F460343

General Info

Members Datasets Scaffolds Average Seq Length
532 281 503 297

Family's Representative Sequence

Representative Sequence 3300059657|Ga0587118_01388|Ga0587118_01388_326_1324
Length 332
Sequence MYVCLKLKNQFNVYSYRLASTLVLAEHNEQKLNPLTLNAVTAAKKFGHEISMLITGSNSELIANQAAKIPDIKRVLFAQHAELKANLPERVSPILSSVQKQFNFSHIIAGASTFSRGVIPRTAAILNVSPISEITDVHGDDSFSRPTYAGNAIAKVTSKAPIKMITIRATAFEASPSEGGSATVEKLPELEIDTKLSEFLGQELSKSERPELAGAKIVVSGGRGLKSGENFKILYDLADVLGAAVGASRAAVDAGFVPNDMQVGQTGKVVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDKDAPIFQVSDFGLVADLFKAVPELTEELKK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2511231021 Pseudomonas sp. GM78 Isolate Nodule
4 2511231024 Pseudomonas sp. GM84 Isolate Nodule
5 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
6 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
7 2765235841 Pseudomonas putida AA7 Isolate Unclassified
8 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
9 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
10 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
11 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
12 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
13 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
14 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
15 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
16 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
17 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
18 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
19 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
131 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
170 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
171 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
172 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
173 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
174 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
175 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
276 8052494512 Pseudomonas putida LD6 Isolate Unclassified
277 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
278 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
279 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
280 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
281 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0.75
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 2.44
Rhizoplane 2.07
Rhizosphere 78.57
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_70 2124908027 Bacteria 29249
2 JGI25162J39368_1000042 3300002737 Bacteria 173466
3 JGI25162J39368_1000080 3300002737 Bacteria 113071
4 JGI25163J39215_1000372 3300002771 Bacteria 14501
5 JGI25164J39214_1000023 3300002772 Bacteria 165681
6 JGI25164J39214_1000073 3300002772 Bacteria 98902
7 JGI25406J46586_10000707 3300003203 Bacteria 15594
8 JGI25165J46597_1000083 3300003214 Bacteria 173466
9 JGI25165J46597_1000152 3300003214 Bacteria 113071
10 Ga0055536_1000233 3300003781 Bacteria 44539
11 Ga0055530_10000120 3300003791 Bacteria 67749
12 Ga0055530_10000240 3300003791 Bacteria 49322
13 Ga0055540_1000248 3300003792 Bacteria 49322
14 Ga0065714_10002428 3300005288 Bacteria 23357
15 Ga0065714_10025571 3300005288 Bacteria 1719
16 Ga0065704_10021353 3300005289 Bacteria 2782
17 Ga0065704_10070222 3300005289 Bacteria 63342
18 Ga0065704_10096962 3300005289 Bacteria 2415
19 Ga0065704_10124729 3300005289 Bacteria 1708
20 Ga0070658_10005201 3300005327 Bacteria 10587
21 Ga0068868_100226593 3300005338 Bacteria 1566
22 Ga0070661_100000627 3300005344 Bacteria 26263
23 Ga0070669_100000772 3300005353 Bacteria 23238
24 Ga0070669_100021607 3300005353 Bacteria 4599
25 Ga0070671_100000018 3300005355 Bacteria 147427
26 Ga0070673_100000555 3300005364 Bacteria 20114
27 Ga0070688_100021754 3300005365 Bacteria 3750
28 Ga0070667_100160148 3300005367 Bacteria 1982
29 Ga0070711_100334663 3300005439 Bacteria 1213
30 Ga0070662_100000292 3300005457 Bacteria 29603
31 Ga0070685_10002814 3300005466 Bacteria 8887
32 Ga0070698_100027044 3300005471 Bacteria 5965
33 Ga0070679_100114250 3300005530 Bacteria 2685
34 Ga0068853_100009350 3300005539 Bacteria 7902
35 Ga0068855_100130112 3300005563 Bacteria 2875
36 Ga0070664_100000249 3300005564 Bacteria 38905
37 Ga0070664_100447546 3300005564 Bacteria 1185
38 Ga0068857_100094552 3300005577 Bacteria 2677
39 Ga0068854_100013787 3300005578 Bacteria 5315
40 Ga0068856_100042775 3300005614 Bacteria 4458
41 Ga0068856_100084694 3300005614 Bacteria 3149
42 Ga0068856_100282754 3300005614 Bacteria 1676
43 Ga0068859_100084338 3300005617 Bacteria 3222
44 Ga0068859_100208360 3300005617 Bacteria 2041
45 Ga0068859_100352960 3300005617 Bacteria 1565
46 Ga0068851_10000194 3300005834 Bacteria 29920
47 Ga0068858_100159853 3300005842 Bacteria 2121
48 Ga0081539_10000054 3300005985 Bacteria 259053
49 Ga0075432_10004558 3300006058 Bacteria 4716
50 Ga0075369_10076972 3300006186 Bacteria 1475
51 Ga0075429_100040676 3300006880 Bacteria 4048
52 Ga0075429_100064416 3300006880 Bacteria 3192
53 Ga0068865_100219847 3300006881 Bacteria 1485
54 Ga0097620_100084342 3300006931 Bacteria 3222
55 Ga0097620_100208347 3300006931 Bacteria 2041
56 Ga0097620_100352952 3300006931 Bacteria 1565
57 Ga0099823_1000434 3300006944 Bacteria 27361
58 Ga0079104_1000094 3300006946 Bacteria 130202
59 Ga0079104_1000115 3300006946 Bacteria 115517
60 Ga0099826_10011129 3300006948 Bacteria 6763
61 Ga0105251_10000018 3300009011 Bacteria 142493
62 Ga0105251_10001230 3300009011 Bacteria 22189
63 Ga0105251_10001611 3300009011 Bacteria 19183
64 Ga0105251_10002244 3300009011 Bacteria 15382
65 Ga0105251_10004174 3300009011 Bacteria 10025
66 Ga0105251_10014300 3300009011 Bacteria 4397
67 Ga0105251_10036689 3300009011 Bacteria 2410
68 Ga0105244_10000169 3300009036 Bacteria 66921
69 Ga0105244_10006937 3300009036 Bacteria 7261
70 Ga0105244_10009003 3300009036 Bacteria 6177
71 Ga0105244_10026037 3300009036 Bacteria 3170
72 Ga0105244_10160461 3300009036 Bacteria 1074
73 Ga0105250_10000068 3300009092 Bacteria 98087
74 Ga0105250_10009453 3300009092 Bacteria 4102
75 Ga0105250_10055877 3300009092 Bacteria 1584
76 Ga0105245_10000260 3300009098 Bacteria 50205
77 Ga0114129_10076978 3300009147 Bacteria 4642
78 Ga0114129_10429578 3300009147 Bacteria 1736
79 Ga0105243_10000165 3300009148 Bacteria 75663
80 Ga0105243_10301603 3300009148 Bacteria 1452
81 Ga0105242_10000347 3300009176 Bacteria 37208
82 Ga0105248_10445204 3300009177 Bacteria 1459
83 Ga0105237_10000279 3300009545 Bacteria 71168
84 Ga0099796_10020239 3300010159 Bacteria 2031
85 Ga0105239_10185640 3300010375 Bacteria 2327
86 Ga0105246_10385500 3300011119 Bacteria 1159
87 Ga0157373_10089816 3300013100 Bacteria 2164
88 Ga0157371_10000526 3300013102 Bacteria 45746
89 Ga0157371_10014859 3300013102 Bacteria 5861
90 Ga0157371_10168106 3300013102 Bacteria 1566
91 Ga0157370_10000450 3300013104 Bacteria 51371
92 Ga0157370_10004431 3300013104 Bacteria 16093
93 Ga0157370_10051426 3300013104 Bacteria 3936
94 Ga0157370_10558048 3300013104 Bacteria 1050
95 Ga0157369_10281575 3300013105 Bacteria 1732
96 Ga0157374_10001598 3300013296 Bacteria 19020
97 Ga0157372_10007270 3300013307 Bacteria 11792
98 Ga0157372_10105128 3300013307 Bacteria 3229
99 Ga0182008_10001585 3300014497 Bacteria 15142
100 Ga0157376_10568358 3300014969 Bacteria 1124
101 Ga0182006_1004985 3300015261 Bacteria 6398
102 Ga0182005_1007772 3300015265 Bacteria 3194
103 Ga0163161_10002637 3300017792 Bacteria 12742
104 Ga0163161_10010099 3300017792 Bacteria 6535
105 Ga0163161_10074051 3300017792 Bacteria 2497
106 Ga0206349_1335876 3300020075 Eukaryota 1401
