 95
56 3300041458 Ga0451798_0809346 Ga0451798_0809346_386_685 96
57 3300044656 Ga0466969_0001050 Ga0466969_0001050_13415_13717 96
58 3300044684 Ga0466966_0000221 Ga0466966_0000221_7490_7792 96
59 3300044693 Ga0466961_0000899 Ga0466961_0000899_17379_17681 96
60 3300044719 Ga0466971_0000345 Ga0466971_0000345_5480_5782 96
61 3300044765 Ga0466970_0013168 Ga0466970_0013168_2481_2783 96
62 3300044842 Ga0466957_0002771 Ga0466957_0002771_600_902 96
63 3300045049 Ga0466959_0000451 Ga0466959_0000451_22937_23239 96
64 3300045051 Ga0451576_1008262 Ga0451576_1008262_543_839 96
65 3300048929 Ga0496126_0653427 Ga0496126_0653427_261_554 96
66 3300061719 Ga0466962_0082210 Ga0466962_0082210_997_1299 96
67 3300002773 JGI25152J39213_1002331 JGI25152J39213_10023313 97
68 3300002774 JGI25150J39212_1004882 JGI25150J39212_10048823 97
69 3300003215 JGI25153J46596_10006782 JGI25153J46596_100067825 97
70 3300003323 rootH1_10027111 rootH1_100271114 97
71 3300003771 Ga0055526_1003401 Ga0055526_10034012 97
72 3300003790 Ga0055528_1067848 Ga0055528_10678482 97
73 3300003794 Ga0055531_10112652 Ga0055531_101126521 97
74 3300005331 Ga0070670_100132960 Ga0070670_1001329602 97
75 3300005334 Ga0068869_100042537 Ga0068869_1000425375 97
76 3300005338 Ga0068868_101594966 Ga0068868_1015949662 97
77 3300005354 Ga0070675_100180853 Ga0070675_1001808532 97
78 3300005366 Ga0070659_102149875 Ga0070659_1021498751 97
79 3300005455 Ga0070663_101895823 Ga0070663_1018958231 97
80 3300005548 Ga0070665_100010366 Ga0070665_1000103668 97
81 3300005617 Ga0068859_101078247 Ga0068859_1010782472 97
82 3300005840 Ga0068870_10359823 Ga0068870_103598232 97
83 3300005937 Ga0081455_10655614 Ga0081455_106556141 97
84 3300006048 Ga0075363_100202401 Ga0075363_1002024013 97
85 3300006178 Ga0075367_11045040 Ga0075367_110450402 97
86 3300006195 Ga0075366_10101612 Ga0075366_101016122 97
87 3300006931 Ga0097620_101078535 Ga0097620_1010785352 97
88 3300017792 Ga0163161_10715897 Ga0163161_107158972 97
89 3300025245 Ga0207425_1000131 Ga0207425_100013139 97
90 3300025258 Ga0209129_1000075 Ga0209129_100007561 97
91 3300025273 Ga0209673_1033257 Ga0209673_10332572 97
92 3300025295 Ga0209564_1000046 Ga0209564_1000046225 97
93 3300025297 Ga0209758_1000052 Ga0209758_1000052238 97
94 3300025299 Ga0209256_1032603 Ga0209256_10326031 97
95 3300025304 Ga0209257_1085851 Ga0209257_10858511 97
96 3300025908 Ga0207643_10341411 Ga0207643_103414112 97
97 3300025908 Ga0207643_10528321 Ga0207643_105283212 97
98 3300025925 Ga0207650_10357359 Ga0207650_103573591 97
99 3300025926 Ga0207659_10842996 Ga0207659_108429961 97
100 3300025935 Ga0207709_10033031 Ga0207709_100330313 97
101 3300025942 Ga0207689_10043592 Ga0207689_100435925 97
102 3300025942 Ga0207689_11250952 Ga0207689_112509521 97
103 3300026067 Ga0207678_11112074 Ga0207678_111120741 97
104 3300028379 Ga0268266_10005532 Ga0268266_100055327 97
105 3300028379 Ga0268266_12074212 Ga0268266_120742121 97
106 3300041413 Ga0439465_0080580 Ga0439465_0080580_742_1050 97
107 3300041507 Ga0451851_0076720 Ga0451851_0076720_274_570 97
108 3300041512 Ga0451853_1089291 Ga0451853_1089291_321_617 97
109 3300046460 Ga0495638_0406245 Ga0495638_0406245_43_357 97
110 3300046616 Ga0495668_0037735 Ga0495668_0037735_1419_1733 97
111 3300046660 Ga0495625_0023099 Ga0495625_0023099_4290_4604 97
112 3300046694 Ga0495649_0387705 Ga0495649_0387705_276_569 97
113 3300047318 Ga0495636_0233253 Ga0495636_0233253_192_485 97
114 3300050493 nmdc:mga0k408_93449_c1 nmdc:mga0k408_93449_c1_701_997 97
115 3300053087 Ga0500643_002645 Ga0500643_002645_6233_6526 97
116 3300053087 Ga0500643_026043 Ga0500643_026043_231_545 97
117 3300053087 Ga0500643_033461 Ga0500643_033461_932_1246 97
118 3300053104 Ga0500556_0339619 Ga0500556_0339619_151_465 97
119 3300053130 Ga0500642_0000002 Ga0500642_0000002_670726_671040 97
