F459710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 311 | 519 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0268650|Ga0451576_0268650_463_1050 |
| Length | 195 |
| Sequence | MNILQINASIRGAASHSSRLASEVVARLQGAGDTVQLRDLGANPPATIDPAALQALFTPAEQRTPEQAARVAQDDALIAELQAADTLVIGMPMYNFTVPVQFKSWLDAICRAQVTFRYTANGPEGLLTGKRAVIVLARGGNYTPDSDTQVPYLRQVLGFVGITDITFIHAEGLNLGPDAEAAALASARSAIAALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 5 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 6 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 7 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 8 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 173 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 184 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 214 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 215 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 216 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 217 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 218 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 219 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 270 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 306 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 309 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 311 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.8 |
| Metatranscriptomes | 12.5 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.42 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 70.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1019066 | 3300002705 | Bacteria | 1248 |
| 2 | JGI25154J39366_1004745 | 3300002738 | Bacteria | 2339 |
| 3 | JGI25157J39369_1000038 | 3300002741 | Bacteria | 130270 |
| 4 | JGI25152J39213_1016178 | 3300002773 | Bacteria | 1448 |
| 5 | JGI25150J39212_1000655 | 3300002774 | Bacteria | 12871 |
| 6 | JGI25159J45721_1010954 | 3300002987 | Unclassified | 2260 |
| 7 | JGI25153J46596_10007539 | 3300003215 | Bacteria | 5330 |
| 8 | rootH1_10003266 | 3300003316 | Bacteria | 13926 |
| 9 | rootL2_10047996 | 3300003322 | Bacteria | 3629 |
| 10 | rootL2_10072243 | 3300003322 | Bacteria | 2728 |
| 11 | rootL2_10074193 | 3300003322 | Bacteria | 3346 |
| 12 | rootH1_10001251 | 3300003323 | Bacteria | 8205 |
| 13 | rootH1_10025546 | 3300003323 | Bacteria | 7590 |
| 14 | JGI25161J50226_1000182 | 3300003374 | Bacteria | 42010 |
| 15 | Ga0055539_1002371 | 3300003752 | Bacteria | 2924 |
| 16 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 17 | Ga0055525_1000525 | 3300003759 | Bacteria | 18477 |
| 18 | Ga0055526_1000780 | 3300003771 | Bacteria | 23749 |
| 19 | Ga0055526_1003391 | 3300003771 | Bacteria | 10146 |
| 20 | Ga0055537_1003470 | 3300003773 | Bacteria | 4844 |
| 21 | Ga0055524_1000187 | 3300003775 | Bacteria | 68927 |
| 22 | Ga0055524_1018949 | 3300003775 | Bacteria | 2369 |
| 23 | Ga0055524_1023255 | 3300003775 | Unclassified | 2000 |
| 24 | Ga0055534_1002067 | 3300003784 | Bacteria | 7243 |
| 25 | Ga0055528_1003283 | 3300003790 | Bacteria | 8223 |
| 26 | Ga0055530_10000444 | 3300003791 | Bacteria | 36774 |
| 27 | Ga0055530_10001759 | 3300003791 | Bacteria | 15132 |
| 28 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 29 | Ga0055531_10001467 | 3300003794 | Bacteria | 17357 |
| 30 | Ga0055543_1000112 | 3300004625 | Bacteria | 69589 |
| 31 | Ga0065165_1005676 | 3300005262 | Bacteria | 6881 |
| 32 | Ga0065712_10179619 | 3300005290 | Bacteria | 1199 |
| 33 | Ga0065715_10119799 | 3300005293 | Bacteria | 2276 |
| 34 | Ga0070658_10022875 | 3300005327 | Bacteria | 5016 |
| 35 | Ga0070658_10055262 | 3300005327 | Bacteria | 3225 |
| 36 | Ga0070676_10287396 | 3300005328 | Bacteria | 1110 |
| 37 | Ga0070690_100646440 | 3300005330 | Bacteria | 807 |
| 38 | Ga0070670_100316581 | 3300005331 | Bacteria | 1366 |
| 39 | Ga0070670_100762186 | 3300005331 | Bacteria | 872 |
| 40 | Ga0070677_10001601 | 3300005333 | Bacteria | 7161 |
| 41 | Ga0070677_10252453 | 3300005333 | Bacteria | 876 |
| 42 | Ga0068869_100794247 | 3300005334 | Bacteria | 813 |
| 43 | Ga0070682_100040109 | 3300005337 | Bacteria | 2880 |
| 44 | Ga0070682_100645589 | 3300005337 | Bacteria | 842 |
