metagRoot

F460153

General Info

Members	Datasets	Scaffolds	Average Seq Length
531	328	515	181

Family's Representative Sequence

Representative Sequence	3300031824\|Ga0307413_11121263\|Ga0307413_111212631
Length	201
Sequence	MNKPAMNQPAPVPGKPPTGAFVFAGVIIALFFIGLMGLLYYGVKKSDTANRDALPSPLIGKPAPAFDLPLLHEPGKRLTLAELRGQPFVMNVWGSWCPECRVEHPVLSKFAMTKRVRFIGYDLKDTREDALAWLERFGNPYLMVVADESGRTAIDWGIYGAPETFLVDAEGIVRWKHVGAVTDQIIKDELVPLLDKLDAEK

Samples

	Sample ID	Description	Type	Environment
1	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
2	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
3	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
4	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
5	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
6	2739367700	Dyella sp. YR388	Isolate	Unclassified
7	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
8	2842914999	Luteibacter sp. R-72151	Isolate	Unclassified
9	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
10	2884411467	Dyella sp. AD56	Isolate	Rhizosphere
11	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
12	2895395659	Rhodanobacter sp. T12-5	Isolate	Unclassified
13	2919085039	Luteibacter sp. 1214	Isolate	Unclassified
14	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
15	2928963466	Dyella japonica 1073	Isolate	Unclassified
16	3300001432	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
17	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
18	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
19	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
20	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
21	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
22	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
23	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
24	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
25	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
26	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
27	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
28	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
29	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
30	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
31	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
32	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
33	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
34	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
35	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
36	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
37	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
38	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
39	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
40	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
41	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
42	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
43	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
44	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
45	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
46	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
47	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
48	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
49	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
50	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
51	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
52	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
55	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
56	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
57	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
58	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
59	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
60	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
61	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
62	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
63	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
64	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
65	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
66	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
67	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
68	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
69	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
70	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
71	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
72	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
73	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
74	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
75	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
76	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
77	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
78	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
79	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
80	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
81	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
82	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
83	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
84	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
85	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
88	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
89	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
90	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
91	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
92	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
93	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
94	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
95	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
96	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
97	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
98	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
99	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
100	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
101	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
102	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
103	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
104	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
105	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
106	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
107	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
108	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
109	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
110	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
111	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
112	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
113	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
114	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
115	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
116	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
117	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
118	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
119	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
120	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
121	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
132	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
133	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
135	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
136	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
183	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
187	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
188	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
189	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
190	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
191	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
192	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
193	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
194	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
195	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
196	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
197	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
198	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
199	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
200	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
201	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
202	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
203	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
204	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
205	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
206	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
207	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
208	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
209	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
210	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
211	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
212	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
213	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
214	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
215	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
216	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
217	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
218	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
219	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
220	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
221	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
222	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
223	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
224	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
225	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
226	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
227	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
228	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
229	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
230	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
231	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
232	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
233	3300042132	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133	Metagenome	Rhizosphere
234	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
235	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
236	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
237	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
238	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
239	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
240	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
241	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
242	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
243	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
244	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
245	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
246	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
247	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
248	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
249	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
250	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
251	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
252	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
253	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
254	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
255	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
256	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
257	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
258	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
259	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
260	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
261	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
262	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
263	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
264	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
265	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
266	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
267	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
268	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
269	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
270	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
271	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
272	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
273	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
274	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
275	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
276	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
277	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
278	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
279	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
280	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
281	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
282	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
283	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
284	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
285	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
286	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
287	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
288	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
289	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
290	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
291	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
292	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
293	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
294	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
295	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
296	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
297	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
298	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
299	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
300	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
301	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
302	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
303	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
304	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
305	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
306	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
307	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
308	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
309	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
310	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
311	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
312	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
313	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
314	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
315	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
316	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
317	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
318	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
319	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
320	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
321	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
322	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
323	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
324	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
325	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
326	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
327	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
328	8002869464	Pseudoxanthomonas helianthi 110414	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	96.42
Metatranscriptomes	0.56
Isolates	3.01

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.04
Nodule	0
Rhizoplane	4.71
Rhizosphere	72.69
Stem	0
Stem Tuber	0
Unclassified	13.56