120 3300053134 Ga0500658_0288133 Ga0500658_0288133_300_611 97
121 3300053139 Ga0500568_0004910 Ga0500568_0004910_4423_4728 97
122 3300053151 Ga0500604_0000062 Ga0500604_0000062_17841_18146 97
123 3300053153 Ga0500616_0000087 Ga0500616_0000087_16538_16843 97
124 3300053730 Ga0500645_000064 Ga0500645_000064_68183_68497 97
125 3300053739 Ga0500587_000479 Ga0500587_000479_1862_2167 97
126 2162886007 SwRhRL2b_contig_2736812 SwRhRL2b_0391.00004500 98
127 3300001979 JGI24740J21852_10075146 JGI24740J21852_100751461 98
128 3300001989 JGI24739J22299_10001183 JGI24739J22299_100011832 98
129 3300001991 JGI24743J22301_10118917 JGI24743J22301_101189172 98
130 3300002067 JGI24735J21928_10003038 JGI24735J21928_100030387 98
131 3300002075 JGI24738J21930_10136936 JGI24738J21930_101369361 98
132 3300002772 JGI25164J39214_1003440 JGI25164J39214_10034402 98
133 3300003215 JGI25153J46596_10001272 JGI25153J46596_100012727 98
134 3300003215 JGI25153J46596_10036913 JGI25153J46596_100369133 98
135 3300003316 rootH1_10182079 rootH1_101820792 98
136 3300003320 rootH2_10079885 rootH2_100798854 98
137 3300003322 rootL2_10276713 rootL2_102767131 98
138 3300003323 rootH1_10338797 rootH1_103387973 98
139 3300003759 Ga0055525_1000013 Ga0055525_1000013252 98
140 3300003762 Ga0055542_1011773 Ga0055542_10117732 98
141 3300003775 Ga0055524_1023360 Ga0055524_10233602 98
142 3300003781 Ga0055536_1002972 Ga0055536_10029725 98
143 3300003781 Ga0055536_1060793 Ga0055536_10607932 98
144 3300003791 Ga0055530_10000167 Ga0055530_1000016716 98
145 3300003794 Ga0055531_10000002 Ga0055531_10000002239 98
146 3300003794 Ga0055531_10000896 Ga0055531_1000089616 98
147 3300004625 Ga0055543_1075536 Ga0055543_10755361 98
148 3300005262 Ga0065165_1001318 Ga0065165_100131813 98
149 3300005262 Ga0065165_1038550 Ga0065165_10385502 98
150 3300005262 Ga0065165_1138841 Ga0065165_11388411 98
151 3300005262 Ga0065165_1152313 Ga0065165_11523132 98
152 3300005289 Ga0065704_10071248 Ga0065704_100712486 98
153 3300005289 Ga0065704_10352318 Ga0065704_103523181 98
154 3300005293 Ga0065715_10454941 Ga0065715_104549412 98
155 3300005328 Ga0070676_10001392 Ga0070676_1000139210 98
156 3300005330 Ga0070690_100018230 Ga0070690_1000182301 98
157 3300005334 Ga0068869_100000033 Ga0068869_10000003361 98
158 3300005334 Ga0068869_100000585 Ga0068869_10000058516 98
159 3300005338 Ga0068868_100001180 Ga0068868_1000011808 98
160 3300005339 Ga0070660_101037397 Ga0070660_1010373972 98
161 3300005343 Ga0070687_100449152 Ga0070687_1004491521 98
162 3300005344 Ga0070661_101878784 Ga0070661_1018787842 98
163 3300005354 Ga0070675_100022171 Ga0070675_1000221712 98
164 3300005356 Ga0070674_101756344 Ga0070674_1017563442 98
165 3300005364 Ga0070673_100000001 Ga0070673_100000001194 98
166 3300005364 Ga0070673_100001138 Ga0070673_10000113815 98
167 3300005364 Ga0070673_101277086 Ga0070673_1012770862 98
168 3300005366 Ga0070659_100003135 Ga0070659_1000031352 98
169 3300005366 Ga0070659_100191651 Ga0070659_1001916512 98
170 3300005367 Ga0070667_100016302 Ga0070667_10001630211 98
171 3300005457 Ga0070662_100000441 Ga0070662_1000004418 98
172 3300005459 Ga0068867_100006941 Ga0068867_1000069413 98
173 3300005459 Ga0068867_100007822 Ga0068867_1000078226 98
174 3300005539 Ga0068853_100015751 Ga0068853_1000157516 98
175 3300005539 Ga0068853_101643761 Ga0068853_1016437612 98
176 3300005543 Ga0070672_100121273 Ga0070672_1001212732 98
177 3300005547 Ga0070693_100452927 Ga0070693_1004529272 98
178 3300005563 Ga0068855_101272769 Ga0068855_1012727692 98
179 3300005577 Ga0068857_100683552 Ga0068857_1006835522 98
180 3300005578 Ga0068854_101186868 Ga0068854_1011868681 98
181 3300005578 Ga0068854_101437099 Ga0068854_1014370992 98
182 3300005578 Ga0068854_101753741 Ga0068854_1017537412 98
183 3300005614 Ga0068856_100396322 Ga0068856_1003963222 98