| 45 | Ga0068868_100011500 | 3300005338 | Bacteria | 6446 |
| 46 | Ga0070660_100007544 | 3300005339 | Bacteria | 7579 |
| 47 | Ga0070660_100023161 | 3300005339 | Bacteria | 4599 |
| 48 | Ga0070660_100085866 | 3300005339 | Bacteria | 2475 |
| 49 | Ga0070689_100268722 | 3300005340 | Bacteria | 1411 |
| 50 | Ga0070661_100219477 | 3300005344 | Bacteria | 1458 |
| 51 | Ga0070669_100008226 | 3300005353 | Bacteria | 7450 |
| 52 | Ga0070675_100001473 | 3300005354 | Bacteria | 17347 |
| 53 | Ga0070675_100242132 | 3300005354 | Bacteria | 1576 |
| 54 | Ga0070671_100011093 | 3300005355 | Bacteria | 7236 |
| 55 | Ga0070671_100030101 | 3300005355 | Bacteria | 4480 |
| 56 | Ga0070674_100002004 | 3300005356 | Bacteria | 11146 |
| 57 | Ga0070674_100327471 | 3300005356 | Bacteria | 1230 |
| 58 | Ga0070673_100030008 | 3300005364 | Bacteria | 4063 |
| 59 | Ga0070673_100050971 | 3300005364 | Bacteria | 3239 |
| 60 | Ga0070673_100733199 | 3300005364 | Bacteria | 909 |
| 61 | Ga0070667_100113363 | 3300005367 | Bacteria | 2353 |
| 62 | Ga0070667_100145705 | 3300005367 | Bacteria | 2077 |
| 63 | Ga0070700_100794532 | 3300005441 | Bacteria | 761 |
| 64 | Ga0070708_100000818 | 3300005445 | Bacteria | 23467 |
| 65 | Ga0070678_100005561 | 3300005456 | Bacteria | 7307 |
| 66 | Ga0070678_100152466 | 3300005456 | Bacteria | 1863 |
| 67 | Ga0070678_100616722 | 3300005456 | Bacteria | 970 |
| 68 | Ga0070678_100868289 | 3300005456 | Bacteria | 823 |
| 69 | Ga0070662_100005173 | 3300005457 | Bacteria | 8321 |
| 70 | Ga0070662_100389227 | 3300005457 | Bacteria | 1149 |
| 71 | Ga0068867_100000086 | 3300005459 | Bacteria | 58298 |
| 72 | Ga0068867_100096314 | 3300005459 | Bacteria | 2253 |
| 73 | Ga0068867_100160265 | 3300005459 | Bacteria | 1774 |
| 74 | Ga0068867_100253022 | 3300005459 | Bacteria | 1433 |
| 75 | Ga0070699_100273387 | 3300005518 | Bacteria | 1513 |
| 76 | Ga0070684_100223041 | 3300005535 | Bacteria | 1720 |
| 77 | Ga0068853_100388325 | 3300005539 | Bacteria | 1305 |
| 78 | Ga0068853_100981307 | 3300005539 | Bacteria | 813 |
| 79 | Ga0070672_100000367 | 3300005543 | Bacteria | 25974 |
| 80 | Ga0070672_100007805 | 3300005543 | Bacteria | 7298 |
| 81 | Ga0070686_100289371 | 3300005544 | Bacteria | 1211 |
| 82 | Ga0070665_100068041 | 3300005548 | Bacteria | 3571 |
| 83 | Ga0068855_100001767 | 3300005563 | Bacteria | 26998 |
| 84 | Ga0068855_100038331 | 3300005563 | Bacteria | 5694 |
| 85 | Ga0068855_100289055 | 3300005563 | Bacteria | 1818 |
| 86 | Ga0068855_100653855 | 3300005563 | Bacteria | 1129 |
| 87 | Ga0070664_100029166 | 3300005564 | Bacteria | 4599 |
| 88 | Ga0068857_100004097 | 3300005577 | Bacteria | 12280 |
| 89 | Ga0068857_100156332 | 3300005577 | Bacteria | 2068 |
| 90 | Ga0068854_100009523 | 3300005578 | Bacteria | 6271 |
| 91 | Ga0068856_100002296 | 3300005614 | Bacteria | 19713 |
| 92 | Ga0068856_101183924 | 3300005614 | Bacteria | 781 |
| 93 | Ga0068852_100786968 | 3300005616 | Bacteria | 965 |
| 94 | Ga0068852_100875522 | 3300005616 | Bacteria | 915 |
| 95 | Ga0068859_100918221 | 3300005617 | Bacteria | 960 |
| 96 | Ga0068864_100018312 | 3300005618 | Bacteria | 5849 |
| 97 | Ga0068864_100023287 | 3300005618 | Bacteria | 5199 |
| 98 | Ga0068864_100142004 | 3300005618 | Bacteria | 2167 |
| 99 | Ga0068861_100906416 | 3300005719 | Bacteria | 835 |
| 100 | Ga0068870_10139262 | 3300005840 | Bacteria | 1418 |
| 101 | Ga0068863_100074674 | 3300005841 | Bacteria | 3208 |
| 102 | Ga0068860_100410901 | 3300005843 | Bacteria | 1340 |
| 103 | Ga0068862_100031756 | 3300005844 | Bacteria | 4461 |
| 104 | Ga0068862_100144841 | 3300005844 | Bacteria | 2111 |
| 105 | Ga0075432_10066585 | 3300006058 | Bacteria | 1289 |
| 106 | Ga0075362_10222980 | 3300006177 | Bacteria | 922 |
| 107 | Ga0075366_10001671 | 3300006195 | Bacteria | 11141 |
| 108 | Ga0075366_10002150 | 3300006195 | Bacteria | 10037 |
| 109 | Ga0075366_10014138 | 3300006195 | Bacteria | 4555 |
| 110 | Ga0075366_10028889 | 3300006195 | Bacteria | 3256 |
| 111 | Ga0075366_10101444 | 3300006195 | Bacteria | 1727 |
| 112 | Ga0075366_10102319 | 3300006195 | Bacteria | 1720 |