107 Ga0206350_10447066 3300020080 Eukaryota 1159
108 Ga0206354_10004808 3300020081 Eukaryota 1216
109 Ga0213876_10166480 3300021384 Bacteria 1173
110 Ga0209760_100114 3300025207 Bacteria 57573
111 Ga0209760_100200 3300025207 Bacteria 28448
112 Ga0207427_100001 3300025231 Bacteria 1410763
113 Ga0207427_100008 3300025231 Bacteria 740731
114 Ga0209437_100003 3300025233 Bacteria 1517827
115 Ga0209437_100014 3300025233 Bacteria 740714
116 Ga0209759_1008333 3300025256 Bacteria 3241
117 Ga0209233_1000007 3300025261 Bacteria 1411234
118 Ga0209233_1000008 3300025261 Bacteria 1356712
119 Ga0209676_1000021 3300025292 Bacteria 609534
120 Ga0209676_1000887 3300025292 Bacteria 38231
121 Ga0209676_1001648 3300025292 Bacteria 19583
122 Ga0209050_1000162 3300025298 Bacteria 155309
123 Ga0209050_1000227 3300025298 Bacteria 123743
124 Ga0209051_1000121 3300025303 Bacteria 146477
125 Ga0209051_1000164 3300025303 Bacteria 124186
126 Ga0209257_1006723 3300025304 Bacteria 7268
127 Ga0207656_10000200 3300025321 Bacteria 21415
128 Ga0207696_1000010 3300025711 Bacteria 534681
129 Ga0207696_1000152 3300025711 Bacteria 119512
130 Ga0207696_1000321 3300025711 Bacteria 51398
131 Ga0207696_1002724 3300025711 Bacteria 8419
132 Ga0207696_1026926 3300025711 Bacteria 1776
133 Ga0207655_1000005 3300025728 Bacteria 917277
134 Ga0207655_1000077 3300025728 Bacteria 219418
135 Ga0207655_1000081 3300025728 Bacteria 214272
136 Ga0207655_1000142 3300025728 Bacteria 137562
137 Ga0207655_1000355 3300025728 Bacteria 65919
138 Ga0207655_1006459 3300025728 Bacteria 7763
139 Ga0207655_1017422 3300025728 Bacteria 3876
140 Ga0207655_1037853 3300025728 Bacteria 2118
141 Ga0207655_1047736 3300025728 Bacteria 1764
142 Ga0207713_1000009 3300025735 Bacteria 551314
143 Ga0207713_1000140 3300025735 Bacteria 108600
144 Ga0207713_1001350 3300025735 Bacteria 20006
145 Ga0207713_1001775 3300025735 Bacteria 16499
146 Ga0207713_1002312 3300025735 Bacteria 14001
147 Ga0207713_1011740 3300025735 Bacteria 4733
148 Ga0207713_1014802 3300025735 Bacteria 4029
149 Ga0207713_1018496 3300025735 Bacteria 3448
150 Ga0207713_1021749 3300025735 Bacteria 3067
151 Ga0207713_1033412 3300025735 Bacteria 2247
152 Ga0207707_10268665 3300025912 Bacteria 1478
153 Ga0207671_10000343 3300025914 Bacteria 68390
154 Ga0207663_10287331 3300025916 Bacteria 1224
155 Ga0207660_10121118 3300025917 Bacteria 1981
156 Ga0207662_10091244 3300025918 Bacteria 1874
157 Ga0207649_10000013 3300025920 Bacteria 255009
158 Ga0207652_10006188 3300025921 Bacteria 9670
159 Ga0207652_10063959 3300025921 Bacteria 3183
160 Ga0207681_10000619 3300025923 Bacteria 23732
161 Ga0207681_10001775 3300025923 Bacteria 13848
162 Ga0207650_10000457 3300025925 Bacteria 34586
163 Ga0207659_10048853 3300025926 Bacteria 2999
164 Ga0207687_10000156 3300025927 Bacteria 45731
165 Ga0207700_10034652 3300025928 Bacteria 3626
166 Ga0207644_10000026 3300025931 Bacteria 147255
167 Ga0207644_10391206 3300025931 Bacteria 1135
168 Ga0207706_10000140 3300025933 Bacteria 78477
169 Ga0207686_10002848 3300025934 Bacteria 9334
170 Ga0207709_10000210 3300025935 Bacteria 75685
171 Ga0207709_10215720 3300025935 Bacteria 1380
172 Ga0207670_10006399 3300025936 Bacteria 6527
173 Ga0207691_10396549 3300025940 Bacteria 1177
174 Ga0207711_10000916 3300025941 Bacteria 28413
175 Ga0207679_10000005 3300025945 Bacteria 525011
176 Ga0207667_10158796 3300025949 Bacteria 2326
177 Ga0207651_10001985 3300025960 Bacteria 9618
178 Ga0207651_10022583 3300025960 Bacteria 3850
179 Ga0207640_10010874 3300025981 Bacteria 5136
180 Ga0207677_10520769 3300026023 Bacteria 1031
181 Ga0207639_10000714 3300026041 Bacteria 22749
182 Ga0207702_10044368 3300026078 Bacteria 3737
183 Ga0207702_10122871 3300026078 Bacteria 2326
184 Ga0207674_10046263 3300026116 Bacteria 4469
185 Ga0207674_10163445 3300026116 Bacteria 2180
186 Ga0207683_10010152 3300026121 Bacteria 8035
187 Ga0207698_10151403 3300026142 Bacteria 2014
188 Ga0209281_1000077 3300027111 Bacteria 262887
189 Ga0209281_1000212 3300027111 Bacteria 130216
190 Ga0209389_1000096 3300027296 Bacteria 80414
191 Ga0209371_1000313 3300027312 Bacteria 53399
192 Ga0209371_1003165 3300027312 Bacteria 8332
193 Ga0209282_1062287 3300027666 Bacteria 2072
194 Ga0207428_10009200 3300027907 Bacteria 8873
195 Ga0207428_10244542 3300027907 Bacteria 1340
196 Ga0268266_10004632 3300028379 Bacteria 13112
197 Ga0268266_10007962 3300028379 Bacteria 9475
198 Ga0268265_10001280 3300028380 Bacteria 21668
199 Ga0265336_10011445 3300028666 Bacteria 3016
200 Ga0307517_10091821 3300028786 Bacteria 2476
201 Ga0265338_10047857 3300028800 Bacteria 3899
202 Ga0268256_1000274 3300030500 Bacteria 53399
203 Ga0268256_1002878 3300030500 Bacteria 8270
204 Ga0265331_10014314 3300031250 Bacteria 4230
205 Ga0265327_10000112 3300031251 Bacteria 175878
206 Ga0265316_10031071 3300031344 Bacteria 4371
207 Ga0307513_10005585 3300031456 Bacteria 16586
208 Ga0307509_10005528 3300031507 Bacteria 17536
209 Ga0307509_10256936 3300031507 Bacteria 1526
210 Ga0307408_100000077 3300031548 Bacteria 110022
211 Ga0265313_10021829 3300031595 Bacteria 3490
212 Ga0307508_10008205 3300031616 Bacteria 9680
213 Ga0316577_10066050 3300031733 Bacteria 2020
214 Ga0307414_10050157 3300032004 Bacteria 2890
215 Ga0307415_100026478 3300032126 Bacteria 3659
216 Ga0307507_10148059 3300033179 Bacteria 1777
217 Ga0373949_0000206 3300035090 Bacteria 22631
218 Ga0373953_0134234 3300035117 Bacteria 1057
219 Ga0373955_0102368 3300035172 Bacteria 1646
220 Ga0316574_0039225 3300035398 Bacteria 2911
221 Ga0316574_0076029 3300035398 Bacteria 2127
222 Ga0373937_0050346 3300036401 Bacteria 3815
223 Ga0316584_0197863 3300036712 Bacteria 1484
224 Ga0373925_0012509 3300037068 Bacteria 6148
225 Ga0395901_0034833 3300038443 Bacteria 5200
226 Ga0400483_255384 3300039062 Bacteria 11642
227 Ga0436365_0676546 3300039437 Bacteria 6583
228 Ga0436360_1033345 3300039438 Bacteria 1610
229 Ga0439438_001068 3300041405 Bacteria 12238
230 Ga0439438_002777 3300041405 Bacteria 7329
231 Ga0439438_005048 3300041405 Bacteria 4921
232 Ga0439438_007586 3300041405 Bacteria 3692
233 Ga0439438_026630 3300041405 Bacteria 1566
234 Ga0439447_000211 3300041407 Bacteria 20579
235 Ga0439447_006680 3300041407 Bacteria 3720
236 Ga0439447_006793 3300041407 Bacteria 3678
237 Ga0439447_041647 3300041407 Bacteria 1117
238 Ga0439466_0001699 3300041411 Bacteria 8595
239 Ga0439466_0008472 3300041411 Bacteria 3875
240 Ga0439466_0012135 3300041411 Bacteria 3179
241 Ga0439466_0018297 3300041411 Bacteria 2514
242 Ga0439433_0029689 3300041999 Bacteria 1249
243 Ga0439432_035322 3300042006 Bacteria 1601
244 Ga0439451_007175 3300042009 Bacteria 2275
245 Ga0439452_004303 3300042010 Bacteria 4804
246 Ga0439452_015355 3300042010 Bacteria 2104
247 Ga0439456_000020 3300042013 Bacteria 60976
248 Ga0439456_003774 3300042013 Bacteria 3082
249 Ga0439456_005623 3300042013 Bacteria 2547
250 Ga0439463_010402 3300042016 Bacteria 2285
251 Ga0450900_007603 3300042136 Bacteria 1339
252 Ga0450902_000273 3300042137 Bacteria 6238
253 Ga0450907_000091 3300042146 Bacteria 35679
254 Ga0450908_002629 3300042184 Bacteria 3524
255 Ga0450909_000736 3300042185 Bacteria 4414
256 Ga0439464_0000028 3300042439 Bacteria 18437
257 Ga0439464_0004657 3300042439 Bacteria 3514
258 Ga0439460_0010124 3300042461 Bacteria 2405
259 Ga0495627_000014 3300046453 Bacteria 326114
260 Ga0495627_007415 3300046453 Bacteria 4200
261 Ga0495603_0000214 3300046455 Bacteria 29899
262 Ga0495591_000037 3300046458 Bacteria 158323
263 Ga0495591_000281 3300046458 Bacteria 47502
264 Ga0495591_002255 3300046458 Bacteria 10990