184 3300005618 Ga0068864_101701361 Ga0068864_1017013612 98
185 3300005618 Ga0068864_101706788 Ga0068864_1017067882 98
186 3300005718 Ga0068866_10034076 Ga0068866_100340762 98
187 3300005719 Ga0068861_101240571 Ga0068861_1012405712 98
188 3300005834 Ga0068851_10396686 Ga0068851_103966862 98
189 3300005842 Ga0068858_100002113 Ga0068858_1000021135 98
190 3300005844 Ga0068862_100480030 Ga0068862_1004800302 98
191 3300006042 Ga0075368_10038279 Ga0075368_100382793 98
192 3300006048 Ga0075363_100563853 Ga0075363_1005638532 98
193 3300006178 Ga0075367_10000083 Ga0075367_1000008320 98
194 3300006195 Ga0075366_10150500 Ga0075366_101505003 98
195 3300006237 Ga0097621_101632394 Ga0097621_1016323942 98
196 3300006353 Ga0075370_10070179 Ga0075370_100701793 98
197 3300006358 Ga0068871_100146807 Ga0068871_1001468074 98
198 3300006358 Ga0068871_100911099 Ga0068871_1009110992 98
199 3300006881 Ga0068865_100000078 Ga0068865_1000000784 98
200 3300006881 Ga0068865_100120598 Ga0068865_1001205982 98
201 3300006881 Ga0068865_100607367 Ga0068865_1006073672 98
202 3300009093 Ga0105240_10057515 Ga0105240_100575155 98
203 3300009093 Ga0105240_10234423 Ga0105240_102344231 98
204 3300009093 Ga0105240_10527867 Ga0105240_105278672 98
205 3300009098 Ga0105245_10000529 Ga0105245_1000052914 98
206 3300009098 Ga0105245_10001532 Ga0105245_1000153219 98
207 3300009098 Ga0105245_13135511 Ga0105245_131355112 98
208 3300009148 Ga0105243_10004390 Ga0105243_100043908 98
209 3300009148 Ga0105243_10057983 Ga0105243_100579834 98
210 3300009148 Ga0105243_10123717 Ga0105243_101237172 98
211 3300009174 Ga0105241_12329064 Ga0105241_123290641 98
212 3300009176 Ga0105242_10002194 Ga0105242_1000219411 98
213 3300009176 Ga0105242_10580279 Ga0105242_105802791 98
214 3300009176 Ga0105242_11281774 Ga0105242_112817742 98
215 3300009177 Ga0105248_10001159 Ga0105248_1000115922 98
216 3300009545 Ga0105237_10489066 Ga0105237_104890662 98
217 3300009545 Ga0105237_12042638 Ga0105237_120426382 98
218 3300009551 Ga0105238_10027548 Ga0105238_100275487 98
219 3300009551 Ga0105238_10391830 Ga0105238_103918304 98
220 3300009551 Ga0105238_10599187 Ga0105238_105991872 98
221 3300009553 Ga0105249_10033345 Ga0105249_100333453 98
222 3300009553 Ga0105249_13361060 Ga0105249_133610601 98
223 3300010375 Ga0105239_10030351 Ga0105239_100303515 98
224 3300010375 Ga0105239_10223035 Ga0105239_102230354 98
225 3300011119 Ga0105246_10000923 Ga0105246_100009235 98
226 3300011119 Ga0105246_10008877 Ga0105246_100088774 98
227 3300013102 Ga0157371_10002150 Ga0157371_1000215022 98
228 3300013104 Ga0157370_10000056 Ga0157370_1000005613 98
229 3300013105 Ga0157369_10003565 Ga0157369_100035654 98
230 3300013105 Ga0157369_10047585 Ga0157369_100475855 98
231 3300013296 Ga0157374_10009868 Ga0157374_100098683 98
232 3300013296 Ga0157374_10147985 Ga0157374_101479852 98
233 3300013296 Ga0157374_12381982 Ga0157374_123819822 98
234 3300013297 Ga0157378_10005832 Ga0157378_100058323 98
235 3300013297 Ga0157378_10091580 Ga0157378_100915802 98
236 3300013297 Ga0157378_12055049 Ga0157378_120550492 98
237 3300013306 Ga0163162_11252296 Ga0163162_112522962 98
238 3300013306 Ga0163162_12417299 Ga0163162_124172991 98
239 3300013307 Ga0157372_11537769 Ga0157372_115377691 98
240 3300013308 Ga0157375_10004502 Ga0157375_100045028 98
241 3300014326 Ga0157380_12951369 Ga0157380_129513692 98
242 3300014745 Ga0157377_10005234 Ga0157377_100052342 98
243 3300014969 Ga0157376_10001712 Ga0157376_1000171213 98
244 3300014969 Ga0157376_12887462 Ga0157376_128874622 98
245 3300021361 Ga0213872_10000172 Ga0213872_1000017220 98
246 3300021361 Ga0213872_10013414 Ga0213872_100134145 98
247 3300025226 Ga0209674_109371 Ga0209674_1093712 98
248 3300025230 Ga0209563_100025 Ga0209563_100025334 98
249 3300025231 Ga0207427_100931 Ga0207427_10093112 98