| 113 | Ga0075366_10205226 | 3300006195 | Unclassified | 1199 |
| 114 | Ga0075366_10214769 | 3300006195 | Bacteria | 1171 |
| 115 | Ga0075366_10226641 | 3300006195 | Bacteria | 1139 |
| 116 | Ga0075366_10307601 | 3300006195 | Bacteria | 970 |
| 117 | Ga0075370_10001645 | 3300006353 | Bacteria | 9866 |
| 118 | Ga0075370_10038071 | 3300006353 | Bacteria | 2706 |
| 119 | Ga0075370_10063586 | 3300006353 | Bacteria | 2104 |
| 120 | Ga0068871_100394113 | 3300006358 | Bacteria | 1232 |
| 121 | Ga0068871_100532837 | 3300006358 | Bacteria | 1062 |
| 122 | Ga0075429_100014531 | 3300006880 | Bacteria | 6822 |
| 123 | Ga0097620_100918226 | 3300006931 | Bacteria | 960 |
| 124 | Ga0075435_100102283 | 3300007076 | Unclassified | 2375 |
| 125 | Ga0105240_10018658 | 3300009093 | Bacteria | 9297 |
| 126 | Ga0105247_10289544 | 3300009101 | Bacteria | 1132 |
| 127 | Ga0105243_10010856 | 3300009148 | Bacteria | 6891 |
| 128 | Ga0105243_10047416 | 3300009148 | Bacteria | 3382 |
| 129 | Ga0105243_10171712 | 3300009148 | Bacteria | 1878 |
| 130 | Ga0105243_10751321 | 3300009148 | Bacteria | 956 |
| 131 | Ga0105241_10009231 | 3300009174 | Bacteria | 7253 |
| 132 | Ga0105242_10055776 | 3300009176 | Bacteria | 3233 |
| 133 | Ga0105248_10000471 | 3300009177 | Bacteria | 45843 |
| 134 | Ga0105248_10001875 | 3300009177 | Bacteria | 23322 |
| 135 | Ga0105248_10146220 | 3300009177 | Bacteria | 2667 |
| 136 | Ga0105237_10429091 | 3300009545 | Bacteria | 1327 |
| 137 | Ga0105238_10047236 | 3300009551 | Bacteria | 4343 |
| 138 | Ga0105239_10021588 | 3300010375 | Bacteria | 7100 |
| 139 | Ga0105239_10507692 | 3300010375 | Bacteria | 1371 |
| 140 | Ga0157373_10004343 | 3300013100 | Bacteria | 10672 |
| 141 | Ga0157370_10348212 | 3300013104 | Bacteria | 1366 |
| 142 | Ga0157369_10029515 | 3300013105 | Bacteria | 6059 |
| 143 | Ga0157374_10064011 | 3300013296 | Bacteria | 3450 |
| 144 | Ga0157378_10568233 | 3300013297 | Bacteria | 1142 |
| 145 | Ga0157378_10690996 | 3300013297 | Bacteria | 1039 |
| 146 | Ga0163162_10283320 | 3300013306 | Bacteria | 1789 |
| 147 | Ga0163162_10388153 | 3300013306 | Bacteria | 1529 |
| 148 | Ga0157372_10224846 | 3300013307 | Bacteria | 2176 |
| 149 | Ga0157375_10410376 | 3300013308 | Bacteria | 1521 |
| 150 | Ga0157375_10849141 | 3300013308 | Bacteria | 1060 |
| 151 | Ga0163163_10028813 | 3300014325 | Bacteria | 5337 |
| 152 | Ga0163163_10660601 | 3300014325 | Bacteria | 1109 |
| 153 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 154 | Ga0157379_10615951 | 3300014968 | Bacteria | 1014 |
| 155 | Ga0157379_10620012 | 3300014968 | Bacteria | 1011 |
| 156 | Ga0157376_10016519 | 3300014969 | Bacteria | 5607 |
| 157 | Ga0157376_10319849 | 3300014969 | Bacteria | 1475 |
| 158 | Ga0163161_10060906 | 3300017792 | Bacteria | 2748 |
| 159 | Ga0163161_10149756 | 3300017792 | Bacteria | 1773 |
| 160 | Ga0163161_10393364 | 3300017792 | Bacteria | 1110 |
| 161 | Ga0206352_10163021 | 3300020078 | Bacteria | 924 |
| 162 | Ga0213872_10011831 | 3300021361 | Bacteria | 4122 |
| 163 | Ga0213872_10087888 | 3300021361 | Bacteria | 1392 |
| 164 | Ga0209436_100484 | 3300025208 | Bacteria | 17563 |
| 165 | Ga0209436_102860 | 3300025208 | Bacteria | 4886 |
| 166 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 167 | Ga0209563_100069 | 3300025230 | Bacteria | 253154 |
| 168 | Ga0207427_101384 | 3300025231 | Bacteria | 8888 |
| 169 | Ga0209258_100870 | 3300025242 | Bacteria | 15963 |
| 170 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 171 | Ga0207425_1000130 | 3300025245 | Bacteria | 70791 |
| 172 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 173 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 174 | Ga0209677_100048 | 3300025253 | Bacteria | 183563 |
| 175 | Ga0209677_100263 | 3300025253 | Bacteria | 35585 |
| 176 | Ga0209677_101400 | 3300025253 | Bacteria | 10475 |
| 177 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 178 | Ga0209759_1001348 | 3300025256 | Bacteria | 14283 |
| 179 | Ga0209759_1003047 | 3300025256 | Bacteria | 6903 |
| 180 | Ga0209759_1013641 | 3300025256 | Bacteria | 2188 |
| 181 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 182 | Ga0209129_1008481 | 3300025258 | Bacteria | 2854 |