265 Ga0495591_012102 3300046458 Bacteria 3229
266 Ga0495591_019750 3300046458 Bacteria 2246
267 Ga0495591_030462 3300046458 Bacteria 1628
268 Ga0495638_0027401 3300046460 Bacteria 3688
269 Ga0495638_0074427 3300046460 Bacteria 2071
270 Ga0495653_0010746 3300046463 Bacteria 7495
271 Ga0495650_0000400 3300046471 Bacteria 72310
272 Ga0495650_0000771 3300046471 Bacteria 39556
273 Ga0495650_0001163 3300046471 Bacteria 28128
274 Ga0495650_0002650 3300046471 Bacteria 13975
275 Ga0495650_0005172 3300046471 Bacteria 8586
276 Ga0495650_0006191 3300046471 Bacteria 7512
277 Ga0495650_0008988 3300046471 Bacteria 5745
278 Ga0495650_0023056 3300046471 Bacteria 2970
279 Ga0495650_0052447 3300046471 Bacteria 1674
280 Ga0495650_0060208 3300046471 Bacteria 1525
281 Ga0495605_0000080 3300046474 Bacteria 125370
282 Ga0495605_0000799 3300046474 Bacteria 22512
283 Ga0495605_0002510 3300046474 Bacteria 11336
284 Ga0495639_0000126 3300046475 Bacteria 39275
285 Ga0495584_0003040 3300046491 Bacteria 9307
286 Ga0495584_0092489 3300046491 Bacteria 1526
287 Ga0495584_0157664 3300046491 Bacteria 1153
288 Ga0495585_0000533 3300046492 Bacteria 35989
289 Ga0495585_0019173 3300046492 Bacteria 3947
290 Ga0495585_0086749 3300046492 Bacteria 1690
291 Ga0495596_0000102 3300046500 Bacteria 60788
292 Ga0495596_0000158 3300046500 Bacteria 47438
293 Ga0495596_0007028 3300046500 Bacteria 5113
294 Ga0495596_0047395 3300046500 Bacteria 1686
295 Ga0495607_0001388 3300046501 Bacteria 21548
296 Ga0495607_0006106 3300046501 Bacteria 8521
297 Ga0495607_0009211 3300046501 Bacteria 6709
298 Ga0495607_0030293 3300046501 Bacteria 3323
299 Ga0495607_0030793 3300046501 Bacteria 3290
300 Ga0495607_0054190 3300046501 Bacteria 2311
301 Ga0495607_0054226 3300046501 Bacteria 2310
302 Ga0495607_0178704 3300046501 Bacteria 1065
303 Ga0495583_0000028 3300046506 Bacteria 255787
304 Ga0495583_0000163 3300046506 Bacteria 112327
305 Ga0495583_0000347 3300046506 Bacteria 73058
306 Ga0495583_0000481 3300046506 Bacteria 58360
307 Ga0495583_0001875 3300046506 Bacteria 19558
308 Ga0495583_0004224 3300046506 Bacteria 10444
309 Ga0495583_0105205 3300046506 Bacteria 1200
310 Ga0495606_0000023 3300046507 Bacteria 265019
311 Ga0495606_0000094 3300046507 Bacteria 151840
312 Ga0495606_0000446 3300046507 Bacteria 67610
313 Ga0495606_0000818 3300046507 Bacteria 47266
314 Ga0495606_0011575 3300046507 Bacteria 7173
315 Ga0495610_0030364 3300046512 Bacteria 2833
316 Ga0495610_0043109 3300046512 Bacteria 2250
317 Ga0495610_0048193 3300046512 Bacteria 2092
318 Ga0495616_0035211 3300046513 Bacteria 2592
319 Ga0495620_0000172 3300046515 Bacteria 50992
320 Ga0495620_0000794 3300046515 Bacteria 19367
321 Ga0495631_0000173 3300046518 Bacteria 43899
322 Ga0495631_0007089 3300046518 Bacteria 5731
323 Ga0495632_0000273 3300046519 Bacteria 50868
324 Ga0495632_0002211 3300046519 Bacteria 15011
325 Ga0495632_0021543 3300046519 Bacteria 3471
326 Ga0495637_0000081 3300046520 Bacteria 74206
327 Ga0495637_0000276 3300046520 Bacteria 40415
328 Ga0495637_0001539 3300046520 Bacteria 13451
329 Ga0495637_0003911 3300046520 Bacteria 7815
330 Ga0495637_0005610 3300046520 Bacteria 6372
331 Ga0495637_0037605 3300046520 Bacteria 2100
332 Ga0495643_0000475 3300046522 Bacteria 51143
333 Ga0495643_0004381 3300046522 Bacteria 9895
334 Ga0495643_0013442 3300046522 Bacteria 4899
335 Ga0495648_0000349 3300046524 Bacteria 50804
336 Ga0495648_0002654 3300046524 Bacteria 16200
337 Ga0495648_0016373 3300046524 Bacteria 5348
338 Ga0495648_0030278 3300046524 Bacteria 3580
339 Ga0495648_0062379 3300046524 Bacteria 2207
340 Ga0495642_0000026 3300046528 Bacteria 90898
341 Ga0495654_0005155 3300046530 Bacteria 7625
342 Ga0495654_0010608 3300046530 Bacteria 5007
343 Ga0495654_0018665 3300046530 Bacteria 3631
344 Ga0495654_0019096 3300046530 Bacteria 3585
345 Ga0495654_0022212 3300046530 Bacteria 3296
346 Ga0495609_0000248 3300046538 Bacteria 51092
347 Ga0495609_0000395 3300046538 Bacteria 36677
348 Ga0495609_0006345 3300046538 Bacteria 6041
349 Ga0495609_0013865 3300046538 Bacteria 3800
350 Ga0495609_0022219 3300046538 Bacteria 2923
351 Ga0495597_0001034 3300046542 Bacteria 21263
352 Ga0495597_0052047 3300046542 Bacteria 1803
353 Ga0495597_0066224 3300046542 Bacteria 1565
354 Ga0495668_0000497 3300046616 Bacteria 49049
355 Ga0495668_0006597 3300046616 Bacteria 7572
356 Ga0495611_0000736 3300046648 Bacteria 18466
357 Ga0495611_0001990 3300046648 Bacteria 9684
358 Ga0495611_0050525 3300046648 Bacteria 1873
359 Ga0495625_0000016 3300046660 Bacteria 311353
360 Ga0495625_0000672 3300046660 Bacteria 48741
361 Ga0495625_0020870 3300046660 Bacteria 5050
362 Ga0495625_0075533 3300046660 Bacteria 2357
363 Ga0495661_0000001 3300046665 Bacteria 898372
364 Ga0495661_0000005 3300046665 Bacteria 433622
365 Ga0495661_0000039 3300046665 Bacteria 153539
366 Ga0495661_0000179 3300046665 Bacteria 72942
367 Ga0495661_0000205 3300046665 Bacteria 68743
368 Ga0495661_0000437 3300046665 Bacteria 44095
369 Ga0495661_0000902 3300046665 Bacteria 27260
370 Ga0495661_0007711 3300046665 Bacteria 7495
371 Ga0495661_0027623 3300046665 Bacteria 3640
372 Ga0495669_0105595 3300046684 Bacteria 1311
373 Ga0495624_0000014 3300046690 Bacteria 111102
374 Ga0495671_0007645 3300046692 Bacteria 6139
375 Ga0495671_0011783 3300046692 Bacteria 4792
376 Ga0495671_0023795 3300046692 Bacteria 3197
377 Ga0495671_0098889 3300046692 Bacteria 1426
378 Ga0495649_0003858 3300046694 Bacteria 9930
379 Ga0495649_0005847 3300046694 Bacteria 7733
380 Ga0495649_0012425 3300046694 Bacteria 4950
381 Ga0495589_0024008 3300046794 Bacteria 3100
382 Ga0495600_0106520 3300046809 Bacteria 1826
383 Ga0495660_0004376 3300046810 Bacteria 8554
384 Ga0495660_0042808 3300046810 Bacteria 2500
385 Ga0495660_0045161 3300046810 Bacteria 2419
386 Ga0495604_0003167 3300047317 Bacteria 13160
387 Ga0495636_0016929 3300047318 Bacteria 2914
388 Ga0495672_0000457 3300047320 Bacteria 48226
389 Ga0495672_0016519 3300047320 Bacteria 4969
390 Ga0495672_0020849 3300047320 Bacteria 4286
391 Ga0495672_0043474 3300047320 Bacteria 2701
392 Ga0495676_0000001 3300047321 Bacteria 624167
393 Ga0495676_0000171 3300047321 Bacteria 50588
394 Ga0495680_0000133 3300047322 Bacteria 74109
395 Ga0495680_0064885 3300047322 Bacteria 2798
396 Ga0495683_0021324 3300047323 Bacteria 3338
397 Ga0495687_000159 3300047443 Bacteria 101178
398 Ga0495677_0091149 3300047445 Bacteria 1148
399 Ga0495679_000119 3300047446 Bacteria 69255
400 Ga0495679_000278 3300047446 Bacteria 42823
401 Ga0495679_003448 3300047446 Bacteria 7599
402 Ga0495673_0000986 3300047469 Bacteria 25501
403 Ga0495673_0005076 3300047469 Bacteria 8056
404 Ga0495673_0005224 3300047469 Bacteria 7890
405 Ga0495673_0005732 3300047469 Bacteria 7448
406 Ga0495673_0006861 3300047469 Bacteria 6637
407 Ga0495673_0015905 3300047469 Bacteria 3861
408 Ga0495673_0038111 3300047469 Bacteria 2189
409 Ga0495673_0049712 3300047469 Bacteria 1844
410 Ga0495673_0125151 3300047469 Bacteria 1014
411 Ga0495681_0001733 3300047470 Bacteria 16133
412 Ga0495681_0020802 3300047470 Bacteria 3550
413 Ga0495686_0003503 3300047472 Bacteria 13562
414 Ga0495626_0000002 3300048091 Bacteria 436012
415 Ga0495626_0000123 3300048091 Bacteria 100704
416 Ga0495626_0000576 3300048091 Bacteria 36334
417 Ga0495626_0096001 3300048091 Bacteria 1297
418 Ga0496101_0034108 3300048904 Bacteria 3594
419 Ga0496102_0283632 3300048905 Bacteria 1561
420 Ga0496104_0552272 3300048907 Bacteria 1063
421 Ga0496106_0108702 3300048909 Bacteria 2157
422 Ga0496108_0229256 3300048911 Bacteria 1615
423 Ga0496110_0098039 3300048913 Bacteria 2626