250 3300025245 Ga0207425_1056314 Ga0207425_10563141 98
251 3300025254 Ga0209148_1000332 Ga0209148_10003328 98
252 3300025254 Ga0209148_1022003 Ga0209148_10220032 98
253 3300025258 Ga0209129_1008618 Ga0209129_10086182 98
254 3300025263 Ga0209565_1000332 Ga0209565_100033222 98
255 3300025273 Ga0209673_1000523 Ga0209673_100052317 98
256 3300025290 Ga0207673_1005779 Ga0207673_10057792 98
257 3300025291 Ga0209675_1015162 Ga0209675_10151623 98
258 3300025292 Ga0209676_1000086 Ga0209676_10000868 98
259 3300025292 Ga0209676_1005342 Ga0209676_10053422 98
260 3300025295 Ga0209564_1026721 Ga0209564_10267213 98
261 3300025297 Ga0209758_1000287 Ga0209758_100028761 98
262 3300025297 Ga0209758_1016468 Ga0209758_10164683 98
263 3300025298 Ga0209050_1000039 Ga0209050_100003916 98
264 3300025298 Ga0209050_1003202 Ga0209050_10032023 98
265 3300025299 Ga0209256_1003899 Ga0209256_10038999 98
266 3300025299 Ga0209256_1005097 Ga0209256_10050972 98
267 3300025299 Ga0209256_1007063 Ga0209256_10070634 98
268 3300025303 Ga0209051_1050566 Ga0209051_10505663 98
269 3300025304 Ga0209257_1000049 Ga0209257_1000049275 98
270 3300025304 Ga0209257_1000051 Ga0209257_100005116 98
271 3300025304 Ga0209257_1015881 Ga0209257_10158814 98
272 3300025901 Ga0207688_10619541 Ga0207688_106195412 98
273 3300025904 Ga0207647_10476709 Ga0207647_104767091 98
274 3300025907 Ga0207645_10001428 Ga0207645_100014284 98
275 3300025911 Ga0207654_10582487 Ga0207654_105824872 98
276 3300025913 Ga0207695_10057651 Ga0207695_100576513 98
277 3300025913 Ga0207695_10067305 Ga0207695_100673053 98
278 3300025914 Ga0207671_10644109 Ga0207671_106441092 98
279 3300025918 Ga0207662_10047693 Ga0207662_100476932 98
280 3300025919 Ga0207657_10839498 Ga0207657_108394981 98
281 3300025920 Ga0207649_10099226 Ga0207649_100992262 98
282 3300025923 Ga0207681_10356034 Ga0207681_103560342 98
283 3300025924 Ga0207694_10333006 Ga0207694_103330061 98
284 3300025924 Ga0207694_10831463 Ga0207694_108314632 98
285 3300025927 Ga0207687_10000580 Ga0207687_1000058014 98
286 3300025927 Ga0207687_10009324 Ga0207687_100093243 98
287 3300025927 Ga0207687_11842274 Ga0207687_118422742 98
288 3300025932 Ga0207690_10080528 Ga0207690_100805282 98
289 3300025934 Ga0207686_10022514 Ga0207686_100225141 98
290 3300025935 Ga0207709_10001739 Ga0207709_100017394 98
291 3300025935 Ga0207709_10102499 Ga0207709_101024993 98
292 3300025935 Ga0207709_11430758 Ga0207709_114307582 98
293 3300025938 Ga0207704_10000090 Ga0207704_100000903 98
294 3300025938 Ga0207704_10105724 Ga0207704_101057242 98
295 3300025940 Ga0207691_10147694 Ga0207691_101476942 98
296 3300025942 Ga0207689_10006914 Ga0207689_100069146 98
297 3300025949 Ga0207667_10251618 Ga0207667_102516184 98
298 3300025949 Ga0207667_10428206 Ga0207667_104282061 98
299 3300025960 Ga0207651_10000001 Ga0207651_10000001276 98
300 3300025960 Ga0207651_11284819 Ga0207651_112848192 98
301 3300025961 Ga0207712_10019779 Ga0207712_100197794 98
302 3300025981 Ga0207640_11679082 Ga0207640_116790822 98
303 3300025981 Ga0207640_12008003 Ga0207640_120080032 98
304 3300025986 Ga0207658_10678286 Ga0207658_106782862 98
305 3300026023 Ga0207677_10000016 Ga0207677_100000164 98
306 3300026035 Ga0207703_10001637 Ga0207703_1000163715 98
307 3300026041 Ga0207639_10050398 Ga0207639_100503985 98
308 3300026078 Ga0207702_10336571 Ga0207702_103365712 98
309 3300026078 Ga0207702_11583182 Ga0207702_115831822 98
310 3300026089 Ga0207648_10005425 Ga0207648_100054259 98
311 3300026095 Ga0207676_11910516 Ga0207676_119105162 98
312 3300026116 Ga0207674_10886641 Ga0207674_108866412 98
313 3300026121 Ga0207683_10467799 Ga0207683_104677992 98
314 3300027866 Ga0209813_10000043 Ga0209813_1000004333 98
315 3300027876 Ga0209974_10402231 Ga0209974_104022312 98
316 3300028786 Ga0307517_10019346 Ga0307517_100193462 98
317 3300028794 Ga0307515_10053013 Ga0307515_100530136 98