| 183 | Ga0209565_1000572 | 3300025263 | Bacteria | 25033 |
| 184 | Ga0209565_1000878 | 3300025263 | Bacteria | 16520 |
| 185 | Ga0209565_1003147 | 3300025263 | Bacteria | 5511 |
| 186 | Ga0209130_1000237 | 3300025284 | Bacteria | 70739 |
| 187 | Ga0209130_1004662 | 3300025284 | Bacteria | 5089 |
| 188 | Ga0209675_1004686 | 3300025291 | Bacteria | 6001 |
| 189 | Ga0209675_1031846 | 3300025291 | Bacteria | 1242 |
| 190 | Ga0209564_1000311 | 3300025295 | Bacteria | 95587 |
| 191 | Ga0209564_1042286 | 3300025295 | Bacteria | 1211 |
| 192 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 193 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 194 | Ga0209050_1000280 | 3300025298 | Bacteria | 108968 |
| 195 | Ga0209050_1000664 | 3300025298 | Bacteria | 52795 |
| 196 | Ga0209050_1001427 | 3300025298 | Bacteria | 25782 |
| 197 | Ga0209256_1000068 | 3300025299 | Bacteria | 246064 |
| 198 | Ga0209256_1000952 | 3300025299 | Bacteria | 35118 |
| 199 | Ga0209256_1038346 | 3300025299 | Bacteria | 1242 |
| 200 | Ga0207426_1003864 | 3300025302 | Bacteria | 7725 |
| 201 | Ga0209051_1006353 | 3300025303 | Bacteria | 6685 |
| 202 | Ga0209051_1015749 | 3300025303 | Bacteria | 3464 |
| 203 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 204 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 205 | Ga0209257_1010241 | 3300025304 | Bacteria | 4797 |
| 206 | Ga0209257_1010307 | 3300025304 | Bacteria | 4756 |
| 207 | Ga0207682_10001930 | 3300025893 | Bacteria | 9419 |
| 208 | Ga0207682_10168334 | 3300025893 | Bacteria | 996 |
| 209 | Ga0207692_10066964 | 3300025898 | Bacteria | 1879 |
| 210 | Ga0207680_10075899 | 3300025903 | Bacteria | 2097 |
| 211 | Ga0207645_10083293 | 3300025907 | Bacteria | 2051 |
| 212 | Ga0207643_10122785 | 3300025908 | Bacteria | 1540 |
| 213 | Ga0207705_10018721 | 3300025909 | Bacteria | 4954 |
| 214 | Ga0207705_10064063 | 3300025909 | Bacteria | 2656 |
| 215 | Ga0207654_10034576 | 3300025911 | Bacteria | 2809 |
| 216 | Ga0207695_10015011 | 3300025913 | Bacteria | 9138 |
| 217 | Ga0207671_10205106 | 3300025914 | Bacteria | 1541 |
| 218 | Ga0207657_10035980 | 3300025919 | Bacteria | 4435 |
| 219 | Ga0207657_10340135 | 3300025919 | Bacteria | 1184 |
| 220 | Ga0207649_10140899 | 3300025920 | Bacteria | 1650 |
| 221 | Ga0207649_10256540 | 3300025920 | Bacteria | 1262 |
| 222 | Ga0207681_10134357 | 3300025923 | Bacteria | 1833 |
| 223 | Ga0207694_10003229 | 3300025924 | Bacteria | 12990 |
| 224 | Ga0207650_10002288 | 3300025925 | Bacteria | 13348 |
| 225 | Ga0207650_10261946 | 3300025925 | Bacteria | 1403 |
| 226 | Ga0207659_10008394 | 3300025926 | Bacteria | 6410 |
| 227 | Ga0207659_10266419 | 3300025926 | Bacteria | 1396 |
| 228 | Ga0207644_10004038 | 3300025931 | Bacteria | 9522 |
| 229 | Ga0207644_10012860 | 3300025931 | Bacteria | 5567 |
| 230 | Ga0207644_10019766 | 3300025931 | Bacteria | 4573 |
| 231 | Ga0207644_10186620 | 3300025931 | Bacteria | 1628 |
| 232 | Ga0207690_10084713 | 3300025932 | Bacteria | 2223 |
| 233 | Ga0207706_10011506 | 3300025933 | Bacteria | 8059 |
| 234 | Ga0207706_10064935 | 3300025933 | Bacteria | 3214 |
| 235 | Ga0207686_10220807 | 3300025934 | Bacteria | 1368 |
| 236 | Ga0207709_10009847 | 3300025935 | Bacteria | 5263 |
| 237 | Ga0207709_10047846 | 3300025935 | Bacteria | 2602 |
| 238 | Ga0207709_10095285 | 3300025935 | Bacteria | 1955 |
| 239 | Ga0207709_10412626 | 3300025935 | Bacteria | 1035 |
| 240 | Ga0207669_10408656 | 3300025937 | Bacteria | 1065 |
| 241 | Ga0207691_10001841 | 3300025940 | Bacteria | 20724 |
| 242 | Ga0207691_10283967 | 3300025940 | Bacteria | 1424 |
| 243 | Ga0207711_10001495 | 3300025941 | Bacteria | 21766 |
| 244 | Ga0207711_10085580 | 3300025941 | Bacteria | 2762 |
| 245 | Ga0207689_10714861 | 3300025942 | Bacteria | 845 |
| 246 | Ga0207679_10087070 | 3300025945 | Bacteria | 2404 |
| 247 | Ga0207667_10003101 | 3300025949 | Bacteria | 20573 |
| 248 | Ga0207667_10013387 | 3300025949 | Bacteria | 9386 |
| 249 | Ga0207667_10061040 | 3300025949 | Bacteria | 3945 |
| 250 | Ga0207651_10004659 | 3300025960 | Bacteria | 6950 |