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24034J14986_100688	3300001432	Unclassified	1995
2	JGI24740J21852_10001236	3300001979	Bacteria	11564
3	JGI24739J22299_10000042	3300001989	Bacteria	34840
4	JGI24739J22299_10000993	3300001989	Bacteria	10563
5	JGI24739J22299_10080609	3300001989	Bacteria	1000
6	JGI24737J22298_10102794	3300001990	Bacteria	847
7	JGI24735J21928_10002640	3300002067	Bacteria	6198
8	JGI24735J21928_10065975	3300002067	Bacteria	1038
9	JGI24735J21928_10065991	3300002067	Bacteria	1038
10	JGI24748J21848_1000003	3300002074	Bacteria	323921
11	JGI24034J26672_10000005	3300002239	Bacteria	404185
12	JGI25162J39368_1000068	3300002737	Bacteria	129594
13	JGI25162J39368_1000746	3300002737	Bacteria	22266
14	JGI25162J39368_1001106	3300002737	Bacteria	16314
15	JGI25157J39369_1000164	3300002741	Bacteria	55890
16	JGI25163J39215_1000810	3300002771	Bacteria	7525
17	JGI25164J39214_1000102	3300002772	Bacteria	83707
18	JGI25165J46597_1000058	3300003214	Bacteria	212833
19	JGI25153J46596_10016799	3300003215	Bacteria	2914
20	rootH2_10078875	3300003320	Bacteria	7182
21	rootL2_10190377	3300003322	Bacteria	1590
22	rootL2_10271993	3300003322	Unclassified	2172
23	Ga0006562J51391_1167572	3300003578	Bacteria	2828
24	Ga0055538_1001545	3300003751	Bacteria	4235
25	Ga0055533_1000578	3300003756	Bacteria	12888
26	Ga0055535_1000034	3300003761	Bacteria	181954
27	Ga0055542_1000081	3300003762	Bacteria	129595
28	Ga0055542_1000112	3300003762	Bacteria	107429
29	Ga0055529_1000083	3300003763	Bacteria	146729
30	Ga0055536_1002367	3300003781	Bacteria	10653
31	Ga0055531_10026730	3300003794	Bacteria	2048
32	Ga0065165_1003057	3300005262	Bacteria	12525
33	Ga0065714_10014374	3300005288	Bacteria	1870
34	Ga0065704_10085165	3300005289	Bacteria	3253
35	Ga0065704_10173272	3300005289	Bacteria	1274
36	Ga0065704_10348914	3300005289	Bacteria	804
37	Ga0070658_10004472	3300005327	Bacteria	11385
38	Ga0068869_100074629	3300005334	Bacteria	2517
39	Ga0068869_100131673	3300005334	Bacteria	1923
40	Ga0070666_10000005	3300005335	Bacteria	343092
41	Ga0070682_100009128	3300005337	Bacteria	5604
42	Ga0068868_100181890	3300005338	Unclassified	1744
43	Ga0070660_100070160	3300005339	Bacteria	2734
44	Ga0070660_101167482	3300005339	Bacteria	652
45	Ga0070689_100009283	3300005340	Bacteria	6969
46	Ga0070689_101120684	3300005340	Bacteria	704
47	Ga0070689_101327832	3300005340	Unclassified	648
48	Ga0070661_100140209	3300005344	Bacteria	1822
49	Ga0070661_100268255	3300005344	Bacteria	1321
50	Ga0070675_100120711	3300005354	Bacteria	2227
51	Ga0070671_100019529	3300005355	Bacteria	5517
52	Ga0070667_100019888	3300005367	Bacteria	5572
53	Ga0070714_100143182	3300005435	Bacteria	2148
54	Ga0070700_100018060	3300005441	Bacteria	4048
55	Ga0070663_100059718	3300005455	Bacteria	2741
56	Ga0070663_100942267	3300005455	Bacteria	748
57	Ga0070678_100542569	3300005456	Bacteria	1031
58	Ga0070662_100031622	3300005457	Bacteria	3715
59	Ga0070681_10044654	3300005458	Bacteria	4436
60	Ga0070681_10105978	3300005458	Bacteria	2753
61	Ga0068867_100226634	3300005459	Bacteria	1509
62	Ga0068867_100375957	3300005459	Bacteria	1192
63	Ga0068867_100807508	3300005459	Bacteria	837
64	Ga0070685_10001904	3300005466	Bacteria	10846
65	Ga0070685_10416300	3300005466	Bacteria	934
66	Ga0070707_100302516	3300005468	Bacteria	1554
67	Ga0070679_100091463	3300005530	Bacteria	3031
68	Ga0070672_100210216	3300005543	Unclassified	1629
69	Ga0070686_100486594	3300005544	Unclassified	955
70	Ga0070695_100150005	3300005545	Bacteria	1626
71	Ga0070696_100001471	3300005546	Bacteria	15424
72	Ga0070696_100013864	3300005546	Bacteria	5411
73	Ga0070693_100290203	3300005547	Bacteria	1099
74	Ga0070665_100035393	3300005548	Bacteria	5021
75	Ga0070704_100171112	3300005549	Bacteria	1728
76	Ga0068855_100107326	3300005563	Bacteria	3208
77	Ga0068855_100195563	3300005563	Bacteria	2278
78	Ga0070664_101068195	3300005564	Bacteria	760
79	Ga0068857_100037439	3300005577	Bacteria	4297
80	Ga0068857_100123661	3300005577	Bacteria	2331
81	Ga0068854_100010072	3300005578	Bacteria	6122
82	Ga0068854_100124690	3300005578	Bacteria	1960
83	Ga0068856_100427577	3300005614	Bacteria	1344
84	Ga0068852_100116813	3300005616	Bacteria	2435
85	Ga0068859_100196653	3300005617	Bacteria	2101
86	Ga0068863_100148320	3300005841	Bacteria	2244
87	Ga0068858_100001055	3300005842	Bacteria	28485
88	Ga0068858_100219575	3300005842	Bacteria	1800
89	Ga0068858_100675438	3300005842	Bacteria	1004
90	Ga0068862_100105256	3300005844	Bacteria	2473
91	Ga0068862_100129045	3300005844	Unclassified	2235
92	Ga0068862_100767518	3300005844	Bacteria	939
93	Ga0070712_100191621	3300006175	Bacteria	1600
94	Ga0075369_10109045	3300006186	Bacteria	1247
95	Ga0075431_100666185	3300006847	Bacteria	1020
96	Ga0075433_10084101	3300006852	Unclassified	2808
97	Ga0075434_100030727	3300006871	Bacteria	5292
98	Ga0075434_100056243	3300006871	Bacteria	3910
99	Ga0075434_101347474	3300006871	Unclassified	724
100	Ga0075429_100135033	3300006880	Bacteria	2159
101	Ga0097620_100196653	3300006931	Bacteria	2101
102	Ga0099794_10054957	3300007265	Bacteria	1923
103	Ga0099795_10002413	3300007788	Bacteria	4394
104	Ga0105251_10000060	3300009011	Bacteria	102799
105	Ga0105244_10000425	3300009036	Bacteria	39065
106	Ga0105240_10013498	3300009093	Bacteria	11219
107	Ga0105240_10013812	3300009093	Bacteria	11061
108	Ga0105240_10145050	3300009093	Bacteria	2834
109	Ga0105240_10183504	3300009093	Bacteria	2467
110	Ga0105240_10462021	3300009093	Bacteria	1418
111	Ga0105240_11093742	3300009093	Bacteria	848
112	Ga0105240_11956681	3300009093	Unclassified	610
113	Ga0105245_10364753	3300009098	Bacteria	1434
114	Ga0105245_10674967	3300009098	Unclassified	1065
115	Ga0105247_10000022	3300009101	Bacteria	219796
116	Ga0105247_10438651	3300009101	Bacteria	939
117	Ga0114129_10045173	3300009147	Bacteria	6193
118	Ga0114129_10115840	3300009147	Bacteria	3693
119	Ga0114129_10255600	3300009147	Unclassified	2350
120	Ga0105243_10000424	3300009148	Bacteria	44307
121	Ga0105242_10005536	3300009176	Bacteria	9749
122	Ga0105242_10019562	3300009176	Bacteria	5307
123	Ga0105248_10038325	3300009177	Bacteria	5364
124	Ga0105248_10538780	3300009177	Bacteria	1317
125	Ga0105248_11192610	3300009177	Unclassified	861
126	Ga0105237_10000023	3300009545	Bacteria	226144
127	Ga0105238_10000060	3300009551	Bacteria	129934
128	Ga0105238_10140530	3300009551	Bacteria	2392
129	Ga0105238_10214863	3300009551	Bacteria	1899
130	Ga0105249_10148874	3300009553	Bacteria	2251
131	Ga0105249_10524503	3300009553	Unclassified	1232
132	Ga0105148_101419	3300009978	Bacteria	1680
133	Ga0099796_10002752	3300010159	Bacteria	3941
134	Ga0099796_10100467	3300010159	Bacteria	1088
135	Ga0105239_10000044	3300010375	Bacteria	187680
136	Ga0105239_10189062	3300010375	Unclassified	2305
137	Ga0157314_1000333	3300012500	Bacteria	4914
138	Ga0157373_10076260	3300013100	Bacteria	2366
139	Ga0157371_10058920	3300013102	Bacteria	2723
140	Ga0157371_10074342	3300013102	Bacteria	2407
141	Ga0157370_10000184	3300013104	Bacteria	78500
142	Ga0157370_10001227	3300013104	Bacteria	32113
143	Ga0157369_10474386	3300013105	Bacteria	1295
144	Ga0157369_10749242	3300013105	Bacteria	1005
145	Ga0157369_11279332	3300013105	Bacteria	748
146	Ga0157378_10000048	3300013297	Bacteria	104914
147	Ga0163162_10020407	3300013306	Bacteria	6511
148	Ga0163162_10078188	3300013306	Bacteria	3373
149	Ga0163162_10092519	3300013306	Bacteria	3108
150	Ga0163162_10927472	3300013306	Bacteria	983
151	Ga0157372_10027676	3300013307	Bacteria	6178
152	Ga0157372_10156191	3300013307	Bacteria	2635
153	Ga0157375_10006149	3300013308	Bacteria	10461
154	Ga0157380_10162969	3300014326	Bacteria	1940
155	Ga0157380_10433674	3300014326	Bacteria	1257
156	Ga0182008_10114070	3300014497	Bacteria	1340
157	Ga0182008_10380459	3300014497	Bacteria	754
158	Ga0157376_10189670	3300014969	Bacteria	1884
159	Ga0157376_10795726	3300014969	Bacteria	958
160	Ga0182005_1000004	3300015265	Bacteria	609645
161	Ga0182005_1003519	3300015265	Bacteria	5292
162	Ga0183368_1003	3300015687	Bacteria	1276390
163	Ga0213873_10133027	3300021358	Bacteria	738
164	Ga0213876_10113990	3300021384	Bacteria	1435
165	Ga0209435_101303	3300025206	Bacteria	3253
166	Ga0209760_100462	3300025207	Bacteria	9090
167	Ga0207672_1000762	3300025223	Bacteria	3521
168	Ga0209784_100016	3300025224	Bacteria	481036
169	Ga0209566_108785	3300025225	Bacteria	1077
170	Ga0209674_100012	3300025226	Bacteria	950162
171	Ga0209672_100673	3300025228	Bacteria	17260
172	Ga0209672_110198	3300025228	Bacteria	1283
173	Ga0209147_105599	3300025229	Bacteria	1855
174	Ga0207427_100019	3300025231	Bacteria	513977
175	Ga0207427_101783	3300025231	Bacteria	6969
176	Ga0209437_100012	3300025233	Bacteria	792625
177	Ga0209437_100192	3300025233	Bacteria	122888
178	Ga0209437_105321	3300025233	Bacteria	2197
179	Ga0209258_100039	3300025242	Bacteria	386366
180	Ga0209258_100308	3300025242	Bacteria	77195
181	Ga0209258_105782	3300025242	Bacteria	2034
182	Ga0209646_1000307	3300025246	Bacteria	39199
183	Ga0209026_1000012	3300025250	Bacteria	480426
184	Ga0209026_1004293	3300025250	Bacteria	4294
185	Ga0209148_1000001	3300025254	Bacteria	2545271
186	Ga0209148_1000005	3300025254	Bacteria	1806504
187	Ga0209759_1000852	3300025256	Bacteria	23718
188	Ga0209759_1018234	3300025256	Bacteria	1702
189	Ga0209129_1005950	3300025258	Bacteria	4110
190	Ga0209233_1000002	3300025261	Bacteria	2501366
191	Ga0209233_1013295	3300025261	Bacteria	2354
192	Ga0209455_1000039	3300025272	Bacteria	437734
193	Ga0209455_1004252	3300025272	Bacteria	4762
194	Ga0209676_1000024	3300025292	Bacteria	578839
195	Ga0209758_1002406	3300025297	Bacteria	19172