318 3300028794 Ga0307515_10113322 Ga0307515_101133224 98
319 3300028794 Ga0307515_10284843 Ga0307515_102848433 98
320 3300028800 Ga0265338_10048741 Ga0265338_100487414 98
321 3300028800 Ga0265338_10140397 Ga0265338_101403973 98
322 3300030745 Ga0316182_1131368 Ga0316182_11313681 98
323 3300031251 Ga0265327_10000290 Ga0265327_1000029014 98
324 3300031251 Ga0265327_10000702 Ga0265327_100007022 98
325 3300031456 Ga0307513_10147629 Ga0307513_101476292 98
326 3300031456 Ga0307513_10636155 Ga0307513_106361552 98
327 3300031711 Ga0265314_10003206 Ga0265314_1000320610 98
328 3300031712 Ga0265342_10618058 Ga0265342_106180582 98
329 3300031731 Ga0307405_11749400 Ga0307405_117494002 98
330 3300031824 Ga0307413_10121332 Ga0307413_101213321 98
331 3300031824 Ga0307413_10220281 Ga0307413_102202813 98
332 3300031824 Ga0307413_10396785 Ga0307413_103967852 98
333 3300031824 Ga0307413_11083508 Ga0307413_110835082 98
334 3300031852 Ga0307410_10045490 Ga0307410_100454904 98
335 3300031852 Ga0307410_10143015 Ga0307410_101430153 98
336 3300031903 Ga0307407_10600143 Ga0307407_106001431 98
337 3300031995 Ga0307409_100038700 Ga0307409_1000387004 98
338 3300031995 Ga0307409_100293277 Ga0307409_1002932772 98
339 3300032004 Ga0307414_10010314 Ga0307414_100103145 98
340 3300032004 Ga0307414_10052971 Ga0307414_100529714 98
341 3300032004 Ga0307414_10085765 Ga0307414_100857653 98
342 3300032004 Ga0307414_10116115 Ga0307414_101161153 98
343 3300032004 Ga0307414_10357257 Ga0307414_103572572 98
344 3300032004 Ga0307414_10547886 Ga0307414_105478862 98
345 3300032004 Ga0307414_10767849 Ga0307414_107678492 98
346 3300032004 Ga0307414_10910841 Ga0307414_109108412 98
347 3300032004 Ga0307414_11554518 Ga0307414_115545182 98
348 3300032005 Ga0307411_10073937 Ga0307411_100739372 98
349 3300032005 Ga0307411_10100595 Ga0307411_101005952 98
350 3300032005 Ga0307411_10130612 Ga0307411_101306122 98
351 3300033180 Ga0307510_10059467 Ga0307510_100594674 98
352 3300036401 Ga0373937_1100562 Ga0373937_1100562_136_432 98
353 3300037312 Ga0395899_0000003 Ga0395899_0000003_780959_781261 98
354 3300037312 Ga0395899_0000396 Ga0395899_0000396_38829_39125 98
355 3300037312 Ga0395899_0064555 Ga0395899_0064555_281_577 98
356 3300037418 Ga0395900_0022028 Ga0395900_0022028_5790_6086 98
357 3300037418 Ga0395900_0107277 Ga0395900_0107277_261_557 98
358 3300037418 Ga0395900_1556749 Ga0395900_1556749_29_325 98
359 3300037466 Ga0395898_0418021 Ga0395898_0418021_311_607 98
360 3300037471 Ga0395905_0023541 Ga0395905_0023541_3344_3640 98
361 3300037471 Ga0395905_0046113 Ga0395905_0046113_281_577 98
362 3300037471 Ga0395905_0170727 Ga0395905_0170727_502_798 98
363 3300037471 Ga0395905_0242517 Ga0395905_0242517_359_655 98
364 3300037471 Ga0395905_0284048 Ga0395905_0284048_408_710 98
365 3300037471 Ga0395905_1695993 Ga0395905_1695993_171_473 98
366 3300037853 Ga0436364_0060956 Ga0436364_0060956_250_546 98
367 3300037853 Ga0436364_1361719 Ga0436364_1361719_247_543 98
368 3300038443 Ga0395901_0104646 Ga0395901_0104646_276_572 98
369 3300039438 Ga0436360_0958655 Ga0436360_0958655_784_1080 98
370 3300039447 Ga0436361_0046862 Ga0436361_0046862_5391_5687 98
371 3300039447 Ga0436361_0167979 Ga0436361_0167979_28576_28872 98
372 3300039447 Ga0436361_0375780 Ga0436361_0375780_2123_2422 98
373 3300039447 Ga0436361_0801110 Ga0436361_0801110_15_311 98
374 3300039447 Ga0436361_1065063 Ga0436361_1065063_478_774 98
375 3300041410 Ga0439461_0000039 Ga0439461_0000039_5995_6291 98
376 3300041413 Ga0439465_0000942 Ga0439465_0000942_5962_6258 98
377 3300041441 Ga0451787_822558 Ga0451787_822558_257_553 98
378 3300041443 Ga0451789_0139606 Ga0451789_0139606_183_479 98
379 3300041443 Ga0451789_0925911 Ga0451789_0925911_83_424 98
380 3300041451 Ga0451791_1437851 Ga0451791_1437851_145_441 98