| 251 | Ga0207651_10007681 | 3300025960 | Bacteria | 5759 |
| 252 | Ga0207658_10026500 | 3300025986 | Bacteria | 4064 |
| 253 | Ga0207658_10046373 | 3300025986 | Bacteria | 3174 |
| 254 | Ga0207677_10010426 | 3300026023 | Bacteria | 5258 |
| 255 | Ga0207677_10205238 | 3300026023 | Bacteria | 1570 |
| 256 | Ga0207639_10039927 | 3300026041 | Bacteria | 3500 |
| 257 | Ga0207639_10226783 | 3300026041 | Bacteria | 1617 |
| 258 | Ga0207639_10230622 | 3300026041 | Bacteria | 1604 |
| 259 | Ga0207702_10005216 | 3300026078 | Bacteria | 11410 |
| 260 | Ga0207702_10586637 | 3300026078 | Bacteria | 1093 |
| 261 | Ga0207641_10303652 | 3300026088 | Bacteria | 1508 |
| 262 | Ga0207641_10436134 | 3300026088 | Bacteria | 1264 |
| 263 | Ga0207641_10947338 | 3300026088 | Bacteria | 856 |
| 264 | Ga0207648_10000053 | 3300026089 | Bacteria | 107516 |
| 265 | Ga0207648_10017318 | 3300026089 | Bacteria | 6562 |
| 266 | Ga0207648_10075975 | 3300026089 | Bacteria | 2928 |
| 267 | Ga0207648_10177150 | 3300026089 | Bacteria | 1886 |
| 268 | Ga0207676_10021173 | 3300026095 | Bacteria | 4769 |
| 269 | Ga0207676_10027340 | 3300026095 | Bacteria | 4248 |
| 270 | Ga0207676_10266404 | 3300026095 | Bacteria | 1549 |
| 271 | Ga0207675_100047872 | 3300026118 | Bacteria | 3991 |
| 272 | Ga0207675_101005551 | 3300026118 | Bacteria | 852 |
| 273 | Ga0207683_10005954 | 3300026121 | Bacteria | 10447 |
| 274 | Ga0207683_10181403 | 3300026121 | Bacteria | 1909 |
| 275 | Ga0207683_10505360 | 3300026121 | Bacteria | 1116 |
| 276 | Ga0207698_10468311 | 3300026142 | Bacteria | 1220 |
| 277 | Ga0207698_11412983 | 3300026142 | Bacteria | 711 |
| 278 | Ga0209998_10048829 | 3300027717 | Bacteria | 976 |
| 279 | Ga0209974_10004417 | 3300027876 | Bacteria | 5003 |
| 280 | Ga0268266_10334911 | 3300028379 | Bacteria | 1419 |
| 281 | Ga0268265_10396457 | 3300028380 | Bacteria | 1274 |
| 282 | Ga0268264_10684018 | 3300028381 | Bacteria | 1018 |
| 283 | Ga0307515_10001629 | 3300028794 | Bacteria | 49963 |
| 284 | Ga0307515_10066207 | 3300028794 | Bacteria | 5010 |
| 285 | Ga0307515_10076602 | 3300028794 | Bacteria | 4433 |
| 286 | Ga0307515_10087646 | 3300028794 | Bacteria | 3946 |
| 287 | Ga0307515_10185483 | 3300028794 | Bacteria | 2011 |
| 288 | Ga0307515_10248555 | 3300028794 | Bacteria | 1535 |
| 289 | Ga0307515_10381387 | 3300028794 | Bacteria | 1042 |
| 290 | Ga0265324_10023001 | 3300029957 | Bacteria | 2223 |
| 291 | Ga0307512_10034290 | 3300030522 | Bacteria | 4344 |
| 292 | Ga0265330_10003812 | 3300031235 | Bacteria | 7771 |
| 293 | Ga0265332_10000841 | 3300031238 | Bacteria | 18651 |
| 294 | Ga0265325_10033294 | 3300031241 | Bacteria | 2748 |
| 295 | Ga0265339_10024672 | 3300031249 | Bacteria | 3461 |
| 296 | Ga0265331_10000936 | 3300031250 | Bacteria | 23357 |
| 297 | Ga0265327_10016553 | 3300031251 | Bacteria | 4674 |
| 298 | Ga0265316_10081530 | 3300031344 | Bacteria | 2480 |
| 299 | Ga0307513_10018405 | 3300031456 | Bacteria | 8345 |
| 300 | Ga0307513_10056239 | 3300031456 | Bacteria | 4202 |
| 301 | Ga0307513_10208749 | 3300031456 | Bacteria | 1786 |
| 302 | Ga0307408_100000016 | 3300031548 | Bacteria | 356896 |
| 303 | Ga0307408_100001185 | 3300031548 | Bacteria | 19736 |
| 304 | Ga0307408_100137393 | 3300031548 | Bacteria | 1914 |
| 305 | Ga0307408_100259889 | 3300031548 | Bacteria | 1436 |
| 306 | Ga0307408_100790460 | 3300031548 | Bacteria | 860 |
| 307 | Ga0307508_10000133 | 3300031616 | Bacteria | 87867 |
| 308 | Ga0307508_10008282 | 3300031616 | Bacteria | 9624 |
| 309 | Ga0307514_10001199 | 3300031649 | Bacteria | 34587 |
| 310 | Ga0310114_106115 | 3300031678 | Bacteria | 1229 |
| 311 | Ga0265314_10022857 | 3300031711 | Bacteria | 4782 |
| 312 | Ga0265314_10088545 | 3300031711 | Bacteria | 2021 |
| 313 | Ga0265342_10011638 | 3300031712 | Bacteria | 6004 |
| 314 | Ga0307516_10001653 | 3300031730 | Bacteria | 30675 |
| 315 | Ga0307516_10004130 | 3300031730 | Bacteria | 18101 |
| 316 | Ga0307516_10529591 | 3300031730 | Bacteria | 832 |
| 317 | Ga0307405_10143158 | 3300031731 | Bacteria | 1670 |
| 318 | Ga0307413_10008938 | 3300031824 | Bacteria | 4763 |