196	Ga0209051_1009664	3300025303	Bacteria	4949
197	Ga0209257_1000122	3300025304	Bacteria	219678
198	Ga0209257_1000647	3300025304	Bacteria	55358
199	Ga0207656_10001499	3300025321	Bacteria	7733
200	Ga0207642_10053072	3300025899	Bacteria	1843
201	Ga0207710_10000001	3300025900	Bacteria	1797433
202	Ga0207688_10346520	3300025901	Bacteria	915
203	Ga0207680_10000005	3300025903	Bacteria	660983
204	Ga0207647_10013852	3300025904	Bacteria	5583
205	Ga0207705_10005669	3300025909	Bacteria	9320
206	Ga0207707_10006499	3300025912	Bacteria	10209
207	Ga0207695_10000294	3300025913	Bacteria	123676
208	Ga0207695_10001068	3300025913	Bacteria	47945
209	Ga0207695_10002599	3300025913	Bacteria	26471
210	Ga0207695_10108712	3300025913	Bacteria	2756
211	Ga0207695_10122195	3300025913	Bacteria	2570
212	Ga0207671_10000020	3300025914	Bacteria	309636
213	Ga0207671_10000033	3300025914	Bacteria	245869
214	Ga0207693_10703513	3300025915	Bacteria	783
215	Ga0207662_10217240	3300025918	Unclassified	1243
216	Ga0207649_10101661	3300025920	Bacteria	1904
217	Ga0207649_10103031	3300025920	Bacteria	1893
218	Ga0207649_10573324	3300025920	Bacteria	866
219	Ga0207646_10178459	3300025922	Bacteria	1918
220	Ga0207681_10041118	3300025923	Bacteria	3080
221	Ga0207694_10004524	3300025924	Bacteria	10847
222	Ga0207694_10287112	3300025924	Bacteria	1352
223	Ga0207664_10104258	3300025929	Bacteria	2348
224	Ga0207706_10057683	3300025933	Bacteria	3420
225	Ga0207686_10001523	3300025934	Bacteria	13066
226	Ga0207709_10004283	3300025935	Bacteria	8264
227	Ga0207709_10401358	3300025935	Bacteria	1048
228	Ga0207670_10002849	3300025936	Bacteria	9128
229	Ga0207670_10451270	3300025936	Bacteria	1037
230	Ga0207669_10107910	3300025937	Unclassified	1858
231	Ga0207665_10089589	3300025939	Bacteria	2131
232	Ga0207711_10029317	3300025941	Bacteria	4641
233	Ga0207667_10000130	3300025949	Bacteria	115321
234	Ga0207667_10000293	3300025949	Bacteria	69188
235	Ga0207667_10511437	3300025949	Bacteria	1217
236	Ga0207640_10000103	3300025981	Bacteria	65214
237	Ga0207640_10172871	3300025981	Unclassified	1612
238	Ga0207677_10250386	3300026023	Unclassified	1438
239	Ga0207703_10000024	3300026035	Bacteria	217968
240	Ga0207703_10164506	3300026035	Bacteria	1945
241	Ga0207703_10267668	3300026035	Bacteria	1547
242	Ga0207678_10179267	3300026067	Bacteria	1809
243	Ga0207678_11126767	3300026067	Bacteria	695
244	Ga0207708_10000028	3300026075	Bacteria	164263
245	Ga0207702_10330178	3300026078	Bacteria	1455
246	Ga0207641_10120857	3300026088	Bacteria	2337
247	Ga0207648_10227745	3300026089	Unclassified	1658
248	Ga0207648_10280625	3300026089	Bacteria	1489
249	Ga0207674_10000218	3300026116	Bacteria	71563
250	Ga0207674_10173322	3300026116	Bacteria	2110
251	Ga0207674_10592026	3300026116	Unclassified	1071
252	Ga0207675_100003230	3300026118	Bacteria	15989
253	Ga0207683_10566630	3300026121	Bacteria	1050
254	Ga0207683_11355181	3300026121	Bacteria	658
255	Ga0207698_10097956	3300026142	Bacteria	2422
256	Ga0209179_1001085	3300027512	Bacteria	3163
257	Ga0209588_1027319	3300027671	Bacteria	1815
258	Ga0209974_10024636	3300027876	Bacteria	1991
259	Ga0265354_1003169	3300028016	Bacteria	1882
260	Ga0268266_10000004	3300028379	Bacteria	1495817
261	Ga0268266_10955913	3300028379	Bacteria	829
262	Ga0268265_10070046	3300028380	Bacteria	2726
263	Ga0268264_10840914	3300028381	Bacteria	919
264	Ga0307515_10289974	3300028794	Bacteria	1333
265	Ga0265770_1000545	3300030878	Bacteria	5229
266	Ga0265760_10003768	3300031090	Bacteria	4395
267	Ga0307513_10006158	3300031456	Bacteria	15740
268	Ga0307513_10255507	3300031456	Bacteria	1546
269	Ga0307509_10227025	3300031507	Bacteria	1674
270	Ga0307408_100213480	3300031548	Bacteria	1570
271	Ga0316575_10133328	3300031665	Bacteria	1020
272	Ga0316576_10002788	3300031727	Bacteria	10044
273	Ga0316576_10006647	3300031727	Bacteria	7223
274	Ga0316576_10171426	3300031727	Unclassified	1638
275	Ga0316578_10270063	3300031728	Unclassified	1019
276	Ga0307516_10000172	3300031730	Bacteria	82701
277	Ga0307405_10490616	3300031731	Bacteria	982
278	Ga0316577_10071374	3300031733	Bacteria	1938
279	Ga0307413_10007898	3300031824	Bacteria	4978
280	Ga0307413_11121263	3300031824	Bacteria	680
281	Ga0307407_10362592	3300031903	Bacteria	1029
282	Ga0307412_10166618	3300031911	Bacteria	1643
283	Ga0307409_100145394	3300031995	Bacteria	2050
284	Ga0307409_100575819	3300031995	Bacteria	1109
285	Ga0307416_100335247	3300032002	Bacteria	1522
286	Ga0307414_10000988	3300032004	Bacteria	14519
287	Ga0307414_10005876	3300032004	Bacteria	6789
288	Ga0307414_10008147	3300032004	Bacteria	5922
289	Ga0307414_10022495	3300032004	Bacteria	3977
290	Ga0307414_10067133	3300032004	Bacteria	2567
291	Ga0307414_10274828	3300032004	Bacteria	1413
292	Ga0307414_10304241	3300032004	Bacteria	1350
293	Ga0307414_10852101	3300032004	Bacteria	833
294	Ga0307411_10205687	3300032005	Bacteria	1515
295	Ga0307507_10114690	3300033179	Bacteria	2184
296	Ga0307510_10020810	3300033180	Bacteria	7659
297	Ga0307510_10106428	3300033180	Bacteria	2568
298	Ga0316574_0005752	3300035398	Bacteria	6647
299	Ga0316574_0007776	3300035398	Bacteria	5903
300	Ga0316574_0040702	3300035398	Bacteria	2862
301	Ga0316574_0053674	3300035398	Bacteria	2516
302	Ga0316574_0274318	3300035398	Bacteria	1075
303	Ga0316574_0408810	3300035398	Bacteria	854
304	Ga0373924_0001169	3300035410	Bacteria	8430
305	Ga0373924_0026798	3300035410	Bacteria	2288
306	Ga0316584_0063328	3300036712	Bacteria	2769
307	Ga0316584_0064163	3300036712	Bacteria	2750
308	Ga0316584_0137646	3300036712	Bacteria	1822
309	Ga0373925_0562417	3300037068	Bacteria	938
310	Ga0395899_0209410	3300037312	Bacteria	1355
311	Ga0395900_0054156	3300037418	Bacteria	4130
312	Ga0395900_0800366	3300037418	Bacteria	870
313	Ga0395898_0041237	3300037466	Bacteria	4560
314	Ga0395898_0058111	3300037466	Bacteria	3766
315	Ga0395898_0062487	3300037466	Bacteria	3616
316	Ga0395905_0014398	3300037471	Bacteria	7555
317	Ga0395901_0070083	3300038443	Bacteria	3652
318	Ga0395901_0136428	3300038443	Bacteria	2578
319	Ga0242420_014637	3300038996	Bacteria	1349
320	Ga0237816_01067	3300039145	Bacteria	2258
321	Ga0436365_0807829	3300039437	Bacteria	4947
322	Ga0436360_1060628	3300039438	Bacteria	3435
323	Ga0436363_1400277	3300039450	Bacteria	1548
324	Ga0439461_0032138	3300041410	Bacteria	1099
325	Ga0439465_0004603	3300041413	Bacteria	4453
326	Ga0439465_0005256	3300041413	Bacteria	4144
327	Ga0439465_0155448	3300041413	Bacteria	818
328	Ga0451789_0571663	3300041443	Bacteria	2244
329	Ga0451791_0312661	3300041451	Bacteria	904
330	Ga0451793_0206665	3300041452	Bacteria	1411
331	Ga0451793_0481626	3300041452	Bacteria	894
332	Ga0451793_0485827	3300041452	Bacteria	854
333	Ga0451797_1563674	3300041453	Bacteria	1634
334	Ga0451843_1144287	3300041509	Bacteria	1462
335	Ga0439431_0062220	3300041997	Bacteria	984
336	Ga0439445_0005598	3300042004	Bacteria	2868
337	Ga0439432_113877	3300042006	Bacteria	803
338	Ga0439449_0000207	3300042007	Bacteria	20712
339	Ga0439449_0001465	3300042007	Bacteria	9251
340	Ga0439449_0039466	3300042007	Bacteria	1755
341	Ga0450920_007210	3300042122	Bacteria	2012
342	Ga0450895_005825	3300042132	Bacteria	999
343	Ga0439446_0007391	3300042156	Bacteria	2886
344	Ga0451577_0084501	3300042876	Bacteria	2832
345	Ga0466972_0365234	3300044658	Bacteria	675
346	Ga0466982_0000020	3300044672	Bacteria	99164
347	Ga0453683_0037063	3300044673	Unclassified	3068
348	Ga0466966_0014471	3300044684	Bacteria	5222
349	Ga0466961_0056030	3300044693	Bacteria	2512
350	Ga0466964_0022723	3300044706	Bacteria	2435
351	Ga0453684_0000437	3300044712	Bacteria	169900
352	Ga0453684_0071269	3300044712	Bacteria	4395
353	Ga0466971_0045723	3300044719	Bacteria	1966
354	Ga0466968_0082276	3300044735	Bacteria	1416
355	Ga0466957_0295131	3300044842	Bacteria	1088
356	Ga0466960_0017122	3300044901	Bacteria	3154
357	Ga0466959_0068363	3300045049	Bacteria	2574
358	Ga0451576_0000081	3300045051	Bacteria	239875
359	Ga0451576_0109572	3300045051	Bacteria	2873
360	Ga0451576_0560101	3300045051	Bacteria	1201
361	Ga0451576_0718334	3300045051	Bacteria	1050
362	Ga0495627_000013	3300046453	Bacteria	332765
363	Ga0495627_000515	3300046453	Bacteria	32034
364	Ga0495591_000020	3300046458	Bacteria	217845
365	Ga0495638_0000159	3300046460	Bacteria	106490
366	Ga0495638_0000161	3300046460	Bacteria	104406
367	Ga0495638_0000246	3300046460	Bacteria	74281
368	Ga0495638_0030394	3300046460	Bacteria	3478
369	Ga0495650_0000197	3300046471	Bacteria	131300
370	Ga0495650_0000590	3300046471	Bacteria	50202
371	Ga0495650_0008170	3300046471	Bacteria	6155
372	Ga0495605_0000047	3300046474	Bacteria	171270
373	Ga0495605_0002483	3300046474	Bacteria	11408
374	Ga0495607_0000307	3300046501	Bacteria	51080
375	Ga0495607_0001496	3300046501	Bacteria	20713
376	Ga0495607_0001899	3300046501	Bacteria	17718
377	Ga0495607_0002088	3300046501	Bacteria	16692
378	Ga0495607_0011423	3300046501	Bacteria	5910
379	Ga0495607_0049182	3300046501	Bacteria	2460
380	Ga0495607_0128753	3300046501	Bacteria	1320
381	Ga0495583_0020846	3300046506	Bacteria	3383
382	Ga0495606_0000940	3300046507	Bacteria	42915
383	Ga0495606_0030456	3300046507	Bacteria	3770
384	Ga0495606_0030714	3300046507	Bacteria	3748
385	Ga0495610_0029252	3300046512	Bacteria	2904
386	Ga0495616_0013053	3300046513	Bacteria	4697
387	Ga0495620_0000681	3300046515	Bacteria	21016
388	Ga0495631_0003761	3300046518	Bacteria	8255
389	Ga0495632_0009865	3300046519	Bacteria	5710
390	Ga0495632_0022177	3300046519	Bacteria	3407
391	Ga0495663_0007954	3300046525	Bacteria	2931
392	Ga0495654_0001351	3300046530	Bacteria	17056
393	Ga0495654_0070742	3300046530	Bacteria	1654
394	Ga0495597_0000004	3300046542	Bacteria	307496