424 Ga0496114_0000221 3300048917 Bacteria 41396
425 Ga0496114_0042962 3300048917 Bacteria 3748
426 Ga0496115_0036453 3300048918 Bacteria 3894
427 Ga0496116_0000185 3300048919 Bacteria 123912
428 Ga0496117_0011122 3300048920 Bacteria 8092
429 Ga0496117_0011654 3300048920 Bacteria 7852
430 Ga0496117_0042975 3300048920 Bacteria 3292
431 Ga0496117_0071070 3300048920 Bacteria 2334
432 Ga0496117_0092404 3300048920 Bacteria 1943
433 Ga0496118_0004428 3300048921 Bacteria 16673
434 Ga0496118_0016643 3300048921 Bacteria 6737
435 Ga0496119_0001076 3300048922 Bacteria 34565
436 Ga0496120_0002302 3300048923 Bacteria 19785
437 Ga0496121_0001963 3300048924 Bacteria 32764
438 Ga0496121_0003265 3300048924 Bacteria 23309
439 Ga0496121_0016182 3300048924 Bacteria 7722
440 Ga0496121_0300509 3300048924 Bacteria 1089
441 Ga0496122_0000156 3300048925 Bacteria 160178
442 Ga0496122_0000597 3300048925 Bacteria 74301
443 Ga0496122_0029704 3300048925 Bacteria 4601
444 Ga0496122_0031715 3300048925 Bacteria 4388
445 Ga0496122_0235140 3300048925 Bacteria 1038
446 Ga0496123_0000087 3300048926 Bacteria 182994
447 Ga0496123_0000343 3300048926 Bacteria 87669
448 Ga0496123_0001070 3300048926 Bacteria 41381
449 Ga0496123_0037161 3300048926 Bacteria 3442
450 Ga0496124_0001532 3300048927 Bacteria 33589
451 Ga0496124_0013704 3300048927 Bacteria 7896
452 Ga0496124_0014222 3300048927 Bacteria 7709
453 Ga0496124_0120863 3300048927 Bacteria 2093
454 Ga0496124_0128998 3300048927 Bacteria 2011
455 Ga0496124_0160735 3300048927 Bacteria 1751
456 Ga0496125_0011854 3300048928 Bacteria 8684
457 Ga0496125_0014108 3300048928 Bacteria 7802
458 Ga0496125_0017212 3300048928 Bacteria 6908
459 Ga0496126_0091717 3300048929 Bacteria 2670
460 Ga0496126_0161159 3300048929 Bacteria 1916
461 Ga0495678_000008 3300049459 Bacteria 445926
462 Ga0495678_001763 3300049459 Bacteria 16027
463 Ga0495678_013754 3300049459 Bacteria 3787
464 Ga0495678_038672 3300049459 Bacteria 1928
465 Ga0495678_076198 3300049459 Bacteria 1215
466 Ga0495682_0000018 3300049460 Bacteria 229211
467 Ga0495682_0000156 3300049460 Bacteria 57409
468 Ga0495682_0000430 3300049460 Bacteria 29408
469 Ga0495682_0000734 3300049460 Bacteria 21242
470 Ga0495682_0056421 3300049460 Bacteria 1423
471 Ga0501034_0000084 3300049571 Bacteria 168283
472 Ga0501046_0387201 3300049580 Bacteria 1011
473 Ga0501047_0039937 3300049581 Bacteria 4538
474 Ga0501047_0171204 3300049581 Bacteria 2040
475 Ga0501069_0174376 3300049585 Bacteria 1241
476 Ga0501070_0006742 3300049586 Bacteria 9777
477 Ga0501070_0053041 3300049586 Bacteria 3364
478 Ga0501070_0136995 3300049586 Bacteria 2021
479 Ga0501073_0026634 3300049589 Bacteria 4140
480 Ga0501074_0021727 3300049590 Bacteria 4659
481 Ga0501074_0188064 3300049590 Bacteria 1472
482 Ga0501216_015574 3300049660 Bacteria 1283
483 Ga0501225_0000785 3300049705 Bacteria 9926
484 Ga0501080_0087960 3300049742 Bacteria 2886
485 Ga0501080_0214074 3300049742 Bacteria 1765
486 Ga0501081_0043679 3300049743 Bacteria 3075
487 Ga0501083_0005169 3300049744 Bacteria 9233
488 Ga0501083_0007760 3300049744 Bacteria 7601
489 Ga0501044_0118955 3300049823 Bacteria 2644
490 Ga0501044_0335455 3300049823 Bacteria 1434
491 nmdc:mga05p37_175315_c1 3300050507 Bacteria 2612
492 nmdc:mga09592_57548_c1 3300050508 Bacteria 3286
493 Ga0500650_0009793 3300053098 Bacteria 3863
494 Ga0500618_001740 3300053125 Bacteria 9241
495 Ga0500659_0000019 3300053135 Bacteria 65589
496 Ga0500659_0005159 3300053135 Bacteria 7352
497 Ga0500568_0032634 3300053139 Bacteria 2140
498 Ga0500636_0103695 3300053177 Bacteria 1614
499 Ga0501084_0317520 3300054114 Bacteria 1316
500 Ga0500661_005983 3300055283 Bacteria 2268
501 Ga0587118_01388 3300059657 Bacteria 1452
502 Ga0501082_0067305 3300060353 Bacteria 3084
503 Ga0501082_0358251 3300060353 Bacteria 1272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100282754 Ga0068856_1002827542 232
2 3300031507 Ga0307509_10256936 Ga0307509_102569361 242
3 3300035090 Ga0373949_0000206 Ga0373949_0000206_9058_10026 244
4 3300031456 Ga0307513_10005585 Ga0307513_1000558512 249
5 3300026142 Ga0207698_10151403 Ga0207698_101514032 250
6 3300025926 Ga0207659_10048853 Ga0207659_100488533 251
7 3300025940 Ga0207691_10396549 Ga0207691_103965492 251
8 3300031616 Ga0307508_10008205 Ga0307508_100082056 252
9 3300033179 Ga0307507_10148059 Ga0307507_101480592 252
10 3300005563 Ga0068855_100130112 Ga0068855_1001301124 254
11 3300025949 Ga0207667_10158796 Ga0207667_101587962 254
12 3300026078 Ga0207702_10122871 Ga0207702_101228712 254
13 3300048925 Ga0496122_0235140 Ga0496122_0235140_188_1024 262
14 3300009147 Ga0114129_10429578 Ga0114129_104295782 263
15 3300050507 nmdc:mga05p37_175315_c1 nmdc:mga05p37_175315_c1_540_1505 263
16 3300037068 Ga0373925_0012509 Ga0373925_0012509_535_1500 264
17 3300028786 Ga0307517_10091821 Ga0307517_100918213 266
18 iso_pu_bacteria 2511231015 2511322048 266
19 3300003203 JGI25406J46586_10000707 JGI25406J46586_1000070711 269
20 3300005985 Ga0081539_10000054 Ga0081539_10000054203 269
21 3300010159 Ga0099796_10020239 Ga0099796_100202391 269
22 3300031595 Ga0265313_10021829 Ga0265313_100218292 270
23 3300053139 Ga0500568_0032634 Ga0500568_0032634_1053_2018 271
24 3300009147 Ga0114129_10076978 Ga0114129_100769782 273
25 3300006880 Ga0075429_100064416 Ga0075429_1000644164 275
26 3300025921 Ga0207652_10006188 Ga0207652_100061885 275
27 3300050508 nmdc:mga09592_57548_c1 nmdc:mga09592_57548_c1_564_1532 275
28 iso_pu_bacteria 2511231021 2511357293 275
29 3300039438 Ga0436360_1033345 Ga0436360_1033345_330_1271 276
30 3300009098 Ga0105245_10000260 Ga0105245_1000026040 277
31 3300025927 Ga0207687_10000156 Ga0207687_1000015626 277
32 3300027907 Ga0207428_10244542 Ga0207428_102445421 278
33 3300031507 Ga0307509_10005528 Ga0307509_100055287 278
34 3300047469 Ga0495673_0049712 Ga0495673_0049712_12_902 279
35 3300005530 Ga0070679_100114250 Ga0070679_1001142502 280
36 3300005577 Ga0068857_100094552 Ga0068857_1000945522 280
37 3300005614 Ga0068856_100042775 Ga0068856_1000427752 280
38 3300010375 Ga0105239_10185640 Ga0105239_101856402 280
39 3300025912 Ga0207707_10268665 Ga0207707_102686652 280
40 3300025921 Ga0207652_10063959 Ga0207652_100639593 280
41 3300026078 Ga0207702_10044368 Ga0207702_100443684 280
42 3300026116 Ga0207674_10046263 Ga0207674_100462633 280
43 3300049660 Ga0501216_015574 Ga0501216_015574_218_1147 280
44 3300046810 Ga0495660_0042808 Ga0495660_0042808_25_918 281
45 3300035172 Ga0373955_0102368 Ga0373955_0102368_84_1049 282
46 3300026116 Ga0207674_10163445 Ga0207674_101634452 283
47 3300039437 Ga0436365_0676546 Ga0436365_0676546_2661_3629 283
48 3300042013 Ga0439456_003774 Ga0439456_003774_112_1056 283
49 3300013296 Ga0157374_10001598 Ga0157374_100015989 284
50 3300026121 Ga0207683_10010152 Ga0207683_100101527 284
51 iso_pu_bacteria 2894772417 2894777554 284
52 3300036401 Ga0373937_0050346 Ga0373937_0050346_1764_2732 285
53 3300049585 Ga0501069_0174376 Ga0501069_0174376_20_988 285
54 3300049586 Ga0501070_0006742 Ga0501070_0006742_1478_2446 285
55 3300049589 Ga0501073_0026634 Ga0501073_0026634_698_1666 285
56 3300049590 Ga0501074_0021727 Ga0501074_0021727_1332_2300 285
57 3300049742 Ga0501080_0214074 Ga0501080_0214074_63_1031 285
58 3300049743 Ga0501081_0043679 Ga0501081_0043679_1505_2473 285
59 3300049744 Ga0501083_0005169 Ga0501083_0005169_3213_4181 285
60 3300005327 Ga0070658_10005201 Ga0070658_100052017 286
61 3300035117 Ga0373953_0134234 Ga0373953_0134234_47_1012 286
62 3300038443 Ga0395901_0034833 Ga0395901_0034833_2608_3576 287
63 3300049586 Ga0501070_0136995 Ga0501070_0136995_832_1800 287