| 319 | Ga0307413_10865361 | 3300031824 | Bacteria | 765 |
| 320 | Ga0307410_10006974 | 3300031852 | Bacteria | 6149 |
| 321 | Ga0307406_10680800 | 3300031901 | Bacteria | 857 |
| 322 | Ga0307412_10021971 | 3300031911 | Bacteria | 3904 |
| 323 | Ga0307412_10069539 | 3300031911 | Bacteria | 2397 |
| 324 | Ga0307412_10205664 | 3300031911 | Bacteria | 1498 |
| 325 | Ga0307412_10881956 | 3300031911 | Bacteria | 783 |
| 326 | Ga0307409_100358191 | 3300031995 | Bacteria | 1379 |
| 327 | Ga0307409_100373413 | 3300031995 | Bacteria | 1353 |
| 328 | Ga0307409_101270618 | 3300031995 | Bacteria | 761 |
| 329 | Ga0307416_100506068 | 3300032002 | Bacteria | 1273 |
| 330 | Ga0307416_100561127 | 3300032002 | Bacteria | 1217 |
| 331 | Ga0307414_10294130 | 3300032004 | Bacteria | 1370 |
| 332 | Ga0307411_10001686 | 3300032005 | Bacteria | 9255 |
| 333 | Ga0307411_10007222 | 3300032005 | Bacteria | 5634 |
| 334 | Ga0307411_10366328 | 3300032005 | Bacteria | 1180 |
| 335 | Ga0307507_10072829 | 3300033179 | Bacteria | 3093 |
| 336 | Ga0373932_0030684 | 3300035112 | Bacteria | 1492 |
| 337 | Ga0373932_0259455 | 3300035112 | Bacteria | 637 |
| 338 | Ga0373956_0389125 | 3300035119 | Bacteria | 665 |
| 339 | Ga0373931_0011014 | 3300035691 | Bacteria | 4360 |
| 340 | Ga0373927_0278669 | 3300035695 | Bacteria | 1100 |
| 341 | Ga0310110_009968 | 3300036535 | Bacteria | 1389 |
| 342 | Ga0373925_0230941 | 3300037068 | Bacteria | 1479 |
| 343 | Ga0395898_0035646 | 3300037466 | Bacteria | 4945 |
| 344 | Ga0395905_0000782 | 3300037471 | Bacteria | 41773 |
| 345 | Ga0395905_0029628 | 3300037471 | Bacteria | 5158 |
| 346 | Ga0395905_0376182 | 3300037471 | Bacteria | 1314 |
| 347 | Ga0395905_0516671 | 3300037471 | Bacteria | 1095 |
| 348 | Ga0395901_0164392 | 3300038443 | Bacteria | 2330 |
| 349 | Ga0436361_0089148 | 3300039447 | Bacteria | 4791 |
| 350 | Ga0436361_0674953 | 3300039447 | Bacteria | 2121 |
| 351 | Ga0451789_0665935 | 3300041443 | Bacteria | 761 |
| 352 | Ga0451795_1163136 | 3300041456 | Bacteria | 2854 |
| 353 | Ga0451837_1651674 | 3300041494 | Bacteria | 1057 |
| 354 | Ga0451853_0688630 | 3300041512 | Bacteria | 1206 |
| 355 | Ga0439449_0023753 | 3300042007 | Bacteria | 2293 |
| 356 | Ga0450917_007568 | 3300042120 | Bacteria | 830 |
| 357 | Ga0450888_007523 | 3300042126 | Bacteria | 1207 |
| 358 | Ga0450890_001567 | 3300042127 | Bacteria | 3288 |
| 359 | Ga0450892_000865 | 3300042130 | Bacteria | 3298 |
| 360 | Ga0450889_000295 | 3300042144 | Bacteria | 5611 |
| 361 | Ga0439459_0016544 | 3300042438 | Bacteria | 1364 |
| 362 | Ga0439464_0086757 | 3300042439 | Bacteria | 940 |
| 363 | Ga0450916_001506 | 3300042530 | Bacteria | 2341 |
| 364 | Ga0451577_0002689 | 3300042876 | Bacteria | 20732 |
| 365 | Ga0451577_0114053 | 3300042876 | Bacteria | 2419 |
| 366 | Ga0466969_0000010 | 3300044656 | Bacteria | 117215 |
| 367 | Ga0466963_0013321 | 3300044694 | Bacteria | 5049 |
| 368 | Ga0453684_0018778 | 3300044712 | Bacteria | 10582 |
| 369 | Ga0453684_0668863 | 3300044712 | Bacteria | 1131 |
| 370 | Ga0451576_0023757 | 3300045051 | Bacteria | 6633 |
| 371 | Ga0451576_0026680 | 3300045051 | Bacteria | 6211 |
| 372 | Ga0451576_0268650 | 3300045051 | Bacteria | 1783 |
| 373 | Ga0466967_0415475 | 3300045976 | Bacteria | 1310 |
| 374 | Ga0495617_000739 | 3300046452 | Bacteria | 16079 |
| 375 | Ga0495651_0272826 | 3300046462 | Bacteria | 1146 |
| 376 | Ga0495650_0003225 | 3300046471 | Bacteria | 12118 |
| 377 | Ga0495580_0074020 | 3300046472 | Bacteria | 2378 |
| 378 | Ga0495639_0008991 | 3300046475 | Bacteria | 4283 |
| 379 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 380 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 381 | Ga0495606_0000015 | 3300046507 | Bacteria | 288808 |
| 382 | Ga0495606_0002047 | 3300046507 | Bacteria | 24702 |
| 383 | Ga0495606_0379548 | 3300046507 | Bacteria | 742 |
| 384 | Ga0495610_0130149 | 3300046512 | Bacteria | 1093 |
| 385 | Ga0495616_0001036 | 3300046513 | Bacteria | 19887 |
| 386 | Ga0495643_0073530 | 3300046522 | Bacteria | 1791 |
| 387 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 388 | Ga0495642_0036103 | 3300046528 | Bacteria | 1997 |