395	Ga0495622_0266898	3300046557	Bacteria	751
396	Ga0495668_0037210	3300046616	Bacteria	2723
397	Ga0495625_0207372	3300046660	Bacteria	1290
398	Ga0495671_0008987	3300046692	Bacteria	5607
399	Ga0495671_0021852	3300046692	Bacteria	3355
400	Ga0495671_0024507	3300046692	Bacteria	3142
401	Ga0495649_0002293	3300046694	Bacteria	13595
402	Ga0495660_0000771	3300046810	Bacteria	24010
403	Ga0495660_0001378	3300046810	Bacteria	16697
404	Ga0495672_0006139	3300047320	Bacteria	9375
405	Ga0495672_0036513	3300047320	Bacteria	3017
406	Ga0495672_0042411	3300047320	Bacteria	2744
407	Ga0495681_0083465	3300047470	Bacteria	1422
408	Ga0495686_0000019	3300047472	Bacteria	434054
409	Ga0496101_0112681	3300048904	Bacteria	2049
410	Ga0496104_0005245	3300048907	Bacteria	11326
411	Ga0496104_1374218	3300048907	Bacteria	609
412	Ga0496105_0005865	3300048908	Bacteria	9367
413	Ga0496105_0084977	3300048908	Bacteria	2614
414	Ga0496106_0032530	3300048909	Bacteria	3889
415	Ga0496106_0381293	3300048909	Bacteria	1133
416	Ga0496107_0029915	3300048910	Bacteria	3879
417	Ga0496107_0171438	3300048910	Bacteria	1610
418	Ga0496107_0868029	3300048910	Unclassified	659
419	Ga0496112_0400774	3300048915	Bacteria	1312
420	Ga0496113_0473273	3300048916	Bacteria	1007
421	Ga0496114_0009483	3300048917	Bacteria	7727
422	Ga0496115_0000025	3300048918	Bacteria	151658
423	Ga0496115_0000974	3300048918	Bacteria	20806
424	Ga0496115_0017359	3300048918	Bacteria	5500
425	Ga0496115_0022193	3300048918	Bacteria	4914
426	Ga0496115_0148144	3300048918	Bacteria	1937
427	Ga0496116_0067577	3300048919	Bacteria	2282
428	Ga0496116_0128315	3300048919	Bacteria	1451
429	Ga0496117_0019447	3300048920	Bacteria	5576
430	Ga0496117_0050917	3300048920	Bacteria	2932
431	Ga0496118_0001376	3300048921	Bacteria	36678
432	Ga0496118_0004230	3300048921	Bacteria	17222
433	Ga0496118_0014443	3300048921	Bacteria	7394
434	Ga0496118_0139900	3300048921	Bacteria	1536
435	Ga0496119_0001095	3300048922	Bacteria	34129
436	Ga0496119_0021552	3300048922	Bacteria	4652
437	Ga0496120_0000656	3300048923	Bacteria	50861
438	Ga0496120_0003409	3300048923	Bacteria	14536
439	Ga0496121_0009617	3300048924	Bacteria	11074
440	Ga0496121_0018955	3300048924	Bacteria	6904
441	Ga0496121_0031517	3300048924	Bacteria	4842
442	Ga0496121_0049477	3300048924	Bacteria	3563
443	Ga0496121_0095870	3300048924	Bacteria	2304
444	Ga0496122_0012524	3300048925	Bacteria	8431
445	Ga0496122_0012864	3300048925	Bacteria	8272
446	Ga0496122_0019208	3300048925	Bacteria	6255
447	Ga0496122_0354397	3300048925	Bacteria	764
448	Ga0496123_0003009	3300048926	Bacteria	19474
449	Ga0496123_0008751	3300048926	Bacteria	9241
450	Ga0496123_0053475	3300048926	Bacteria	2668
451	Ga0496124_0000009	3300048927	Bacteria	734820
452	Ga0496124_0000411	3300048927	Bacteria	76929
453	Ga0496124_0000808	3300048927	Bacteria	50879
454	Ga0496124_0103593	3300048927	Bacteria	2302
455	Ga0496125_0000344	3300048928	Bacteria	88380
456	Ga0496125_0057679	3300048928	Bacteria	3143
457	Ga0496125_0197353	3300048928	Bacteria	1322
458	Ga0496126_0003518	3300048929	Bacteria	19705
459	Ga0496126_0023183	3300048929	Bacteria	6018
460	Ga0496126_0028609	3300048929	Bacteria	5308
461	Ga0496126_0041181	3300048929	Bacteria	4277
462	Ga0496126_0071704	3300048929	Bacteria	3083
463	Ga0496126_0127605	3300048929	Bacteria	2200
464	Ga0496126_0143338	3300048929	Bacteria	2054
465	Ga0495678_040877	3300049459	Bacteria	1860
466	Ga0495682_0224484	3300049460	Bacteria	665
467	Ga0501031_0024973	3300049568	Bacteria	3897
468	Ga0501032_0095339	3300049569	Bacteria	1972
469	Ga0501032_0111153	3300049569	Bacteria	1813
470	Ga0501033_0036018	3300049570	Bacteria	3709
471	Ga0501033_0123391	3300049570	Bacteria	1878
472	Ga0501034_0000498	3300049571	Bacteria	63644
473	Ga0501034_0002570	3300049571	Bacteria	21609
474	Ga0501034_0106025	3300049571	Bacteria	2803
475	Ga0501034_0231852	3300049571	Bacteria	1795
476	Ga0501036_0014667	3300049572	Bacteria	6531
477	Ga0501037_0070702	3300049573	Bacteria	2539
478	Ga0501037_0114306	3300049573	Bacteria	1943
479	Ga0501038_0073373	3300049574	Bacteria	2898
480	Ga0501038_0080138	3300049574	Bacteria	2752
481	Ga0501040_0343996	3300049576	Bacteria	1068
482	Ga0501043_0029780	3300049579	Bacteria	4289
483	Ga0501043_0697948	3300049579	Bacteria	741
484	Ga0501046_0125049	3300049580	Bacteria	1954
485	Ga0501047_0018881	3300049581	Bacteria	6612
486	Ga0501047_0021381	3300049581	Bacteria	6210
487	Ga0501047_0025248	3300049581	Bacteria	5710
488	Ga0501047_0461358	3300049581	Bacteria	1099
489	Ga0501067_0018447	3300049583	Bacteria	3865
490	Ga0501070_0155846	3300049586	Bacteria	1883
491	Ga0501070_0607729	3300049586	Bacteria	871
492	Ga0501071_0020233	3300049587	Bacteria	4624
493	Ga0501073_0000695	3300049589	Bacteria	23661
494	Ga0501073_0596988	3300049589	Bacteria	763
495	Ga0501077_0004764	3300049593	Bacteria	8249
496	Ga0501235_019981	3300049669	Bacteria	1487
497	Ga0501079_0063119	3300049741	Bacteria	2858
498	Ga0501080_0007265	3300049742	Bacteria	9994
499	Ga0501081_0611993	3300049743	Bacteria	816
500	Ga0501083_0640541	3300049744	Bacteria	691
501	Ga0501035_0037784	3300049822	Bacteria	4370
502	Ga0501044_0017345	3300049823	Bacteria	7722
503	Ga0501044_0074794	3300049823	Bacteria	3440
504	Ga0501045_0129898	3300049824	Bacteria	1873
505	nmdc:mga05p37_396834_c1	3300050507	Unclassified	1612
506	nmdc:mga05p37_40887_c1	3300050507	Bacteria	5692
507	nmdc:mga0n895_1020533_c1	3300050512	Unclassified	808
508	nmdc:mga0n895_56404_c1	3300050512	Bacteria	3870
509	nmdc:mga0a205_16694_c1	3300050515	Bacteria	6876
510	nmdc:mga0a205_7433_c1	3300050515	Bacteria	9921
511	nmdc:mga0sz30_37054_c1	3300050516	Bacteria	2040
512	Ga0500556_0000374	3300053104	Bacteria	32602
513	Ga0500573_0063946	3300053140	Bacteria	2105
514	Ga0500577_0168153	3300053142	Bacteria	937
515	Ga0501082_0289088	3300060353	Bacteria	1427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048917	Ga0496114_0009483	Ga0496114_0009483_871_1467	139
2	3300048929	Ga0496126_0041181	Ga0496126_0041181_2528_3124	139
3	3300005289	Ga0065704_10085165	Ga0065704_100851652	145
4	3300048915	Ga0496112_0400774	Ga0496112_0400774_50_502	146
5	3300026121	Ga0207683_11355181	Ga0207683_113551812	147
6	3300028379	Ga0268266_10955913	Ga0268266_109559131	153
7	iso_pu_bacteria	2842914999	2842916271	156
8	3300041997	Ga0439431_0062220	Ga0439431_0062220_338_949	157
9	3300042004	Ga0439445_0005598	Ga0439445_0005598_168_779	157
10	3300005289	Ga0065704_10173272	Ga0065704_101732721	158
11	3300032004	Ga0307414_10000988	Ga0307414_1000098811	158
12	3300041413	Ga0439465_0005256	Ga0439465_0005256_427_1044	158
13	3300042007	Ga0439449_0000207	Ga0439449_0000207_4462_5079	158
14	3300049571	Ga0501034_0000498	Ga0501034_0000498_54953_55525	158
15	iso_pu_bacteria	8002869464	8002871784	158
16	3300025923	Ga0207681_10041118	Ga0207681_100411183	159
17	3300032004	Ga0307414_10008147	Ga0307414_100081472	159
18	3300003781	Ga0055536_1002367	Ga0055536_100236712	160
19	3300005289	Ga0065704_10348914	Ga0065704_103489142	160
20	3300005435	Ga0070714_100143182	Ga0070714_1001431822	160
21	3300009978	Ga0105148_101419	Ga0105148_1014192	160
22	3300025292	Ga0209676_1000024	Ga0209676_1000024155	160
23	3300025304	Ga0209257_1000647	Ga0209257_100064731	160
24	3300025929	Ga0207664_10104258	Ga0207664_101042582	160
25	3300028794	Ga0307515_10289974	Ga0307515_102899742	160
26	3300031456	Ga0307513_10006158	Ga0307513_100061582	160
27	3300031456	Ga0307513_10255507	Ga0307513_102555072	160
28	3300031824	Ga0307413_11121263	Ga0307413_111212631	160
29	3300041410	Ga0439461_0032138	Ga0439461_0032138_473_1078	160
30	3300041413	Ga0439465_0004603	Ga0439465_0004603_12_617	160
31	3300041413	Ga0439465_0155448	Ga0439465_0155448_207_803	160
32	3300041451	Ga0451791_0312661	Ga0451791_0312661_178_768	160
33	3300041452	Ga0451793_0206665	Ga0451793_0206665_145_729	160
34	3300041452	Ga0451793_0481626	Ga0451793_0481626_237_827	160
35	3300041453	Ga0451797_1563674	Ga0451797_1563674_307_891	160
36	3300041509	Ga0451843_1144287	Ga0451843_1144287_142_732	160
37	3300042007	Ga0439449_0001465	Ga0439449_0001465_4484_5089	160
38	3300042007	Ga0439449_0039466	Ga0439449_0039466_144_740	160
39	3300046460	Ga0495638_0030394	Ga0495638_0030394_598_1188	160
40	3300046474	Ga0495605_0002483	Ga0495605_0002483_3832_4356	160
41	3300046525	Ga0495663_0007954	Ga0495663_0007954_2120_2725	160
42	3300046660	Ga0495625_0207372	Ga0495625_0207372_80_685	160
43	3300046692	Ga0495671_0008987	Ga0495671_0008987_2260_2865	160
44	3300048925	Ga0496122_0012864	Ga0496122_0012864_6250_6783	160
45	3300048925	Ga0496122_0019208	Ga0496122_0019208_2833_3438	160
46	3300048926	Ga0496123_0008751	Ga0496123_0008751_3758_4291	160
47	3300048926	Ga0496123_0053475	Ga0496123_0053475_258_863	160
48	3300048927	Ga0496124_0103593	Ga0496124_0103593_1165_1770	160
49	3300049571	Ga0501034_0002570	Ga0501034_0002570_11112_11708	160
50	3300053142	Ga0500577_0168153	Ga0500577_0168153_301_906	160
51	iso_pu_bacteria	2600255283	2601625164	160
52	iso_pu_bacteria	2643221579	2643908425	160
53	iso_pu_bacteria	2643221581	2643916267	160
54	iso_pu_bacteria	2739367700	2739731753	160
55	iso_pu_bacteria	2884338543	2884340332	160
56	iso_pu_bacteria	2884411467	2884414081	160
57	iso_pu_bacteria	2895395659	2895396714	160
58	iso_pu_bacteria	2919085039	2919085594	160
59	iso_pu_bacteria	2923516293	2923518043	160
60	iso_pu_bacteria	2928963466	2928967342	160
61	3300003794	Ga0055531_10026730	Ga0055531_100267302	161
62	3300025304	Ga0209257_1000122	Ga0209257_1000122136	161
63	3300042006	Ga0439432_113877	Ga0439432_113877_116_664	161
64	3300046501	Ga0495607_0011423	Ga0495607_0011423_4034_4612	161
65	3300046507	Ga0495606_0030456	Ga0495606_0030456_2175_2753	161