381 3300041452 Ga0451793_0951445 Ga0451793_0951445_227_526 98
382 3300041453 Ga0451797_1017601 Ga0451797_1017601_374_670 98
383 3300041456 Ga0451795_1411656 Ga0451795_1411656_1595_1894 98
384 3300041459 Ga0451800_1237296 Ga0451800_1237296_552_851 98
385 3300041463 Ga0451804_0035446 Ga0451804_0035446_3870_4169 98
386 3300041463 Ga0451804_0086716 Ga0451804_0086716_130_438 98
387 3300041486 Ga0451807_0828075 Ga0451807_0828075_173_469 98
388 3300041486 Ga0451807_1637974 Ga0451807_1637974_11_310 98
389 3300041494 Ga0451837_0051540 Ga0451837_0051540_147_449 98
390 3300041494 Ga0451837_1068148 Ga0451837_1068148_143_439 98
391 3300041509 Ga0451843_0000599 Ga0451843_0000599_701_997 98
392 3300041509 Ga0451843_1174303 Ga0451843_1174303_137_439 98
393 3300041512 Ga0451853_0513266 Ga0451853_0513266_83_379 98
394 3300041997 Ga0439431_0000534 Ga0439431_0000534_1789_2085 98
395 3300042002 Ga0439442_002952 Ga0439442_002952_128_424 98
396 3300042004 Ga0439445_0000291 Ga0439445_0000291_6617_6913 98
397 3300042005 Ga0439448_0023672 Ga0439448_0023672_1253_1549 98
398 3300042006 Ga0439432_000049 Ga0439432_000049_29826_30122 98
399 3300042007 Ga0439449_0065406 Ga0439449_0065406_997_1293 98
400 3300042015 Ga0439462_0000923 Ga0439462_0000923_3109_3405 98
401 3300046457 Ga0495590_0003562 Ga0495590_0003562_3557_3853 98
402 3300046459 Ga0495629_0291535 Ga0495629_0291535_619_915 98
403 3300046460 Ga0495638_0000478 Ga0495638_0000478_16870_17166 98
404 3300046460 Ga0495638_0000500 Ga0495638_0000500_15019_15315 98
405 3300046460 Ga0495638_0001983 Ga0495638_0001983_12896_13192 98
406 3300046460 Ga0495638_0156316 Ga0495638_0156316_742_1041 98
407 3300046471 Ga0495650_0000196 Ga0495650_0000196_36489_36785 98
408 3300046471 Ga0495650_0010372 Ga0495650_0010372_2983_3279 98
409 3300046471 Ga0495650_0106021 Ga0495650_0106021_504_800 98
410 3300046506 Ga0495583_0000122 Ga0495583_0000122_30410_30706 98
411 3300046507 Ga0495606_0093367 Ga0495606_0093367_565_861 98
412 3300046512 Ga0495610_0000534 Ga0495610_0000534_5809_6111 98
413 3300046512 Ga0495610_0009932 Ga0495610_0009932_4225_4521 98
414 3300046512 Ga0495610_0386521 Ga0495610_0386521_166_462 98
415 3300046513 Ga0495616_0064198 Ga0495616_0064198_626_928 98
416 3300046516 Ga0495628_0877590 Ga0495628_0877590_272_568 98
417 3300046518 Ga0495631_0016339 Ga0495631_0016339_1359_1655 98
418 3300046519 Ga0495632_0093217 Ga0495632_0093217_851_1153 98
419 3300046519 Ga0495632_0212570 Ga0495632_0212570_379_720 98
420 3300046520 Ga0495637_0084203 Ga0495637_0084203_65_367 98
421 3300046520 Ga0495637_0241355 Ga0495637_0241355_302_598 98
422 3300046522 Ga0495643_0225919 Ga0495643_0225919_422_724 98
423 3300046523 Ga0495644_0121441 Ga0495644_0121441_474_782 98
424 3300046524 Ga0495648_0000389 Ga0495648_0000389_27803_28099 98
425 3300046524 Ga0495648_0179807 Ga0495648_0179807_414_710 98
426 3300046525 Ga0495663_0171104 Ga0495663_0171104_48_344 98
427 3300046526 Ga0495666_0355129 Ga0495666_0355129_260_556 98
428 3300046530 Ga0495654_0098467 Ga0495654_0098467_455_751 98
429 3300046536 Ga0495587_0013979 Ga0495587_0013979_4615_4911 98
430 3300046557 Ga0495622_0002767 Ga0495622_0002767_8000_8296 98
431 3300046558 Ga0495633_0032350 Ga0495633_0032350_1754_2050 98
432 3300046616 Ga0495668_0006012 Ga0495668_0006012_419_715 98
433 3300046660 Ga0495625_0000876 Ga0495625_0000876_9734_10030 98
434 3300046660 Ga0495625_0002001 Ga0495625_0002001_15907_16203 98
435 3300046660 Ga0495625_0002592 Ga0495625_0002592_8427_8723 98
436 3300046660 Ga0495625_0007475 Ga0495625_0007475_1812_2114 98
437 3300046660 Ga0495625_0028435 Ga0495625_0028435_583_885 98
438 3300046665 Ga0495661_0095747 Ga0495661_0095747_853_1149 98
439 3300046683 Ga0495658_0775569 Ga0495658_0775569_53_349 98
440 3300046691 Ga0495670_0000033 Ga0495670_0000033_75992_76288 98