| 389 | Ga0495609_0005783 | 3300046538 | Bacteria | 6424 |
| 390 | Ga0495611_0006678 | 3300046648 | Bacteria | 4908 |
| 391 | Ga0495625_0000836 | 3300046660 | Bacteria | 42292 |
| 392 | Ga0495625_0015143 | 3300046660 | Bacteria | 6120 |
| 393 | Ga0495658_0430497 | 3300046683 | Bacteria | 842 |
| 394 | Ga0495649_0000107 | 3300046694 | Bacteria | 74394 |
| 395 | Ga0495589_0012806 | 3300046794 | Bacteria | 4336 |
| 396 | Ga0495672_0118434 | 3300047320 | Bacteria | 1411 |
| 397 | Ga0495683_0052365 | 3300047323 | Bacteria | 2038 |
| 398 | Ga0495683_0097141 | 3300047323 | Bacteria | 1420 |
| 399 | Ga0495677_0005267 | 3300047445 | Bacteria | 4916 |
| 400 | Ga0495673_0024365 | 3300047469 | Bacteria | 2925 |
| 401 | Ga0495615_0020053 | 3300048090 | Bacteria | 1493 |
| 402 | Ga0496101_0507573 | 3300048904 | Bacteria | 953 |
| 403 | Ga0496102_0004336 | 3300048905 | Bacteria | 11995 |
| 404 | Ga0496102_0043870 | 3300048905 | Bacteria | 4056 |
| 405 | Ga0496104_0041019 | 3300048907 | Bacteria | 4339 |
| 406 | Ga0496104_0266443 | 3300048907 | Bacteria | 1626 |
| 407 | Ga0496104_0364401 | 3300048907 | Bacteria | 1358 |
| 408 | Ga0496104_0599432 | 3300048907 | Bacteria | 1012 |
| 409 | Ga0496105_0086151 | 3300048908 | Bacteria | 2596 |
| 410 | Ga0496105_0446326 | 3300048908 | Bacteria | 1022 |
| 411 | Ga0496106_0433763 | 3300048909 | Bacteria | 1056 |
| 412 | Ga0496108_0132577 | 3300048911 | Bacteria | 2142 |
| 413 | Ga0496109_0049985 | 3300048912 | Bacteria | 3809 |
| 414 | Ga0496109_0219499 | 3300048912 | Bacteria | 1788 |
| 415 | Ga0496109_0888812 | 3300048912 | Bacteria | 829 |
| 416 | Ga0496110_0234851 | 3300048913 | Bacteria | 1668 |
| 417 | Ga0496110_0263396 | 3300048913 | Bacteria | 1569 |
| 418 | Ga0496110_0926171 | 3300048913 | Bacteria | 778 |
| 419 | Ga0496112_0090918 | 3300048915 | Bacteria | 3021 |
| 420 | Ga0496113_0019957 | 3300048916 | Bacteria | 4701 |
| 421 | Ga0496126_0060046 | 3300048929 | Bacteria | 3422 |
| 422 | Ga0501306_019325 | 3300049127 | Bacteria | 939 |
| 423 | Ga0501306_022724 | 3300049127 | Bacteria | 886 |
| 424 | Ga0501306_023974 | 3300049127 | Bacteria | 869 |
| 425 | Ga0501306_036644 | 3300049127 | Bacteria | 748 |
| 426 | Ga0501306_038126 | 3300049127 | Bacteria | 737 |
| 427 | Ga0501306_047748 | 3300049127 | Bacteria | 680 |
| 428 | Ga0501308_008344 | 3300049128 | Bacteria | 1107 |
| 429 | Ga0501308_014112 | 3300049128 | Bacteria | 931 |
| 430 | Ga0501308_017156 | 3300049128 | Bacteria | 874 |
| 431 | Ga0501308_025863 | 3300049128 | Bacteria | 763 |
| 432 | Ga0501308_032844 | 3300049128 | Bacteria | 703 |
| 433 | Ga0501309_019874 | 3300049129 | Bacteria | 937 |
| 434 | Ga0501309_022375 | 3300049129 | Bacteria | 894 |
| 435 | Ga0501309_026787 | 3300049129 | Bacteria | 834 |
| 436 | Ga0501309_042344 | 3300049129 | Bacteria | 699 |
| 437 | Ga0501309_043192 | 3300049129 | Bacteria | 693 |
| 438 | Ga0501310_005408 | 3300049130 | Bacteria | 1310 |
| 439 | Ga0501310_015935 | 3300049130 | Bacteria | 896 |
| 440 | Ga0501310_016771 | 3300049130 | Bacteria | 881 |
| 441 | Ga0501310_032224 | 3300049130 | Bacteria | 701 |
| 442 | Ga0501304_002111 | 3300049160 | Bacteria | 1353 |
| 443 | Ga0501304_009171 | 3300049160 | Bacteria | 845 |
| 444 | Ga0501304_010073 | 3300049160 | Bacteria | 821 |
| 445 | Ga0501305_004967 | 3300049161 | Bacteria | 1589 |
| 446 | Ga0501305_025679 | 3300049161 | Bacteria | 894 |
| 447 | Ga0501305_061837 | 3300049161 | Bacteria | 646 |
| 448 | Ga0501307_014970 | 3300049162 | Bacteria | 953 |
| 449 | Ga0501307_015866 | 3300049162 | Bacteria | 934 |
| 450 | Ga0501307_036511 | 3300049162 | Bacteria | 701 |
| 451 | Ga0501301_001001 | 3300049524 | Bacteria | 1766 |
| 452 | Ga0501311_021877 | 3300049527 | Bacteria | 875 |
| 453 | Ga0501312_022694 | 3300049528 | Bacteria | 941 |
| 454 | Ga0501312_027371 | 3300049528 | Bacteria | 879 |
| 455 | Ga0501312_041842 | 3300049528 | Bacteria | 751 |
| 456 | Ga0501313_004639 | 3300049529 | Bacteria | 1420 |
| 457 | Ga0501313_012288 | 3300049529 | Bacteria | 996 |
| 458 | Ga0501313_022124 | 3300049529 | Bacteria | 791 |
| 459 | Ga0501314_005403 | 3300049530 | Bacteria | 1087 |