66	3300046512	Ga0495610_0029252	Ga0495610_0029252_1158_1736	161
67	3300046513	Ga0495616_0013053	Ga0495616_0013053_1271_1849	161
68	3300047470	Ga0495681_0083465	Ga0495681_0083465_40_618	161
69	3300048925	Ga0496122_0012524	Ga0496122_0012524_6132_6704	161
70	3300048926	Ga0496123_0003009	Ga0496123_0003009_12594_13166	161
71	3300048927	Ga0496124_0000009	Ga0496124_0000009_223647_224222	161
72	3300048929	Ga0496126_0071704	Ga0496126_0071704_1025_1597	161
73	iso_pu_bacteria	2842780639	2842781043	161
74	iso_pu_bacteria	2891633521	2891636339	161
75	3300001979	JGI24740J21852_10001236	JGI24740J21852_100012363	162
76	3300001989	JGI24739J22299_10000042	JGI24739J22299_1000004236	162
77	3300001989	JGI24739J22299_10000993	JGI24739J22299_100009939	162
78	3300001989	JGI24739J22299_10080609	JGI24739J22299_100806092	162
79	3300001990	JGI24737J22298_10102794	JGI24737J22298_101027942	162
80	3300002067	JGI24735J21928_10002640	JGI24735J21928_100026402	162
81	3300002067	JGI24735J21928_10065975	JGI24735J21928_100659752	162
82	3300002067	JGI24735J21928_10065991	JGI24735J21928_100659912	162
83	3300002737	JGI25162J39368_1000068	JGI25162J39368_100006822	162
84	3300002737	JGI25162J39368_1000746	JGI25162J39368_100074614	162
85	3300002737	JGI25162J39368_1001106	JGI25162J39368_100110613	162
86	3300002741	JGI25157J39369_1000164	JGI25157J39369_10001645	162
87	3300002771	JGI25163J39215_1000810	JGI25163J39215_10008106	162
88	3300002772	JGI25164J39214_1000102	JGI25164J39214_100010224	162
89	3300003214	JGI25165J46597_1000058	JGI25165J46597_1000058136	162
90	3300003215	JGI25153J46596_10016799	JGI25153J46596_100167994	162
91	3300003320	rootH2_10078875	rootH2_100788752	162
92	3300003322	rootL2_10190377	rootL2_101903773	162
93	3300003578	Ga0006562J51391_1167572	Ga0006562J51391_11675721	162
94	3300003751	Ga0055538_1001545	Ga0055538_10015452	162
95	3300003756	Ga0055533_1000578	Ga0055533_10005785	162
96	3300003761	Ga0055535_1000034	Ga0055535_100003481	162
97	3300003762	Ga0055542_1000081	Ga0055542_100008122	162
98	3300003762	Ga0055542_1000112	Ga0055542_100011221	162
99	3300003763	Ga0055529_1000083	Ga0055529_1000083137	162
100	3300005262	Ga0065165_1003057	Ga0065165_100305712	162
101	3300005288	Ga0065714_10014374	Ga0065714_100143742	162
102	3300005327	Ga0070658_10004472	Ga0070658_1000447211	162
103	3300005335	Ga0070666_10000005	Ga0070666_10000005234	162
104	3300005337	Ga0070682_100009128	Ga0070682_1000091284	162
105	3300005339	Ga0070660_100070160	Ga0070660_1000701603	162
106	3300005340	Ga0070689_100009283	Ga0070689_1000092833	162
107	3300005344	Ga0070661_100140209	Ga0070661_1001402092	162
108	3300005344	Ga0070661_100268255	Ga0070661_1002682553	162
109	3300005367	Ga0070667_100019888	Ga0070667_1000198886	162
110	3300005455	Ga0070663_100059718	Ga0070663_1000597184	162
111	3300005455	Ga0070663_100942267	Ga0070663_1009422672	162
112	3300005456	Ga0070678_100542569	Ga0070678_1005425692	162
113	3300005457	Ga0070662_100031622	Ga0070662_1000316222	162
114	3300005458	Ga0070681_10044654	Ga0070681_100446542	162
115	3300005458	Ga0070681_10105978	Ga0070681_101059782	162
116	3300005466	Ga0070685_10001904	Ga0070685_100019049	162
117	3300005466	Ga0070685_10416300	Ga0070685_104163002	162
118	3300005530	Ga0070679_100091463	Ga0070679_1000914632	162
119	3300005546	Ga0070696_100013864	Ga0070696_1000138644	162
120	3300005547	Ga0070693_100290203	Ga0070693_1002902032	162
121	3300005548	Ga0070665_100035393	Ga0070665_1000353936	162
122	3300005563	Ga0068855_100107326	Ga0068855_1001073263	162
123	3300005563	Ga0068855_100195563	Ga0068855_1001955632	162
124	3300005577	Ga0068857_100037439	Ga0068857_1000374392	162
125	3300005577	Ga0068857_100123661	Ga0068857_1001236613	162
126	3300005578	Ga0068854_100010072	Ga0068854_1000100723	162
127	3300005578	Ga0068854_100124690	Ga0068854_1001246901	162
128	3300005614	Ga0068856_100427577	Ga0068856_1004275772	162
129	3300005616	Ga0068852_100116813	Ga0068852_1001168134	162
130	3300005842	Ga0068858_100675438	Ga0068858_1006754382	162
131	3300005844	Ga0068862_100105256	Ga0068862_1001052563	162
132	3300006186	Ga0075369_10109045	Ga0075369_101090452	162
133	3300009011	Ga0105251_10000060	Ga0105251_1000006082	162
134	3300009036	Ga0105244_10000425	Ga0105244_1000042517	162
135	3300009093	Ga0105240_10013498	Ga0105240_100134984	162
136	3300009093	Ga0105240_10013812	Ga0105240_1001381210	162
137	3300009093	Ga0105240_10183504	Ga0105240_101835044	162
138	3300009093	Ga0105240_11093742	Ga0105240_110937422	162
139	3300009545	Ga0105237_10000023	Ga0105237_1000002313	162
140	3300009551	Ga0105238_10000060	Ga0105238_10000060106	162
141	3300009551	Ga0105238_10140530	Ga0105238_101405302	162
142	3300009551	Ga0105238_10214863	Ga0105238_102148632	162
143	3300010375	Ga0105239_10000044	Ga0105239_1000004489	162
144	3300012500	Ga0157314_1000333	Ga0157314_10003333	162
145	3300013100	Ga0157373_10076260	Ga0157373_100762602	162
146	3300013102	Ga0157371_10058920	Ga0157371_100589202	162
147	3300013104	Ga0157370_10000184	Ga0157370_1000018479	162
148	3300013104	Ga0157370_10001227	Ga0157370_100012278	162
149	3300013105	Ga0157369_10474386	Ga0157369_104743862	162
150	3300013105	Ga0157369_10749242	Ga0157369_107492422	162
151	3300013105	Ga0157369_11279332	Ga0157369_112793322	162
152	3300013306	Ga0163162_10020407	Ga0163162_100204072	162
153	3300013306	Ga0163162_10092519	Ga0163162_100925193	162
154	3300013306	Ga0163162_10927472	Ga0163162_109274722	162
155	3300013307	Ga0157372_10027676	Ga0157372_100276763	162
156	3300013307	Ga0157372_10156191	Ga0157372_101561912	162
157	3300014497	Ga0182008_10114070	Ga0182008_101140702	162
158	3300014497	Ga0182008_10380459	Ga0182008_103804591	162
159	3300014969	Ga0157376_10189670	Ga0157376_101896703	162
160	3300014969	Ga0157376_10795726	Ga0157376_107957262	162
161	3300015265	Ga0182005_1000004	Ga0182005_10000045	162
162	3300015265	Ga0182005_1003519	Ga0182005_10035194	162
163	3300015687	Ga0183368_1003	Ga0183368_1003983	162
164	3300025206	Ga0209435_101303	Ga0209435_1013032	162
165	3300025207	Ga0209760_100462	Ga0209760_10046211	162
166	3300025224	Ga0209784_100016	Ga0209784_100016373	162
167	3300025225	Ga0209566_108785	Ga0209566_1087852	162
168	3300025226	Ga0209674_100012	Ga0209674_100012729	162
169	3300025228	Ga0209672_100673	Ga0209672_10067316	162
170	3300025228	Ga0209672_110198	Ga0209672_1101981	162
171	3300025229	Ga0209147_105599	Ga0209147_1055992	162
172	3300025231	Ga0207427_100019	Ga0207427_10001941	162
173	3300025231	Ga0207427_101783	Ga0207427_1017832	162
174	3300025233	Ga0209437_100012	Ga0209437_100012202	162
175	3300025233	Ga0209437_100192	Ga0209437_100192112	162
176	3300025233	Ga0209437_105321	Ga0209437_1053213	162
177	3300025242	Ga0209258_100039	Ga0209258_100039379	162
178	3300025242	Ga0209258_100308	Ga0209258_10030848	162
179	3300025242	Ga0209258_105782	Ga0209258_1057821	162
180	3300025246	Ga0209646_1000307	Ga0209646_100030738	162
181	3300025250	Ga0209026_1000012	Ga0209026_1000012113	162
182	3300025250	Ga0209026_1004293	Ga0209026_10042935	162
183	3300025254	Ga0209148_1000001	Ga0209148_10000011644	162
184	3300025254	Ga0209148_1000005	Ga0209148_1000005715	162
185	3300025256	Ga0209759_1000852	Ga0209759_10008529	162
186	3300025256	Ga0209759_1018234	Ga0209759_10182343	162
187	3300025258	Ga0209129_1005950	Ga0209129_10059505	162
188	3300025261	Ga0209233_1000002	Ga0209233_1000002588	162
189	3300025261	Ga0209233_1013295	Ga0209233_10132953	162
190	3300025272	Ga0209455_1000039	Ga0209455_1000039379	162
191	3300025272	Ga0209455_1004252	Ga0209455_10042522	162
192	3300025297	Ga0209758_1002406	Ga0209758_10024065	162
193	3300025303	Ga0209051_1009664	Ga0209051_10096647	162
194	3300025321	Ga0207656_10001499	Ga0207656_100014996	162
195	3300025903	Ga0207680_10000005	Ga0207680_10000005592	162
196	3300025904	Ga0207647_10013852	Ga0207647_100138525	162
197	3300025909	Ga0207705_10005669	Ga0207705_100056695	162
198	3300025912	Ga0207707_10006499	Ga0207707_100064994	162
199	3300025913	Ga0207695_10000294	Ga0207695_1000029490	162
200	3300025913	Ga0207695_10001068	Ga0207695_1000106819	162
201	3300025913	Ga0207695_10002599	Ga0207695_1000259912	162
202	3300025913	Ga0207695_10108712	Ga0207695_101087121	162
203	3300025913	Ga0207695_10122195	Ga0207695_101221952	162
204	3300025914	Ga0207671_10000020	Ga0207671_10000020222	162
205	3300025914	Ga0207671_10000033	Ga0207671_1000003333	162
206	3300025920	Ga0207649_10101661	Ga0207649_101016612	162
207	3300025920	Ga0207649_10103031	Ga0207649_101030312	162
208	3300025920	Ga0207649_10573324	Ga0207649_105733242	162
209	3300025924	Ga0207694_10004524	Ga0207694_1000452412	162
210	3300025924	Ga0207694_10287112	Ga0207694_102871121	162
211	3300025933	Ga0207706_10057683	Ga0207706_100576834	162
212	3300025936	Ga0207670_10002849	Ga0207670_100028493	162
213	3300025949	Ga0207667_10000130	Ga0207667_10000130110	162
214	3300025949	Ga0207667_10000293	Ga0207667_1000029312	162
215	3300025949	Ga0207667_10511437	Ga0207667_105114372	162
216	3300025981	Ga0207640_10000103	Ga0207640_1000010320	162
217	3300026035	Ga0207703_10267668	Ga0207703_102676683	162
218	3300026067	Ga0207678_10179267	Ga0207678_101792673	162
219	3300026067	Ga0207678_11126767	Ga0207678_111267672	162
220	3300026078	Ga0207702_10330178	Ga0207702_103301782	162
221	3300026116	Ga0207674_10000218	Ga0207674_1000021877	162
222	3300026116	Ga0207674_10173322	Ga0207674_101733222	162
223	3300026121	Ga0207683_10566630	Ga0207683_105666302	162
224	3300026142	Ga0207698_10097956	Ga0207698_100979564	162
225	3300028379	Ga0268266_10000004	Ga0268266_10000004939	162
226	3300028380	Ga0268265_10070046	Ga0268265_100700463	162