64 3300049823 Ga0501044_0335455 Ga0501044_0335455_447_1415 287
65 3300028800 Ga0265338_10047857 Ga0265338_100478573 288
66 3300031250 Ga0265331_10014314 Ga0265331_100143144 288
67 3300031251 Ga0265327_10000112 Ga0265327_1000011290 288
68 3300032126 Ga0307415_100026478 Ga0307415_1000264784 288
69 3300042439 Ga0439464_0000028 Ga0439464_0000028_1740_2669 288
70 3300049590 Ga0501074_0188064 Ga0501074_0188064_480_1448 288
71 3300053177 Ga0500636_0103695 Ga0500636_0103695_100_1029 288
72 3300060353 Ga0501082_0358251 Ga0501082_0358251_21_989 288
73 3300006058 Ga0075432_10004558 Ga0075432_100045584 289
74 3300013104 Ga0157370_10004431 Ga0157370_1000443115 289
75 3300017792 Ga0163161_10010099 Ga0163161_100100994 289
76 3300046471 Ga0495650_0002650 Ga0495650_0002650_10354_11298 289
77 3300046506 Ga0495583_0000481 Ga0495583_0000481_16808_17752 289
78 iso_pu_bacteria 2511231024 2511374744 289
79 iso_pu_bacteria 2511231024 2511375095 289
80 iso_pu_bacteria 2511231024 2511375450 289
81 iso_pu_bacteria 2554235231 2555247212 289
82 iso_pu_bacteria 2600254954 2600445644 289
83 iso_pu_bacteria 2765235841 2765582940 289
84 iso_pu_bacteria 2806310737 2807409339 289
85 iso_pu_bacteria 2806310745 2807457641 289
86 iso_pu_bacteria 2811994881 2812371328 289
87 iso_pu_bacteria 2823421272 2823424106 289
88 iso_pu_bacteria 2919155634 2919159785 289
89 iso_pu_bacteria 2919501602 2919503817 289
90 iso_pu_bacteria 2923519811 2923525441 289
91 iso_pu_bacteria 2926063275 2926065611 289
92 iso_pu_bacteria 2931396565 2931400697 289
93 iso_pu_bacteria 3007803356 3007805793 289
94 iso_pu_bacteria 3007872151 3007874783 289
95 iso_pu_bacteria 8034962539 8034965879 289
96 iso_pu_bacteria 8052494512 8052497171 289
97 iso_pu_bacteria 8052494512 8052498325 289
98 iso_pu_bacteria 8054357960 8054358595 289
99 iso_pu_bacteria 8054929484 8054931422 289
100 iso_pu_bacteria 8056115690 8056118003 289
101 iso_pu_bacteria 8056120720 8056122497 289
102 iso_pu_bacteria 8056137416 8056139970 289
103 iso_pu_bacteria 8056137416 8056141247 289
104 3300003791 Ga0055530_10000240 Ga0055530_1000024021 290
105 3300003792 Ga0055540_1000248 Ga0055540_100024821 290
106 3300005353 Ga0070669_100021607 Ga0070669_1000216072 290
107 3300005457 Ga0070662_100000292 Ga0070662_10000029210 290
108 3300005539 Ga0068853_100009350 Ga0068853_1000093504 290
109 3300005564 Ga0070664_100447546 Ga0070664_1004475462 290
110 3300005578 Ga0068854_100013787 Ga0068854_1000137874 290
111 3300005834 Ga0068851_10000194 Ga0068851_1000019424 290
112 3300006946 Ga0079104_1000115 Ga0079104_100011599 290
113 3300009011 Ga0105251_10002244 Ga0105251_1000224413 290
114 3300009011 Ga0105251_10004174 Ga0105251_1000417412 290
115 3300009177 Ga0105248_10445204 Ga0105248_104452042 290
116 3300013102 Ga0157371_10168106 Ga0157371_101681061 290
117 3300013104 Ga0157370_10000450 Ga0157370_1000045042 290
118 3300013104 Ga0157370_10558048 Ga0157370_105580481 290
119 3300017792 Ga0163161_10002637 Ga0163161_1000263711 290
120 3300017792 Ga0163161_10074051 Ga0163161_100740514 290
121 3300025292 Ga0209676_1001648 Ga0209676_100164820 290
122 3300025298 Ga0209050_1000227 Ga0209050_1000227106 290
123 3300025303 Ga0209051_1000164 Ga0209051_1000164107 290
124 3300025304 Ga0209257_1006723 Ga0209257_10067232 290
125 3300025321 Ga0207656_10000200 Ga0207656_100002009 290
126 3300025735 Ga0207713_1001775 Ga0207713_10017752 290
127 3300025923 Ga0207681_10000619 Ga0207681_1000061924 290
128 3300025933 Ga0207706_10000140 Ga0207706_1000014087 290
129 3300025981 Ga0207640_10010874 Ga0207640_100108742 290
130 3300026041 Ga0207639_10000714 Ga0207639_1000071420 290
131 3300027111 Ga0209281_1000077 Ga0209281_1000077201 290
132 3300027907 Ga0207428_10009200 Ga0207428_100092006 290
133 3300031548 Ga0307408_100000077 Ga0307408_10000007729 290
134 3300041405 Ga0439438_002777 Ga0439438_002777_5989_6918 290
135 3300041405 Ga0439438_026630 Ga0439438_026630_445_1374 290
136 3300041407 Ga0439447_006680 Ga0439447_006680_2610_3539 290
137 3300041407 Ga0439447_041647 Ga0439447_041647_73_1020 290
138 3300041411 Ga0439466_0018297 Ga0439466_0018297_1327_2256 290
139 3300042006 Ga0439432_035322 Ga0439432_035322_228_1157 290
140 3300042009 Ga0439451_007175 Ga0439451_007175_99_1028 290
141 3300042010 Ga0439452_015355 Ga0439452_015355_1021_1950 290
142 3300042013 Ga0439456_005623 Ga0439456_005623_598_1527 290
143 3300042016 Ga0439463_010402 Ga0439463_010402_684_1613 290
144 3300042146 Ga0450907_000091 Ga0450907_000091_51_980 290
145 3300042184 Ga0450908_002629 Ga0450908_002629_51_980 290
146 3300042185 Ga0450909_000736 Ga0450909_000736_605_1534 290
147 3300042461 Ga0439460_0010124 Ga0439460_0010124_660_1589 290
148 3300046458 Ga0495591_000281 Ga0495591_000281_46520_47449 290
149 3300046460 Ga0495638_0074427 Ga0495638_0074427_1089_2018 290
150 3300046491 Ga0495584_0157664 Ga0495584_0157664_134_1063 290
151 3300046500 Ga0495596_0000102 Ga0495596_0000102_59722_60651 290
152 3300046501 Ga0495607_0001388 Ga0495607_0001388_13785_14714 290
153 3300046501 Ga0495607_0006106 Ga0495607_0006106_6415_7359 290
154 3300046507 Ga0495606_0000023 Ga0495606_0000023_208684_209613 290
155 3300046512 Ga0495610_0048193 Ga0495610_0048193_1089_2018 290
156 3300046519 Ga0495632_0002211 Ga0495632_0002211_3935_4864 290
157 3300046520 Ga0495637_0000276 Ga0495637_0000276_91_1020 290
158 3300046522 Ga0495643_0004381 Ga0495643_0004381_106_1035 290
159 3300046524 Ga0495648_0030278 Ga0495648_0030278_54_983 290
160 3300046530 Ga0495654_0019096 Ga0495654_0019096_2603_3532 290
161 3300046542 Ga0495597_0052047 Ga0495597_0052047_91_1020 290
162 3300046542 Ga0495597_0066224 Ga0495597_0066224_91_1020 290
163 3300046616 Ga0495668_0000497 Ga0495668_0000497_47984_48913 290
164 3300046660 Ga0495625_0020870 Ga0495625_0020870_43_984 290
165 3300046690 Ga0495624_0000014 Ga0495624_0000014_91639_92568 290
166 3300046694 Ga0495649_0005847 Ga0495649_0005847_367_1296 290
167 3300047320 Ga0495672_0020849 Ga0495672_0020849_2538_3467 290
168 3300047470 Ga0495681_0001733 Ga0495681_0001733_15142_16071 290
169 3300048091 Ga0495626_0000576 Ga0495626_0000576_35343_36272 290
170 3300048927 Ga0496124_0013704 Ga0496124_0013704_6824_7753 290
171 3300049459 Ga0495678_013754 Ga0495678_013754_42_971 290
172 3300049459 Ga0495678_038672 Ga0495678_038672_593_1534 290
173 3300049460 Ga0495682_0000734 Ga0495682_0000734_56_985 290
174 3300049581 Ga0501047_0171204 Ga0501047_0171204_112_1080 290
175 3300049823 Ga0501044_0118955 Ga0501044_0118955_368_1336 290
176 3300053125 Ga0500618_001740 Ga0500618_001740_4863_5807 290
177 3300005288 Ga0065714_10025571 Ga0065714_100255712 291
178 3300005289 Ga0065704_10021353 Ga0065704_100213532 291
179 3300006186 Ga0075369_10076972 Ga0075369_100769722 291
180 3300009011 Ga0105251_10001611 Ga0105251_100016112 291
181 3300009092 Ga0105250_10009453 Ga0105250_100094532 291
182 3300013102 Ga0157371_10014859 Ga0157371_100148593 291
183 3300015261 Ga0182006_1004985 Ga0182006_10049853 291
184 3300025711 Ga0207696_1000321 Ga0207696_10003218 291
185 3300025735 Ga0207713_1001350 Ga0207713_100135022 291
186 3300027312 Ga0209371_1000313 Ga0209371_100031311 291
187 3300030500 Ga0268256_1000274 Ga0268256_100027411 291
188 3300031733 Ga0316577_10066050 Ga0316577_100660502 291
189 3300032004 Ga0307414_10050157 Ga0307414_100501572 291
190 3300035398 Ga0316574_0039225 Ga0316574_0039225_1867_2796 291
191 3300036712 Ga0316584_0197863 Ga0316584_0197863_412_1341 291
192 3300041407 Ga0439447_006793 Ga0439447_006793_192_1121 291
193 3300041411 Ga0439466_0012135 Ga0439466_0012135_2203_3132 291