441 3300046691 Ga0495670_0143723 Ga0495670_0143723_316_618 98
442 3300046809 Ga0495600_0042379 Ga0495600_0042379_761_1057 98
443 3300047317 Ga0495604_0902912 Ga0495604_0902912_210_506 98
444 3300047323 Ga0495683_0143548 Ga0495683_0143548_290_592 98
445 3300047446 Ga0495679_009923 Ga0495679_009923_904_1200 98
446 3300047469 Ga0495673_0000420 Ga0495673_0000420_17019_17315 98
447 3300047469 Ga0495673_0016299 Ga0495673_0016299_1517_1813 98
448 3300047470 Ga0495681_0136649 Ga0495681_0136649_485_787 98
449 3300047470 Ga0495681_0209914 Ga0495681_0209914_231_527 98
450 3300047472 Ga0495686_0000164 Ga0495686_0000164_121121_121417 98
451 3300047472 Ga0495686_0009474 Ga0495686_0009474_6126_6434 98
452 3300047472 Ga0495686_0038556 Ga0495686_0038556_1281_1577 98
453 3300048090 Ga0495615_0049315 Ga0495615_0049315_379_711 98
454 3300048905 Ga0496102_0916790 Ga0496102_0916790_328_624 98
455 3300048908 Ga0496105_0866277 Ga0496105_0866277_205_501 98
456 3300048909 Ga0496106_0974155 Ga0496106_0974155_252_554 98
457 3300048910 Ga0496107_0621367 Ga0496107_0621367_202_498 98
458 3300048911 Ga0496108_1603106 Ga0496108_1603106_113_409 98
459 3300048912 Ga0496109_0831055 Ga0496109_0831055_206_502 98
460 3300048917 Ga0496114_0106473 Ga0496114_0106473_98_394 98
461 3300048917 Ga0496114_1384996 Ga0496114_1384996_225_521 98
462 3300048918 Ga0496115_0004250 Ga0496115_0004250_8813_9109 98
463 3300048918 Ga0496115_0006370 Ga0496115_0006370_5362_5664 98
464 3300048920 Ga0496117_0343017 Ga0496117_0343017_421_717 98
465 3300048921 Ga0496118_0009455 Ga0496118_0009455_3936_4232 98
466 3300048923 Ga0496120_0135823 Ga0496120_0135823_217_513 98
467 3300048925 Ga0496122_0003882 Ga0496122_0003882_17083_17379 98
468 3300048926 Ga0496123_0004295 Ga0496123_0004295_12096_12392 98
469 3300048929 Ga0496126_0022494 Ga0496126_0022494_3670_3966 98
470 3300048929 Ga0496126_0241664 Ga0496126_0241664_836_1132 98
471 3300048929 Ga0496126_0373697 Ga0496126_0373697_543_839 98
472 3300048929 Ga0496126_0866690 Ga0496126_0866690_95_391 98
473 3300049459 Ga0495678_006172 Ga0495678_006172_3993_4289 98
474 3300049570 Ga0501033_0564832 Ga0501033_0564832_421_717 98
475 3300049571 Ga0501034_1370757 Ga0501034_1370757_179_487 98
476 3300049671 Ga0501238_001405 Ga0501238_001405_1754_2050 98
477 3300049758 Ga0501241_014161 Ga0501241_014161_180_476 98
478 3300049758 Ga0501241_051977 Ga0501241_051977_214_510 98
479 3300049822 Ga0501035_0246319 Ga0501035_0246319_535_831 98
480 3300050490 nmdc:mga03n38_26584_c1 nmdc:mga03n38_26584_c1_2064_2372 98
481 3300050493 nmdc:mga0k408_567105_c1 nmdc:mga0k408_567105_c1_14_310 98
482 3300050494 nmdc:mga06z11_56_c1 nmdc:mga06z11_56_c1_18876_19184 98
483 3300050494 nmdc:mga06z11_667900_c1 nmdc:mga06z11_667900_c1_78_386 98
484 3300050495 nmdc:mga04h51_99_c1 nmdc:mga04h51_99_c1_7039_7347 98
485 3300050496 nmdc:mga07m45_125786_c1 nmdc:mga07m45_125786_c1_581_889 98
486 3300050513 nmdc:mga0rr50_1099666_c1 nmdc:mga0rr50_1099666_c1_203_505 98
487 3300053086 Ga0500578_0009669 Ga0500578_0009669_1638_1934 98
488 3300053087 Ga0500643_095655 Ga0500643_095655_488_787 98
489 3300053088 Ga0500644_0000046 Ga0500644_0000046_9544_9840 98
490 3300053088 Ga0500644_0014985 Ga0500644_0014985_1480_1776 98
491 3300053088 Ga0500644_0100689 Ga0500644_0100689_311_610 98
492 3300053090 Ga0500646_0000881 Ga0500646_0000881_7544_7843 98
493 3300053090 Ga0500646_0207621 Ga0500646_0207621_216_512 98
494 3300053090 Ga0500646_0283928 Ga0500646_0283928_216_512 98
495 3300053092 Ga0500583_0042065 Ga0500583_0042065_122_421 98
496 3300053093 Ga0500651_0036779 Ga0500651_0036779_2664_2963 98
497 3300053093 Ga0500651_0372704 Ga0500651_0372704_16_315 98
498 3300053094 Ga0500566_0164461 Ga0500566_0164461_405_701 98
499 3300053096 Ga0500641_0104220 Ga0500641_0104220_402_698 98
500 3300053098 Ga0500650_0005141 Ga0500650_0005141_4223_4522 98