227	3300028381	Ga0268264_10840914	Ga0268264_108409141	162
228	3300031507	Ga0307509_10227025	Ga0307509_102270252	162
229	3300033179	Ga0307507_10114690	Ga0307507_101146902	162
230	3300033180	Ga0307510_10020810	Ga0307510_100208109	162
231	3300033180	Ga0307510_10106428	Ga0307510_101064282	162
232	3300035398	Ga0316574_0005752	Ga0316574_0005752_5316_5846	162
233	3300035398	Ga0316574_0040702	Ga0316574_0040702_1706_2236	162
234	3300037312	Ga0395899_0209410	Ga0395899_0209410_520_1062	162
235	3300037418	Ga0395900_0054156	Ga0395900_0054156_470_1012	162
236	3300037418	Ga0395900_0800366	Ga0395900_0800366_53_595	162
237	3300037466	Ga0395898_0041237	Ga0395898_0041237_3395_3940	162
238	3300037466	Ga0395898_0058111	Ga0395898_0058111_2949_3491	162
239	3300037466	Ga0395898_0062487	Ga0395898_0062487_491_1033	162
240	3300037471	Ga0395905_0014398	Ga0395905_0014398_6379_6921	162
241	3300038443	Ga0395901_0070083	Ga0395901_0070083_151_696	162
242	3300038443	Ga0395901_0136428	Ga0395901_0136428_1848_2390	162
243	3300039145	Ga0237816_01067	Ga0237816_01067_706_1308	162
244	3300041443	Ga0451789_0571663	Ga0451789_0571663_352_894	162
245	3300041452	Ga0451793_0485827	Ga0451793_0485827_81_623	162
246	3300044658	Ga0466972_0365234	Ga0466972_0365234_47_589	162
247	3300044672	Ga0466982_0000020	Ga0466982_0000020_63404_63946	162
248	3300044684	Ga0466966_0014471	Ga0466966_0014471_3573_4115	162
249	3300044693	Ga0466961_0056030	Ga0466961_0056030_1208_1750	162
250	3300044706	Ga0466964_0022723	Ga0466964_0022723_867_1409	162
251	3300044719	Ga0466971_0045723	Ga0466971_0045723_174_716	162
252	3300044735	Ga0466968_0082276	Ga0466968_0082276_789_1331	162
253	3300044842	Ga0466957_0295131	Ga0466957_0295131_315_857	162
254	3300044901	Ga0466960_0017122	Ga0466960_0017122_2557_3099	162
255	3300045049	Ga0466959_0068363	Ga0466959_0068363_942_1484	162
256	3300046453	Ga0495627_000013	Ga0495627_000013_214776_215315	162
257	3300046453	Ga0495627_000515	Ga0495627_000515_24278_24814	162
258	3300046458	Ga0495591_000020	Ga0495591_000020_157482_158018	162
259	3300046460	Ga0495638_0000159	Ga0495638_0000159_17117_17659	162
260	3300046460	Ga0495638_0000161	Ga0495638_0000161_47496_48038	162
261	3300046460	Ga0495638_0000246	Ga0495638_0000246_45_587	162
262	3300046471	Ga0495650_0000197	Ga0495650_0000197_99736_100278	162
263	3300046471	Ga0495650_0000590	Ga0495650_0000590_14155_14697	162
264	3300046471	Ga0495650_0008170	Ga0495650_0008170_2671_3207	162
265	3300046474	Ga0495605_0000047	Ga0495605_0000047_77988_78524	162
266	3300046501	Ga0495607_0000307	Ga0495607_0000307_36550_37086	162
267	3300046501	Ga0495607_0001496	Ga0495607_0001496_12844_13380	162
268	3300046501	Ga0495607_0001899	Ga0495607_0001899_305_841	162
269	3300046501	Ga0495607_0002088	Ga0495607_0002088_4578_5114	162
270	3300046501	Ga0495607_0049182	Ga0495607_0049182_822_1364	162
271	3300046501	Ga0495607_0128753	Ga0495607_0128753_692_1228	162
272	3300046506	Ga0495583_0020846	Ga0495583_0020846_2809_3345	162
273	3300046507	Ga0495606_0000940	Ga0495606_0000940_17670_18212	162
274	3300046507	Ga0495606_0030714	Ga0495606_0030714_1100_1642	162
275	3300046515	Ga0495620_0000681	Ga0495620_0000681_14767_15303	162
276	3300046518	Ga0495631_0003761	Ga0495631_0003761_1084_1620	162
277	3300046519	Ga0495632_0009865	Ga0495632_0009865_2391_2927	162
278	3300046519	Ga0495632_0022177	Ga0495632_0022177_2265_2801	162
279	3300046530	Ga0495654_0001351	Ga0495654_0001351_3576_4112	162
280	3300046530	Ga0495654_0070742	Ga0495654_0070742_48_584	162
281	3300046542	Ga0495597_0000004	Ga0495597_0000004_210214_210750	162
282	3300046557	Ga0495622_0266898	Ga0495622_0266898_26_568	162
283	3300046616	Ga0495668_0037210	Ga0495668_0037210_136_675	162
284	3300046692	Ga0495671_0021852	Ga0495671_0021852_787_1323	162
285	3300046694	Ga0495649_0002293	Ga0495649_0002293_10531_11073	162
286	3300046810	Ga0495660_0000771	Ga0495660_0000771_7196_7732	162
287	3300046810	Ga0495660_0001378	Ga0495660_0001378_14021_14560	162
288	3300047320	Ga0495672_0006139	Ga0495672_0006139_1241_1777	162
289	3300047320	Ga0495672_0036513	Ga0495672_0036513_1376_1912	162
290	3300047320	Ga0495672_0042411	Ga0495672_0042411_1427_1963	162
291	3300047472	Ga0495686_0000019	Ga0495686_0000019_260992_261534	162
292	3300048904	Ga0496101_0112681	Ga0496101_0112681_435_977	162
293	3300048907	Ga0496104_1374218	Ga0496104_1374218_25_567	162
294	3300048908	Ga0496105_0084977	Ga0496105_0084977_830_1372	162
295	3300048909	Ga0496106_0381293	Ga0496106_0381293_101_643	162
296	3300048910	Ga0496107_0029915	Ga0496107_0029915_3059_3601	162
297	3300048916	Ga0496113_0473273	Ga0496113_0473273_448_993	162
298	3300048918	Ga0496115_0000025	Ga0496115_0000025_3798_4343	162
299	3300048918	Ga0496115_0000974	Ga0496115_0000974_17121_17663	162
300	3300048918	Ga0496115_0022193	Ga0496115_0022193_73_615	162
301	3300048918	Ga0496115_0148144	Ga0496115_0148144_1161_1703	162
302	3300048919	Ga0496116_0067577	Ga0496116_0067577_974_1510	162
303	3300048919	Ga0496116_0128315	Ga0496116_0128315_389_931	162
304	3300048920	Ga0496117_0019447	Ga0496117_0019447_1502_2044	162
305	3300048920	Ga0496117_0050917	Ga0496117_0050917_1606_2148	162
306	3300048921	Ga0496118_0001376	Ga0496118_0001376_19138_19680	162
307	3300048921	Ga0496118_0004230	Ga0496118_0004230_12600_13142	162
308	3300048921	Ga0496118_0014443	Ga0496118_0014443_351_893	162
309	3300048921	Ga0496118_0139900	Ga0496118_0139900_821_1363	162
310	3300048922	Ga0496119_0001095	Ga0496119_0001095_18050_18592	162
311	3300048922	Ga0496119_0021552	Ga0496119_0021552_2844_3386	162
312	3300048923	Ga0496120_0000656	Ga0496120_0000656_46027_46569	162
313	3300048923	Ga0496120_0003409	Ga0496120_0003409_12747_13289	162
314	3300048924	Ga0496121_0009617	Ga0496121_0009617_7198_7740	162
315	3300048924	Ga0496121_0018955	Ga0496121_0018955_1216_1758	162
316	3300048924	Ga0496121_0031517	Ga0496121_0031517_2644_3186	162
317	3300048924	Ga0496121_0049477	Ga0496121_0049477_2049_2591	162
318	3300048924	Ga0496121_0095870	Ga0496121_0095870_793_1335	162
319	3300048925	Ga0496122_0354397	Ga0496122_0354397_46_591	162
320	3300048927	Ga0496124_0000411	Ga0496124_0000411_38006_38551	162
321	3300048927	Ga0496124_0000808	Ga0496124_0000808_14041_14586	162
322	3300048928	Ga0496125_0000344	Ga0496125_0000344_69010_69552	162
323	3300048928	Ga0496125_0057679	Ga0496125_0057679_737_1279	162
324	3300048928	Ga0496125_0197353	Ga0496125_0197353_53_595	162
325	3300048929	Ga0496126_0003518	Ga0496126_0003518_12643_13185	162
326	3300048929	Ga0496126_0023183	Ga0496126_0023183_4364_4906	162
327	3300048929	Ga0496126_0028609	Ga0496126_0028609_2084_2626	162
328	3300048929	Ga0496126_0127605	Ga0496126_0127605_369_911	162
329	3300048929	Ga0496126_0143338	Ga0496126_0143338_1491_2033	162
330	3300049459	Ga0495678_040877	Ga0495678_040877_47_589	162
331	3300049460	Ga0495682_0224484	Ga0495682_0224484_67_609	162
332	3300049568	Ga0501031_0024973	Ga0501031_0024973_494_1036	162
333	3300049569	Ga0501032_0111153	Ga0501032_0111153_743_1285	162
334	3300049570	Ga0501033_0036018	Ga0501033_0036018_645_1187	162
335	3300049571	Ga0501034_0231852	Ga0501034_0231852_653_1195	162
336	3300049572	Ga0501036_0014667	Ga0501036_0014667_4879_5421	162
337	3300049573	Ga0501037_0114306	Ga0501037_0114306_1350_1892	162
338	3300049574	Ga0501038_0073373	Ga0501038_0073373_617_1159	162
339	3300049579	Ga0501043_0029780	Ga0501043_0029780_700_1242	162
340	3300049580	Ga0501046_0125049	Ga0501046_0125049_786_1328	162
341	3300049581	Ga0501047_0018881	Ga0501047_0018881_3127_3669	162
342	3300049581	Ga0501047_0021381	Ga0501047_0021381_2986_3528	162
343	3300049581	Ga0501047_0461358	Ga0501047_0461358_289_831	162
344	3300049586	Ga0501070_0607729	Ga0501070_0607729_43_585	162
345	3300049589	Ga0501073_0596988	Ga0501073_0596988_50_592	162
346	3300049822	Ga0501035_0037784	Ga0501035_0037784_3172_3714	162
347	3300049823	Ga0501044_0017345	Ga0501044_0017345_6067_6609	162
348	3300050516	nmdc:mga0sz30_37054_c1	nmdc:mga0sz30_37054_c1_1360_1902	162
349	3300053140	Ga0500573_0063946	Ga0500573_0063946_275_814	162
350	iso_pu_bacteria	2648501241	2649122630	162
351	iso_pu_bacteria	2651869818	2652974087	162
352	3300003322	rootL2_10271993	rootL2_102719932	163
353	3300005339	Ga0070660_101167482	Ga0070660_1011674821	163
354	3300005546	Ga0070696_100001471	Ga0070696_1000014713	163
355	3300005564	Ga0070664_101068195	Ga0070664_1010681952	163
356	3300005844	Ga0068862_100129045	Ga0068862_1001290453	163
357	3300006175	Ga0070712_100191621	Ga0070712_1001916213	163
358	3300006847	Ga0075431_100666185	Ga0075431_1006661852	163
359	3300006880	Ga0075429_100135033	Ga0075429_1001350332	163
360	3300007265	Ga0099794_10054957	Ga0099794_100549572	163
361	3300007788	Ga0099795_10002413	Ga0099795_100024135	163
362	3300009093	Ga0105240_10145050	Ga0105240_101450503	163
363	3300009093	Ga0105240_10462021	Ga0105240_104620212	163
364	3300009553	Ga0105249_10524503	Ga0105249_105245032	163
365	3300010159	Ga0099796_10002752	Ga0099796_100027522	163
366	3300010159	Ga0099796_10100467	Ga0099796_101004672	163
367	3300013102	Ga0157371_10074342	Ga0157371_100743422	163
368	3300025915	Ga0207693_10703513	Ga0207693_107035132	163
369	3300025939	Ga0207665_10089589	Ga0207665_100895892	163
370	3300026116	Ga0207674_10592026	Ga0207674_105920262	163
371	3300027512	Ga0209179_1001085	Ga0209179_10010853	163
372	3300027671	Ga0209588_1027319	Ga0209588_10273192	163
373	3300028016	Ga0265354_1003169	Ga0265354_10031693	163
374	3300030878	Ga0265770_1000545	Ga0265770_10005452	163
375	3300031090	Ga0265760_10003768	Ga0265760_100037683	163
376	3300031727	Ga0316576_10171426	Ga0316576_101714262	163
377	3300031728	Ga0316578_10270063	Ga0316578_102700632	163