194 3300042010 Ga0439452_004303 Ga0439452_004303_2524_3453 291
195 3300042439 Ga0439464_0004657 Ga0439464_0004657_1913_2842 291
196 3300046474 Ga0495605_0000080 Ga0495605_0000080_69239_70168 291
197 3300046475 Ga0495639_0000126 Ga0495639_0000126_63_992 291
198 3300046507 Ga0495606_0000446 Ga0495606_0000446_344_1273 291
199 3300046515 Ga0495620_0000794 Ga0495620_0000794_18256_19185 291
200 3300046665 Ga0495661_0000005 Ga0495661_0000005_314172_315101 291
201 3300046665 Ga0495661_0000039 Ga0495661_0000039_152295_153239 291
202 3300046665 Ga0495661_0000902 Ga0495661_0000902_287_1231 291
203 3300046665 Ga0495661_0027623 Ga0495661_0027623_108_1037 291
204 3300046794 Ga0495589_0024008 Ga0495589_0024008_442_1371 291
205 3300047317 Ga0495604_0003167 Ga0495604_0003167_12172_13116 291
206 3300047320 Ga0495672_0000457 Ga0495672_0000457_821_1750 291
207 3300047322 Ga0495680_0000133 Ga0495680_0000133_64_1008 291
208 3300048920 Ga0496117_0092404 Ga0496117_0092404_58_987 291
209 3300048924 Ga0496121_0300509 Ga0496121_0300509_28_957 291
210 3300048929 Ga0496126_0161159 Ga0496126_0161159_956_1885 291
211 3300002737 JGI25162J39368_1000042 JGI25162J39368_10000422 292
212 3300002772 JGI25164J39214_1000023 JGI25164J39214_1000023165 292
213 3300003214 JGI25165J46597_1000083 JGI25165J46597_1000083172 292
214 3300005338 Ga0068868_100226593 Ga0068868_1002265932 292
215 3300005355 Ga0070671_100000018 Ga0070671_100000018127 292
216 3300005364 Ga0070673_100000555 Ga0070673_1000005557 292
217 3300005365 Ga0070688_100021754 Ga0070688_1000217545 292
218 3300005466 Ga0070685_10002814 Ga0070685_1000281410 292
219 3300005617 Ga0068859_100084338 Ga0068859_1000843383 292
220 3300005617 Ga0068859_100352960 Ga0068859_1003529601 292
221 3300005842 Ga0068858_100159853 Ga0068858_1001598532 292
222 3300006931 Ga0097620_100084342 Ga0097620_1000843423 292
223 3300006931 Ga0097620_100352952 Ga0097620_1003529521 292
224 3300006946 Ga0079104_1000094 Ga0079104_100009497 292
225 3300006948 Ga0099826_10011129 Ga0099826_100111298 292
226 3300009011 Ga0105251_10000018 Ga0105251_1000001848 292
227 3300009036 Ga0105244_10026037 Ga0105244_100260373 292
228 3300009148 Ga0105243_10301603 Ga0105243_103016031 292
229 3300014497 Ga0182008_10001585 Ga0182008_100015852 292
230 3300015265 Ga0182005_1007772 Ga0182005_10077724 292
231 3300025207 Ga0209760_100114 Ga0209760_10011418 292
232 3300025231 Ga0207427_100008 Ga0207427_100008456 292
233 3300025233 Ga0209437_100014 Ga0209437_100014255 292
234 3300025261 Ga0209233_1000008 Ga0209233_1000008255 292
235 3300025711 Ga0207696_1000152 Ga0207696_100015292 292
236 3300025728 Ga0207655_1000005 Ga0207655_1000005871 292
237 3300025735 Ga0207713_1000009 Ga0207713_1000009425 292
238 3300025735 Ga0207713_1014802 Ga0207713_10148025 292
239 3300025918 Ga0207662_10091244 Ga0207662_100912442 292
240 3300025931 Ga0207644_10000026 Ga0207644_1000002651 292
241 3300025931 Ga0207644_10391206 Ga0207644_103912061 292
242 3300025935 Ga0207709_10215720 Ga0207709_102157202 292
243 3300025941 Ga0207711_10000916 Ga0207711_1000091614 292
244 3300025960 Ga0207651_10001985 Ga0207651_100019853 292
245 3300025960 Ga0207651_10022583 Ga0207651_100225833 292
246 3300026023 Ga0207677_10520769 Ga0207677_105207691 292
247 3300027111 Ga0209281_1000212 Ga0209281_100021236 292
248 3300027666 Ga0209282_1062287 Ga0209282_10622872 292
249 3300028379 Ga0268266_10007962 Ga0268266_100079628 292
250 3300028380 Ga0268265_10001280 Ga0268265_1000128014 292
251 3300031344 Ga0265316_10031071 Ga0265316_100310711 292
252 3300041405 Ga0439438_005048 Ga0439438_005048_168_1097 292
253 3300041407 Ga0439447_000211 Ga0439447_000211_10760_11689 292
254 3300041999 Ga0439433_0029689 Ga0439433_0029689_201_1133 292
255 3300046458 Ga0495591_019750 Ga0495591_019750_1172_2116 292
256 3300046471 Ga0495650_0000771 Ga0495650_0000771_14596_15525 292
257 3300046471 Ga0495650_0052447 Ga0495650_0052447_115_1044 292
258 3300046491 Ga0495584_0003040 Ga0495584_0003040_8316_9245 292
259 3300046500 Ga0495596_0000158 Ga0495596_0000158_2323_3252 292
260 3300046501 Ga0495607_0009211 Ga0495607_0009211_341_1270 292
261 3300046501 Ga0495607_0054190 Ga0495607_0054190_514_1443 292
262 3300046506 Ga0495583_0000163 Ga0495583_0000163_475_1404 292
263 3300046518 Ga0495631_0000173 Ga0495631_0000173_62_991 292
264 3300046519 Ga0495632_0021543 Ga0495632_0021543_1072_2001 292
265 3300046520 Ga0495637_0001539 Ga0495637_0001539_11743_12672 292
266 3300046520 Ga0495637_0005610 Ga0495637_0005610_93_1022 292
267 3300046528 Ga0495642_0000026 Ga0495642_0000026_2393_3322 292
268 3300046530 Ga0495654_0010608 Ga0495654_0010608_458_1387 292
269 3300046530 Ga0495654_0018665 Ga0495654_0018665_2604_3533 292
270 3300046538 Ga0495609_0006345 Ga0495609_0006345_674_1603 292
271 3300046616 Ga0495668_0006597 Ga0495668_0006597_860_1789 292
272 3300046648 Ga0495611_0001990 Ga0495611_0001990_539_1468 292
273 3300046660 Ga0495625_0000672 Ga0495625_0000672_18078_19007 292
274 3300046660 Ga0495625_0075533 Ga0495625_0075533_120_1049 292
275 3300046692 Ga0495671_0007645 Ga0495671_0007645_3559_4488 292
276 3300046692 Ga0495671_0098889 Ga0495671_0098889_398_1327 292
277 3300046694 Ga0495649_0003858 Ga0495649_0003858_2032_2961 292
278 3300046809 Ga0495600_0106520 Ga0495600_0106520_825_1754 292
279 3300047318 Ga0495636_0016929 Ga0495636_0016929_57_986 292
280 3300047322 Ga0495680_0064885 Ga0495680_0064885_1797_2726 292
281 3300047323 Ga0495683_0021324 Ga0495683_0021324_78_1007 292
282 3300047469 Ga0495673_0000986 Ga0495673_0000986_705_1634 292
283 3300047469 Ga0495673_0005224 Ga0495673_0005224_6224_7153 292
284 3300047470 Ga0495681_0020802 Ga0495681_0020802_18_947 292
285 3300047472 Ga0495686_0003503 Ga0495686_0003503_11731_12660 292
286 3300048904 Ga0496101_0034108 Ga0496101_0034108_679_1641 292
287 3300048909 Ga0496106_0108702 Ga0496106_0108702_887_1849 292
288 3300048917 Ga0496114_0000221 Ga0496114_0000221_12286_13248 292
289 3300048918 Ga0496115_0036453 Ga0496115_0036453_99_1061 292
290 3300048919 Ga0496116_0000185 Ga0496116_0000185_122924_123853 292
291 3300048920 Ga0496117_0042975 Ga0496117_0042975_72_1028 292
292 3300048921 Ga0496118_0016643 Ga0496118_0016643_663_1619 292
293 3300048924 Ga0496121_0001963 Ga0496121_0001963_31805_32734 292
294 3300049459 Ga0495678_076198 Ga0495678_076198_95_1024 292
295 3300049460 Ga0495682_0000018 Ga0495682_0000018_184599_185528 292
296 3300049460 Ga0495682_0000430 Ga0495682_0000430_22027_22971 292
297 3300049580 Ga0501046_0387201 Ga0501046_0387201_46_975 292
298 3300049742 Ga0501080_0087960 Ga0501080_0087960_382_1350 292
299 3300049744 Ga0501083_0007760 Ga0501083_0007760_5210_6178 292
300 3300054114 Ga0501084_0317520 Ga0501084_0317520_103_1071 292
301 3300055283 Ga0500661_005983 Ga0500661_005983_532_1461 292
302 2124908027 MRS2a_Contig_70 MRS2a_00559320 293
303 3300002737 JGI25162J39368_1000080 JGI25162J39368_10000802 293
304 3300002771 JGI25163J39215_1000372 JGI25163J39215_100037218 293
305 3300002772 JGI25164J39214_1000073 JGI25164J39214_100007390 293
306 3300003214 JGI25165J46597_1000152 JGI25165J46597_1000152102 293
307 3300003781 Ga0055536_1000233 Ga0055536_10002332 293
308 3300003791 Ga0055530_10000120 Ga0055530_100001202 293
309 3300005288 Ga0065714_10002428 Ga0065714_100024287 293
310 3300005289 Ga0065704_10070222 Ga0065704_1007022252 293
311 3300005289 Ga0065704_10096962 Ga0065704_100969623 293
312 3300005289 Ga0065704_10124729 Ga0065704_101247291 293
313 3300005344 Ga0070661_100000627 Ga0070661_1000006277 293
314 3300005353 Ga0070669_100000772 Ga0070669_1000007723 293
315 3300005367 Ga0070667_100160148 Ga0070667_1001601482 293