501 3300053102 Ga0500554_004877 Ga0500554_004877_2133_2429 98
502 3300053103 Ga0500555_105332 Ga0500555_105332_304_600 98
503 3300053104 Ga0500556_0002085 Ga0500556_0002085_6347_6649 98
504 3300053108 Ga0500562_006292 Ga0500562_006292_311_607 98
505 3300053118 Ga0500594_0000812 Ga0500594_0000812_2150_2446 98
506 3300053119 Ga0500595_001959 Ga0500595_001959_5667_5963 98
507 3300053121 Ga0500607_080950 Ga0500607_080950_897_1193 98
508 3300053123 Ga0500614_008918 Ga0500614_008918_381_677 98
509 3300053125 Ga0500618_000064 Ga0500618_000064_25404_25700 98
510 3300053127 Ga0500623_142026 Ga0500623_142026_50_349 98
511 3300053129 Ga0500628_000584 Ga0500628_000584_3486_3785 98
512 3300053130 Ga0500642_0001707 Ga0500642_0001707_2082_2381 98
513 3300053131 Ga0500652_000108 Ga0500652_000108_28707_29006 98
514 3300053131 Ga0500652_290617 Ga0500652_290617_162_458 98
515 3300053133 Ga0500655_021563 Ga0500655_021563_574_873 98
516 3300053133 Ga0500655_049691 Ga0500655_049691_366_662 98
517 3300053134 Ga0500658_0007011 Ga0500658_0007011_933_1235 98
518 3300053136 Ga0500559_0008081 Ga0500559_0008081_984_1280 98
519 3300053136 Ga0500559_0062639 Ga0500559_0062639_1020_1316 98
520 3300053136 Ga0500559_0172435 Ga0500559_0172435_628_924 98
521 3300053138 Ga0500564_000125 Ga0500564_000125_6837_7133 98
522 3300053140 Ga0500573_0041383 Ga0500573_0041383_1899_2201 98
523 3300053143 Ga0500579_132331 Ga0500579_132331_413_712 98
524 3300053147 Ga0500589_257988 Ga0500589_257988_272_571 98
525 3300053147 Ga0500589_332379 Ga0500589_332379_129_425 98
526 3300053151 Ga0500604_0001250 Ga0500604_0001250_775_1074 98
527 3300053156 Ga0500622_0000682 Ga0500622_0000682_1275_1571 98
528 3300053156 Ga0500622_0001458 Ga0500622_0001458_7943_8242 98
529 3300053156 Ga0500622_0029990 Ga0500622_0029990_1403_1699 98
530 3300053156 Ga0500622_0160965 Ga0500622_0160965_686_982 98
531 3300053158 Ga0500627_0171786 Ga0500627_0171786_592_888 98
532 3300053726 Ga0500584_085249 Ga0500584_085249_12_308 98
533 3300053730 Ga0500645_003167 Ga0500645_003167_3922_4224 98
534 3300053730 Ga0500645_135043 Ga0500645_135043_57_356 98
535 3300053735 Ga0500596_000155 Ga0500596_000155_7655_7951 98
536 3300055283 Ga0500661_043802 Ga0500661_043802_295_591 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

24

70

0.98

PF12840

HTH_20

Helix-turn-helix domain

22

71

0.98

PF12802

MarR_2

MarR family

24

75

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9215 10 68
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.9076 24 67
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.8983 24 67
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.898 10 68
3gw2-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulatory protein (fragment 1-100) from mycobacterium bovis. northeast structural genomics consortium target mbr242e. 0.8936 2 82
ID Description Score Start End Superfamily
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 10 68 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 10 66 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9152 22 68 3.30.230.130
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.911 25 69 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9052 25 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3M1TSR8-F1-model_v4 ArsR family transcriptional regulator 0.9132 4 82 GO:0003700
GO:0005737
AF-A0A257V6W3-F1-model_v4 HTH arsR-type domain-containing protein 0.9045 2 82 GO:0003700
AF-A0A532TSH1-F1-model_v4 ArsR family transcriptional regulator 0.9031 4 85 GO:0003700
AF-A0A1G3L7G9-F1-model_v4 HTH arsR-type domain-containing protein 0.8971 3 85 GO:0003700
AF-A0A852VR53-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.8963 2 82 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
79.23 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map