378	3300031730	Ga0307516_10000172	Ga0307516_1000017219	163
379	3300031731	Ga0307405_10490616	Ga0307405_104906162	163
380	3300031824	Ga0307413_10007898	Ga0307413_100078983	163
381	3300031903	Ga0307407_10362592	Ga0307407_103625922	163
382	3300031911	Ga0307412_10166618	Ga0307412_101666182	163
383	3300031995	Ga0307409_100575819	Ga0307409_1005758192	163
384	3300032002	Ga0307416_100335247	Ga0307416_1003352472	163
385	3300032004	Ga0307414_10005876	Ga0307414_100058765	163
386	3300032004	Ga0307414_10022495	Ga0307414_100224953	163
387	3300032004	Ga0307414_10067133	Ga0307414_100671332	163
388	3300032004	Ga0307414_10274828	Ga0307414_102748283	163
389	3300032004	Ga0307414_10304241	Ga0307414_103042412	163
390	3300032004	Ga0307414_10852101	Ga0307414_108521012	163
391	3300032005	Ga0307411_10205687	Ga0307411_102056871	163
392	3300036712	Ga0316584_0064163	Ga0316584_0064163_1796_2332	163
393	3300037068	Ga0373925_0562417	Ga0373925_0562417_126_665	163
394	3300042876	Ga0451577_0084501	Ga0451577_0084501_1123_1677	163
395	3300046692	Ga0495671_0024507	Ga0495671_0024507_1441_1965	163
396	3300048907	Ga0496104_0005245	Ga0496104_0005245_3203_3742	163
397	3300048908	Ga0496105_0005865	Ga0496105_0005865_3435_3974	163
398	3300048910	Ga0496107_0171438	Ga0496107_0171438_803_1342	163
399	3300048918	Ga0496115_0017359	Ga0496115_0017359_475_1014	163
400	3300049569	Ga0501032_0095339	Ga0501032_0095339_573_1136	163
401	3300049570	Ga0501033_0123391	Ga0501033_0123391_11_574	163
402	3300049571	Ga0501034_0106025	Ga0501034_0106025_725_1288	163
403	3300049573	Ga0501037_0070702	Ga0501037_0070702_690_1253	163
404	3300049574	Ga0501038_0080138	Ga0501038_0080138_621_1184	163
405	3300049579	Ga0501043_0697948	Ga0501043_0697948_140_703	163
406	3300049581	Ga0501047_0025248	Ga0501047_0025248_4765_5328	163
407	3300049586	Ga0501070_0155846	Ga0501070_0155846_74_637	163
408	3300049669	Ga0501235_019981	Ga0501235_019981_111_665	163
409	3300049743	Ga0501081_0611993	Ga0501081_0611993_153_692	163
410	3300049823	Ga0501044_0074794	Ga0501044_0074794_1246_1809	163
411	3300005334	Ga0068869_100074629	Ga0068869_1000746293	164
412	3300005340	Ga0070689_101120684	Ga0070689_1011206841	164
413	3300005354	Ga0070675_100120711	Ga0070675_1001207113	164
414	3300005441	Ga0070700_100018060	Ga0070700_1000180602	164
415	3300005459	Ga0068867_100807508	Ga0068867_1008075082	164
416	3300005841	Ga0068863_100148320	Ga0068863_1001483203	164
417	3300005844	Ga0068862_100767518	Ga0068862_1007675182	164
418	3300009177	Ga0105248_10038325	Ga0105248_100383252	164
419	3300014326	Ga0157380_10162969	Ga0157380_101629692	164
420	3300025935	Ga0207709_10401358	Ga0207709_104013582	164
421	3300025936	Ga0207670_10451270	Ga0207670_104512702	164
422	3300025941	Ga0207711_10029317	Ga0207711_100293172	164
423	3300026075	Ga0207708_10000028	Ga0207708_1000002845	164
424	3300026088	Ga0207641_10120857	Ga0207641_101208574	164
425	3300026089	Ga0207648_10227745	Ga0207648_102277452	164
426	3300027876	Ga0209974_10024636	Ga0209974_100246362	164
427	3300031548	Ga0307408_100213480	Ga0307408_1002134802	164
428	3300031727	Ga0316576_10002788	Ga0316576_100027888	164
429	3300031995	Ga0307409_100145394	Ga0307409_1001453942	164
430	3300035398	Ga0316574_0007776	Ga0316574_0007776_4293_4826	164
431	3300035398	Ga0316574_0274318	Ga0316574_0274318_295_828	164
432	3300035398	Ga0316574_0408810	Ga0316574_0408810_79_609	164
433	3300035410	Ga0373924_0001169	Ga0373924_0001169_6177_6704	164
434	3300035410	Ga0373924_0026798	Ga0373924_0026798_871_1395	164
435	3300036712	Ga0316584_0063328	Ga0316584_0063328_1405_1938	164
436	3300042122	Ga0450920_007210	Ga0450920_007210_1330_1869	164
437	3300042132	Ga0450895_005825	Ga0450895_005825_24_563	164
438	3300042156	Ga0439446_0007391	Ga0439446_0007391_1366_1905	164
439	3300044712	Ga0453684_0000437	Ga0453684_0000437_160509_161069	164
440	3300045051	Ga0451576_0000081	Ga0451576_0000081_8832_9392	164
441	3300049576	Ga0501040_0343996	Ga0501040_0343996_112_654	164
442	3300049583	Ga0501067_0018447	Ga0501067_0018447_3093_3632	164
443	3300049587	Ga0501071_0020233	Ga0501071_0020233_749_1288	164
444	3300049589	Ga0501073_0000695	Ga0501073_0000695_5706_6245	164
445	3300049593	Ga0501077_0004764	Ga0501077_0004764_1342_1881	164
446	3300049741	Ga0501079_0063119	Ga0501079_0063119_1128_1667	164
447	3300049742	Ga0501080_0007265	Ga0501080_0007265_930_1469	164
448	3300049744	Ga0501083_0640541	Ga0501083_0640541_60_599	164
449	3300049824	Ga0501045_0129898	Ga0501045_0129898_184_723	164
450	3300060353	Ga0501082_0289088	Ga0501082_0289088_813_1352	164
451	3300014326	Ga0157380_10433674	Ga0157380_104336742	165
452	3300021358	Ga0213873_10133027	Ga0213873_101330272	165
453	3300021384	Ga0213876_10113990	Ga0213876_101139902	165
454	3300039437	Ga0436365_0807829	Ga0436365_0807829_3320_3853	165
455	3300039438	Ga0436360_1060628	Ga0436360_1060628_2624_3163	165
456	3300039450	Ga0436363_1400277	Ga0436363_1400277_159_692	165
457	3300053104	Ga0500556_0000374	Ga0500556_0000374_10514_11044	165
458	3300025901	Ga0207688_10346520	Ga0207688_103465201	166
459	3300005334	Ga0068869_100131673	Ga0068869_1001316732	170
460	3300005338	Ga0068868_100181890	Ga0068868_1001818902	170
461	3300005459	Ga0068867_100375957	Ga0068867_1003759572	170
462	3300005545	Ga0070695_100150005	Ga0070695_1001500053	170
463	3300006871	Ga0075434_100030727	Ga0075434_1000307278	170
464	3300006871	Ga0075434_100056243	Ga0075434_1000562432	170
465	3300009098	Ga0105245_10674967	Ga0105245_106749672	170
466	3300009147	Ga0114129_10255600	Ga0114129_102556005	170
467	3300009553	Ga0105249_10148874	Ga0105249_101488742	170
468	3300010375	Ga0105239_10189062	Ga0105239_101890625	170
469	3300013306	Ga0163162_10078188	Ga0163162_100781881	170
470	3300025981	Ga0207640_10172871	Ga0207640_101728712	170
471	3300026023	Ga0207677_10250386	Ga0207677_102503862	170
472	3300026118	Ga0207675_100003230	Ga0207675_1000032308	170
473	3300031665	Ga0316575_10133328	Ga0316575_101333282	170
474	3300031727	Ga0316576_10006647	Ga0316576_100066477	170
475	3300031733	Ga0316577_10071374	Ga0316577_100713742	170
476	3300035398	Ga0316574_0053674	Ga0316574_0053674_768_1337	170
477	3300036712	Ga0316584_0137646	Ga0316584_0137646_1101_1670	170
478	3300038996	Ga0242420_014637	Ga0242420_014637_342_893	170
479	3300044673	Ga0453683_0037063	Ga0453683_0037063_897_1451	170
480	3300044712	Ga0453684_0071269	Ga0453684_0071269_3633_4187	170
481	3300045051	Ga0451576_0109572	Ga0451576_0109572_209_763	170
482	3300045051	Ga0451576_0718334	Ga0451576_0718334_261_815	170
483	3300050512	nmdc:mga0n895_1020533_c1	nmdc:mga0n895_1020533_c1_178_732	170
484	3300050512	nmdc:mga0n895_56404_c1	nmdc:mga0n895_56404_c1_874_1428	170
485	3300050515	nmdc:mga0a205_7433_c1	nmdc:mga0a205_7433_c1_2929_3483	170
486	3300005468	Ga0070707_100302516	Ga0070707_1003025162	171
487	3300025922	Ga0207646_10178459	Ga0207646_101784593	171
488	3300001432	JGI24034J14986_100688	JGI24034J14986_1006882	173
489	3300002074	JGI24748J21848_1000003	JGI24748J21848_100000312	173
490	3300002239	JGI24034J26672_10000005	JGI24034J26672_10000005387	173
491	3300005340	Ga0070689_101327832	Ga0070689_1013278321	173
492	3300005355	Ga0070671_100019529	Ga0070671_1000195292	173
493	3300005459	Ga0068867_100226634	Ga0068867_1002266341	173
494	3300005543	Ga0070672_100210216	Ga0070672_1002102164	173
495	3300005544	Ga0070686_100486594	Ga0070686_1004865942	173
496	3300005549	Ga0070704_100171112	Ga0070704_1001711122	173
497	3300005617	Ga0068859_100196653	Ga0068859_1001966532	173
498	3300005842	Ga0068858_100001055	Ga0068858_10000105512	173
499	3300005842	Ga0068858_100219575	Ga0068858_1002195752	173
500	3300006852	Ga0075433_10084101	Ga0075433_100841011	173
501	3300006871	Ga0075434_101347474	Ga0075434_1013474741	173
502	3300006931	Ga0097620_100196653	Ga0097620_1001966532	173
503	3300009093	Ga0105240_11956681	Ga0105240_119566811	173
504	3300009098	Ga0105245_10364753	Ga0105245_103647533	173
505	3300009101	Ga0105247_10000022	Ga0105247_1000002212	173
506	3300009101	Ga0105247_10438651	Ga0105247_104386512	173
507	3300009147	Ga0114129_10045173	Ga0114129_100451732	173
508	3300009147	Ga0114129_10115840	Ga0114129_101158402	173
509	3300009148	Ga0105243_10000424	Ga0105243_100004248	173
510	3300009176	Ga0105242_10005536	Ga0105242_100055362	173
511	3300009176	Ga0105242_10019562	Ga0105242_100195625	173
512	3300009177	Ga0105248_10538780	Ga0105248_105387803	173
513	3300009177	Ga0105248_11192610	Ga0105248_111926102	173
514	3300013297	Ga0157378_10000048	Ga0157378_1000004880	173
515	3300013308	Ga0157375_10006149	Ga0157375_1000614910	173
516	3300025223	Ga0207672_1000762	Ga0207672_10007622	173
517	3300025899	Ga0207642_10053072	Ga0207642_100530722	173
518	3300025900	Ga0207710_10000001	Ga0207710_10000001396	173
519	3300025918	Ga0207662_10217240	Ga0207662_102172402	173
520	3300025934	Ga0207686_10001523	Ga0207686_100015235	173
521	3300025935	Ga0207709_10004283	Ga0207709_100042836	173
522	3300025937	Ga0207669_10107910	Ga0207669_101079102	173
523	3300026035	Ga0207703_10000024	Ga0207703_10000024104	173
524	3300026035	Ga0207703_10164506	Ga0207703_101645062	173
525	3300026089	Ga0207648_10280625	Ga0207648_102806252	173
526	3300045051	Ga0451576_0560101	Ga0451576_0560101_287_838	173
527	3300048909	Ga0496106_0032530	Ga0496106_0032530_1556_2113	173
528	3300048910	Ga0496107_0868029	Ga0496107_0868029_17_574	173
529	3300050507	nmdc:mga05p37_396834_c1	nmdc:mga05p37_396834_c1_469_1020	173
530	3300050507	nmdc:mga05p37_40887_c1	nmdc:mga05p37_40887_c1_1262_1813	173
531	3300050515	nmdc:mga0a205_16694_c1	nmdc:mga0a205_16694_c1_6236_6787	173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