316 3300005439 Ga0070711_100334663 Ga0070711_1003346632 293
317 3300005471 Ga0070698_100027044 Ga0070698_1000270442 293
318 3300005564 Ga0070664_100000249 Ga0070664_1000002492 293
319 3300005614 Ga0068856_100084694 Ga0068856_1000846944 293
320 3300005617 Ga0068859_100208360 Ga0068859_1002083602 293
321 3300006880 Ga0075429_100040676 Ga0075429_1000406762 293
322 3300006881 Ga0068865_100219847 Ga0068865_1002198472 293
323 3300006931 Ga0097620_100208347 Ga0097620_1002083472 293
324 3300006944 Ga0099823_1000434 Ga0099823_100043420 293
325 3300009011 Ga0105251_10001230 Ga0105251_100012302 293
326 3300009011 Ga0105251_10014300 Ga0105251_100143001 293
327 3300009011 Ga0105251_10036689 Ga0105251_100366893 293
328 3300009036 Ga0105244_10000169 Ga0105244_100001692 293
329 3300009036 Ga0105244_10006937 Ga0105244_100069372 293
330 3300009036 Ga0105244_10009003 Ga0105244_100090038 293
331 3300009036 Ga0105244_10160461 Ga0105244_101604611 293
332 3300009092 Ga0105250_10000068 Ga0105250_100000689 293
333 3300009092 Ga0105250_10055877 Ga0105250_100558772 293
334 3300009148 Ga0105243_10000165 Ga0105243_1000016511 293
335 3300009176 Ga0105242_10000347 Ga0105242_1000034740 293
336 3300009545 Ga0105237_10000279 Ga0105237_1000027964 293
337 3300011119 Ga0105246_10385500 Ga0105246_103855002 293
338 3300013100 Ga0157373_10089816 Ga0157373_100898161 293
339 3300013102 Ga0157371_10000526 Ga0157371_1000052643 293
340 3300013104 Ga0157370_10051426 Ga0157370_100514262 293
341 3300013105 Ga0157369_10281575 Ga0157369_102815752 293
342 3300013307 Ga0157372_10007270 Ga0157372_100072709 293
343 3300013307 Ga0157372_10105128 Ga0157372_101051282 293
344 3300014969 Ga0157376_10568358 Ga0157376_105683582 293
345 3300020075 Ga0206349_1335876 Ga0206349_13358761 293
346 3300020080 Ga0206350_10447066 Ga0206350_104470661 293
347 3300020081 Ga0206354_10004808 Ga0206354_100048081 293
348 3300021384 Ga0213876_10166480 Ga0213876_101664802 293
349 3300025207 Ga0209760_100200 Ga0209760_10020024 293
350 3300025231 Ga0207427_100001 Ga0207427_1000011062 293
351 3300025233 Ga0209437_100003 Ga0209437_100003310 293
352 3300025256 Ga0209759_1008333 Ga0209759_10083333 293
353 3300025261 Ga0209233_1000007 Ga0209233_10000071062 293
354 3300025292 Ga0209676_1000021 Ga0209676_1000021385 293
355 3300025292 Ga0209676_1000887 Ga0209676_100088724 293
356 3300025298 Ga0209050_1000162 Ga0209050_100016242 293
357 3300025303 Ga0209051_1000121 Ga0209051_1000121110 293
358 3300025711 Ga0207696_1000010 Ga0207696_1000010476 293
359 3300025711 Ga0207696_1002724 Ga0207696_10027242 293
360 3300025711 Ga0207696_1026926 Ga0207696_10269262 293
361 3300025728 Ga0207655_1000077 Ga0207655_1000077134 293
362 3300025728 Ga0207655_1000081 Ga0207655_1000081198 293
363 3300025728 Ga0207655_1000142 Ga0207655_100014279 293
364 3300025728 Ga0207655_1000355 Ga0207655_100035536 293
365 3300025728 Ga0207655_1006459 Ga0207655_10064599 293
366 3300025728 Ga0207655_1017422 Ga0207655_10174223 293
367 3300025728 Ga0207655_1037853 Ga0207655_10378532 293
368 3300025728 Ga0207655_1047736 Ga0207655_10477362 293
369 3300025735 Ga0207713_1000140 Ga0207713_10001402 293
370 3300025735 Ga0207713_1002312 Ga0207713_10023123 293
371 3300025735 Ga0207713_1011740 Ga0207713_10117402 293
372 3300025735 Ga0207713_1018496 Ga0207713_10184962 293
373 3300025735 Ga0207713_1021749 Ga0207713_10217492 293
374 3300025735 Ga0207713_1033412 Ga0207713_10334123 293
375 3300025914 Ga0207671_10000343 Ga0207671_1000034360 293
376 3300025916 Ga0207663_10287331 Ga0207663_102873311 293
377 3300025917 Ga0207660_10121118 Ga0207660_101211182 293
378 3300025920 Ga0207649_10000013 Ga0207649_10000013137 293
379 3300025923 Ga0207681_10001775 Ga0207681_100017757 293
380 3300025925 Ga0207650_10000457 Ga0207650_1000045729 293
381 3300025928 Ga0207700_10034652 Ga0207700_100346522 293
382 3300025934 Ga0207686_10002848 Ga0207686_100028482 293
383 3300025935 Ga0207709_10000210 Ga0207709_1000021065 293
384 3300025936 Ga0207670_10006399 Ga0207670_100063992 293
385 3300025945 Ga0207679_10000005 Ga0207679_10000005391 293
386 3300027296 Ga0209389_1000096 Ga0209389_100009630 293
387 3300027312 Ga0209371_1003165 Ga0209371_10031653 293
388 3300028379 Ga0268266_10004632 Ga0268266_1000463213 293
389 3300028666 Ga0265336_10011445 Ga0265336_100114453 293
390 3300030500 Ga0268256_1002878 Ga0268256_10028789 293
391 3300035398 Ga0316574_0076029 Ga0316574_0076029_374_1303 293
392 3300039062 Ga0400483_255384 Ga0400483_255384_8587_9516 293
393 3300041405 Ga0439438_001068 Ga0439438_001068_617_1546 293
394 3300041405 Ga0439438_007586 Ga0439438_007586_129_1058 293
395 3300041411 Ga0439466_0001699 Ga0439466_0001699_120_1049 293
396 3300041411 Ga0439466_0008472 Ga0439466_0008472_2758_3687 293
397 3300042013 Ga0439456_000020 Ga0439456_000020_5642_6571 293
398 3300042136 Ga0450900_007603 Ga0450900_007603_118_1047 293
399 3300042137 Ga0450902_000273 Ga0450902_000273_2966_3895 293
400 3300046453 Ga0495627_000014 Ga0495627_000014_136252_137181 293
401 3300046453 Ga0495627_007415 Ga0495627_007415_222_1151 293
402 3300046455 Ga0495603_0000214 Ga0495603_0000214_28904_29833 293
403 3300046458 Ga0495591_000037 Ga0495591_000037_17606_18535 293
404 3300046458 Ga0495591_002255 Ga0495591_002255_7226_8155 293
405 3300046458 Ga0495591_012102 Ga0495591_012102_547_1476 293
406 3300046458 Ga0495591_030462 Ga0495591_030462_564_1493 293
407 3300046460 Ga0495638_0027401 Ga0495638_0027401_2716_3645 293
408 3300046463 Ga0495653_0010746 Ga0495653_0010746_2149_3093 293
409 3300046471 Ga0495650_0000400 Ga0495650_0000400_23460_24389 293
410 3300046471 Ga0495650_0001163 Ga0495650_0001163_5866_6795 293
411 3300046471 Ga0495650_0005172 Ga0495650_0005172_5906_6835 293
412 3300046471 Ga0495650_0006191 Ga0495650_0006191_2692_3621 293
413 3300046471 Ga0495650_0008988 Ga0495650_0008988_38_967 293
414 3300046471 Ga0495650_0023056 Ga0495650_0023056_1272_2201 293
415 3300046471 Ga0495650_0060208 Ga0495650_0060208_175_1104 293
416 3300046474 Ga0495605_0000799 Ga0495605_0000799_3347_4276 293
417 3300046474 Ga0495605_0002510 Ga0495605_0002510_2027_2956 293
418 3300046491 Ga0495584_0092489 Ga0495584_0092489_170_1099 293
419 3300046492 Ga0495585_0000533 Ga0495585_0000533_32601_33542 293
420 3300046492 Ga0495585_0019173 Ga0495585_0019173_1714_2643 293
421 3300046492 Ga0495585_0086749 Ga0495585_0086749_639_1568 293
422 3300046500 Ga0495596_0007028 Ga0495596_0007028_4036_4965 293
423 3300046500 Ga0495596_0047395 Ga0495596_0047395_376_1305 293
424 3300046501 Ga0495607_0030293 Ga0495607_0030293_719_1648 293
425 3300046501 Ga0495607_0030793 Ga0495607_0030793_1184_2113 293
426 3300046501 Ga0495607_0054226 Ga0495607_0054226_744_1673 293
427 3300046501 Ga0495607_0178704 Ga0495607_0178704_63_992 293
428 3300046506 Ga0495583_0000028 Ga0495583_0000028_11721_12650 293
429 3300046506 Ga0495583_0000347 Ga0495583_0000347_19095_20024 293
430 3300046506 Ga0495583_0001875 Ga0495583_0001875_9665_10594 293
431 3300046506 Ga0495583_0004224 Ga0495583_0004224_7417_8346 293
432 3300046506 Ga0495583_0105205 Ga0495583_0105205_138_1067 293
433 3300046507 Ga0495606_0000094 Ga0495606_0000094_131660_132589 293
434 3300046507 Ga0495606_0000818 Ga0495606_0000818_2401_3345 293
435 3300046507 Ga0495606_0011575 Ga0495606_0011575_3705_4634 293
436 3300046512 Ga0495610_0030364 Ga0495610_0030364_305_1234 293
437 3300046512 Ga0495610_0043109 Ga0495610_0043109_1211_2140 293
438 3300046513 Ga0495616_0035211 Ga0495616_0035211_1583_2512 293
439 3300046515 Ga0495620_0000172 Ga0495620_0000172_44522_45451 293
440 3300046518 Ga0495631_0007089 Ga0495631_0007089_188_1117 293