58

190

0.94 PF00578

AhpC-TSA

AhpC/TSA family

59

176

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3k8n-assembly1.cif.gz_A	crystal structure of e. coli ccmg	0.9474	24	172
2g0f-assembly1.cif.gz_A	crystal structure of p144a mutant of e.coli ccmg protein	0.9414	22	172
2b1k-assembly1.cif.gz_A	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.9387	22	172
1z5y-assembly1.cif.gz_E	crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg	0.931	36	172
3kh9-assembly1.cif.gz_A	crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa	0.9133	18	173

ID	Description	Score	Start	End	Superfamily
2b1kA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9387	22	172	3.40.30.10
2b1kA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9087	22	172	3.40.30.10
3iosA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.886	34	167	3.40.30.10
1kngA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8716	29	171	3.40.30.10
af_P71990_1_182_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8697	27	150	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7W0X5A7-F1-model_v4	DsbE family thiol:disulfide interchange protein	0.9809	27	172	GO:0015036 GO:0017004 GO:0030288
AF-A0A1H7XPN3-F1-model_v4	Cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE	0.9701	18	172	GO:0015036 GO:0017004 GO:0030288
AF-A0A7W0X5A7-F1-model_v4	DsbE family thiol:disulfide interchange protein	0.9605	27	172	GO:0015036 GO:0017004 GO:0030288
AF-A0A658ADD0-F1-model_v4	deleted	0.9519	22	171
AF-A0A497XKM8-F1-model_v4	Cytochrome c biogenesis protein CcmG/thiol:disulfide interchange protein DsbE	0.9507	10	173	GO:0015036 GO:0017004 GO:0030288

Feature Viewer

pLDDT	pTM	Quality
89.44	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460153

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08534

Redoxin

Redoxin

58

190

0.94

PF00578

AhpC-TSA

AhpC/TSA family

59

176

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map