441 3300046519 Ga0495632_0000273 Ga0495632_0000273_44397_45326 293
442 3300046520 Ga0495637_0000081 Ga0495637_0000081_41838_42767 293
443 3300046520 Ga0495637_0003911 Ga0495637_0003911_6594_7523 293
444 3300046520 Ga0495637_0037605 Ga0495637_0037605_1123_2052 293
445 3300046522 Ga0495643_0000475 Ga0495643_0000475_44649_45578 293
446 3300046522 Ga0495643_0013442 Ga0495643_0013442_3586_4515 293
447 3300046524 Ga0495648_0000349 Ga0495648_0000349_44320_45249 293
448 3300046524 Ga0495648_0002654 Ga0495648_0002654_13306_14247 293
449 3300046524 Ga0495648_0016373 Ga0495648_0016373_3379_4308 293
450 3300046524 Ga0495648_0062379 Ga0495648_0062379_924_1853 293
451 3300046530 Ga0495654_0005155 Ga0495654_0005155_5971_6900 293
452 3300046530 Ga0495654_0022212 Ga0495654_0022212_839_1768 293
453 3300046538 Ga0495609_0000248 Ga0495609_0000248_18733_19662 293
454 3300046538 Ga0495609_0000395 Ga0495609_0000395_28519_29448 293
455 3300046538 Ga0495609_0013865 Ga0495609_0013865_2804_3733 293
456 3300046538 Ga0495609_0022219 Ga0495609_0022219_1269_2198 293
457 3300046542 Ga0495597_0001034 Ga0495597_0001034_8061_8990 293
458 3300046648 Ga0495611_0000736 Ga0495611_0000736_6001_6930 293
459 3300046648 Ga0495611_0050525 Ga0495611_0050525_823_1752 293
460 3300046660 Ga0495625_0000016 Ga0495625_0000016_202741_203670 293
461 3300046665 Ga0495661_0000001 Ga0495661_0000001_676794_677723 293
462 3300046665 Ga0495661_0000179 Ga0495661_0000179_14168_15097 293
463 3300046665 Ga0495661_0000205 Ga0495661_0000205_5863_6792 293
464 3300046665 Ga0495661_0000437 Ga0495661_0000437_28703_29632 293
465 3300046665 Ga0495661_0007711 Ga0495661_0007711_136_1065 293
466 3300046684 Ga0495669_0105595 Ga0495669_0105595_265_1194 293
467 3300046692 Ga0495671_0011783 Ga0495671_0011783_885_1814 293
468 3300046692 Ga0495671_0023795 Ga0495671_0023795_1260_2189 293
469 3300046694 Ga0495649_0012425 Ga0495649_0012425_1556_2485 293
470 3300046810 Ga0495660_0004376 Ga0495660_0004376_217_1146 293
471 3300046810 Ga0495660_0045161 Ga0495660_0045161_25_954 293
472 3300047320 Ga0495672_0016519 Ga0495672_0016519_2423_3352 293
473 3300047320 Ga0495672_0043474 Ga0495672_0043474_997_1926 293
474 3300047321 Ga0495676_0000001 Ga0495676_0000001_321539_322468 293
475 3300047321 Ga0495676_0000171 Ga0495676_0000171_31564_32493 293
476 3300047443 Ga0495687_000159 Ga0495687_000159_61070_61999 293
477 3300047445 Ga0495677_0091149 Ga0495677_0091149_99_1028 293
478 3300047446 Ga0495679_000119 Ga0495679_000119_40499_41428 293
479 3300047446 Ga0495679_000278 Ga0495679_000278_9900_10829 293
480 3300047446 Ga0495679_003448 Ga0495679_003448_5945_6874 293
481 3300047469 Ga0495673_0005076 Ga0495673_0005076_280_1224 293
482 3300047469 Ga0495673_0005732 Ga0495673_0005732_487_1416 293
483 3300047469 Ga0495673_0006861 Ga0495673_0006861_111_1040 293
484 3300047469 Ga0495673_0015905 Ga0495673_0015905_1251_2180 293
485 3300047469 Ga0495673_0038111 Ga0495673_0038111_131_1060 293
486 3300047469 Ga0495673_0125151 Ga0495673_0125151_60_989 293
487 3300048091 Ga0495626_0000002 Ga0495626_0000002_393071_394012 293
488 3300048091 Ga0495626_0000123 Ga0495626_0000123_14464_15393 293
489 3300048091 Ga0495626_0096001 Ga0495626_0096001_279_1208 293
490 3300048905 Ga0496102_0283632 Ga0496102_0283632_424_1353 293
491 3300048907 Ga0496104_0552272 Ga0496104_0552272_83_1051 293
492 3300048911 Ga0496108_0229256 Ga0496108_0229256_549_1478 293
493 3300048913 Ga0496110_0098039 Ga0496110_0098039_48_977 293
494 3300048917 Ga0496114_0042962 Ga0496114_0042962_2724_3653 293
495 3300048920 Ga0496117_0011122 Ga0496117_0011122_2184_3113 293
496 3300048920 Ga0496117_0011654 Ga0496117_0011654_5622_6551 293
497 3300048920 Ga0496117_0071070 Ga0496117_0071070_524_1453 293
498 3300048921 Ga0496118_0004428 Ga0496118_0004428_13344_14273 293
499 3300048922 Ga0496119_0001076 Ga0496119_0001076_1184_2113 293
500 3300048923 Ga0496120_0002302 Ga0496120_0002302_1184_2113 293
501 3300048924 Ga0496121_0003265 Ga0496121_0003265_2470_3399 293
502 3300048924 Ga0496121_0016182 Ga0496121_0016182_447_1376 293
503 3300048925 Ga0496122_0000156 Ga0496122_0000156_6195_7124 293
504 3300048925 Ga0496122_0000597 Ga0496122_0000597_50618_51559 293
505 3300048925 Ga0496122_0029704 Ga0496122_0029704_3510_4439 293
506 3300048925 Ga0496122_0031715 Ga0496122_0031715_2570_3499 293
507 3300048926 Ga0496123_0000087 Ga0496123_0000087_175669_176598 293
508 3300048926 Ga0496123_0000343 Ga0496123_0000343_21896_22837 293
509 3300048926 Ga0496123_0001070 Ga0496123_0001070_17626_18555 293
510 3300048926 Ga0496123_0037161 Ga0496123_0037161_1624_2553 293
511 3300048927 Ga0496124_0001532 Ga0496124_0001532_5682_6611 293
512 3300048927 Ga0496124_0014222 Ga0496124_0014222_559_1488 293
513 3300048927 Ga0496124_0120863 Ga0496124_0120863_672_1601 293
514 3300048927 Ga0496124_0128998 Ga0496124_0128998_441_1370 293
515 3300048927 Ga0496124_0160735 Ga0496124_0160735_365_1294 293
516 3300048928 Ga0496125_0011854 Ga0496125_0011854_7559_8488 293
517 3300048928 Ga0496125_0014108 Ga0496125_0014108_633_1562 293
518 3300048928 Ga0496125_0017212 Ga0496125_0017212_5253_6182 293
519 3300048929 Ga0496126_0091717 Ga0496126_0091717_1009_1938 293
520 3300049459 Ga0495678_000008 Ga0495678_000008_374127_375056 293
521 3300049459 Ga0495678_001763 Ga0495678_001763_8868_9797 293
522 3300049460 Ga0495682_0000156 Ga0495682_0000156_20636_21565 293
523 3300049460 Ga0495682_0056421 Ga0495682_0056421_386_1315 293
524 3300049571 Ga0501034_0000084 Ga0501034_0000084_161465_162394 293
525 3300049581 Ga0501047_0039937 Ga0501047_0039937_1970_2938 293
526 3300049586 Ga0501070_0053041 Ga0501070_0053041_1482_2450 293
527 3300049705 Ga0501225_0000785 Ga0501225_0000785_1945_2916 293
528 3300053098 Ga0500650_0009793 Ga0500650_0009793_2821_3750 293
529 3300053135 Ga0500659_0000019 Ga0500659_0000019_36811_37755 293
530 3300053135 Ga0500659_0005159 Ga0500659_0005159_3746_4675 293
531 3300059657 Ga0587118_01388 Ga0587118_01388_326_1324 293
532 3300060353 Ga0501082_0067305 Ga0501082_0067305_2072_3040 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

211

291

0.98

PF01012

ETF

Electron transfer flavoprotein domain

21

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.9484 1 166
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8528 1 166
7qh2-assembly1.cif.gz_E cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.7548 3 139
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.7527 2 164
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.703 1 163
ID Description Score Start End Superfamily
1efvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9463 1 167 3.40.50.620
af_Q12480_22_209_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9419 2 140 3.40.50.620
af_A0A1D8PQF9_17_202_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9307 1 167 3.40.50.620
af_Q4DG52_12_193_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9298 3 167 3.40.50.620
af_P78790_28_214_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8937 1 167 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6A7Z6C1-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 1 68 140 GO:0009055
GO:0033539
GO:0050660
AF-A0A431V9C0-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9907 57 140 GO:0009055
GO:0033539
GO:0050660
AF-A0A4R0WTS4-F1-model_v4 deleted 0.9846 46 132
AF-A0A7X6EP53-F1-model_v4 deleted 0.9818 46 131
AF-A0A6N9BS25-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9807 1 137 GO:0009055
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
74.02 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map