| 460 | Ga0501314_006300 | 3300049530 | Bacteria | 1031 |
| 461 | Ga0501314_009495 | 3300049530 | Bacteria | 894 |
| 462 | Ga0501314_010826 | 3300049530 | Bacteria | 854 |
| 463 | Ga0501315_013319 | 3300049531 | Bacteria | 1028 |
| 464 | Ga0501315_013691 | 3300049531 | Bacteria | 1019 |
| 465 | Ga0501315_019056 | 3300049531 | Bacteria | 910 |
| 466 | Ga0501315_020848 | 3300049531 | Bacteria | 883 |
| 467 | Ga0501315_046432 | 3300049531 | Bacteria | 671 |
| 468 | Ga0501316_014237 | 3300049532 | Bacteria | 947 |
| 469 | Ga0501318_016402 | 3300049534 | Bacteria | 895 |
| 470 | Ga0501321_008375 | 3300049537 | Bacteria | 1096 |
| 471 | Ga0501321_015649 | 3300049537 | Bacteria | 895 |
| 472 | Ga0501321_032352 | 3300049537 | Bacteria | 705 |
| 473 | Ga0501321_034690 | 3300049537 | Bacteria | 688 |
| 474 | Ga0501321_044859 | 3300049537 | Bacteria | 632 |
| 475 | Ga0501322_004430 | 3300049538 | Bacteria | 944 |
| 476 | Ga0501322_005818 | 3300049538 | Bacteria | 863 |
| 477 | Ga0501322_006249 | 3300049538 | Bacteria | 844 |
| 478 | Ga0501322_007047 | 3300049538 | Bacteria | 811 |
| 479 | Ga0501322_009782 | 3300049538 | Bacteria | 730 |
| 480 | Ga0501322_011512 | 3300049538 | Bacteria | 693 |
| 481 | Ga0501323_037184 | 3300049539 | Bacteria | 703 |
| 482 | Ga0501324_008437 | 3300049540 | Bacteria | 908 |
| 483 | Ga0501325_021040 | 3300049541 | Bacteria | 688 |
| 484 | Ga0501334_10657 | 3300049550 | Bacteria | 666 |
| 485 | Ga0501340_004446 | 3300049556 | Bacteria | 884 |
| 486 | Ga0501032_0115274 | 3300049569 | Bacteria | 1777 |
| 487 | Ga0501034_0274939 | 3300049571 | Bacteria | 1625 |
| 488 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 489 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 490 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 491 | Ga0501048_0122131 | 3300049582 | Bacteria | 1840 |
| 492 | Ga0501211_011872 | 3300049658 | Bacteria | 859 |
| 493 | Ga0501227_010609 | 3300049665 | Bacteria | 1999 |
| 494 | Ga0501252_008151 | 3300049682 | Bacteria | 1200 |
| 495 | Ga0501255_007710 | 3300049684 | Bacteria | 1148 |
| 496 | Ga0501045_0001048 | 3300049824 | Bacteria | 18195 |
| 497 | nmdc:mga03683_208573_c1 | 3300050489 | Bacteria | 898 |
| 498 | nmdc:mga03n38_96993_c1 | 3300050490 | Bacteria | 1415 |
| 499 | nmdc:mga0k408_1147_c1 | 3300050493 | Bacteria | 14519 |
| 500 | nmdc:mga0k408_137125_c1 | 3300050493 | Bacteria | 1454 |
| 501 | nmdc:mga0k408_14103_c1 | 3300050493 | Bacteria | 4395 |
| 502 | nmdc:mga0k408_298415_c1 | 3300050493 | Bacteria | 962 |
| 503 | nmdc:mga0k408_32895_c1 | 3300050493 | Bacteria | 2963 |
| 504 | nmdc:mga0k408_4840_c1 | 3300050493 | Bacteria | 7141 |
| 505 | nmdc:mga0k408_533_c1 | 3300050493 | Bacteria | 20949 |
| 506 | nmdc:mga07m45_114_c1 | 3300050496 | Bacteria | 32256 |
| 507 | nmdc:mga07m45_14185_c1 | 3300050496 | Bacteria | 4240 |
| 508 | nmdc:mga09592_2396_c1 | 3300050508 | Bacteria | 15137 |
| 509 | nmdc:mga0a205_200296_c1 | 3300050515 | Unclassified | 1887 |
| 510 | Ga0495655_0176144 | 3300053083 | Unclassified | 687 |
| 511 | Ga0500578_0256687 | 3300053086 | Bacteria | 1051 |
| 512 | Ga0500608_092540 | 3300053122 | Bacteria | 1411 |
| 513 | Ga0500559_0030666 | 3300053136 | Bacteria | 2306 |
| 514 | Ga0500590_019010 | 3300053148 | Bacteria | 3560 |
| 515 | Ga0500619_000030 | 3300053154 | Bacteria | 46680 |
| 516 | Ga0500636_0002776 | 3300053177 | Bacteria | 9766 |
| 517 | Ga0500587_002994 | 3300053739 | Bacteria | 2391 |
| 518 | Ga0500661_004209 | 3300055283 | Bacteria | 2692 |
| 519 | Ga0466962_0231622 | 3300061719 | Bacteria | 906 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0430497 | Ga0495658_0430497_60_590 | 169 |
| 2 | 3300035119 | Ga0373956_0389125 | Ga0373956_0389125_112_645 | 174 |
| 3 | 3300005333 | Ga0070677_10252453 | Ga0070677_102524531 | 176 |
| 4 | 3300005456 | Ga0070678_100152466 | Ga0070678_1001524662 | 176 |
| 5 | 3300005459 | Ga0068867_100096314 | Ga0068867_1000963143 | 176 |
| 6 | 3300026089 | Ga0207648_10177150 | Ga0207648_101771502 | 176 |
| 7 | 3300026121 | Ga0207683_10181403 | Ga0207683_101814032 | 176 |
| 8 | 3300044694 | Ga0466963_0013321 | Ga0466963_0013321_4489_5025 | 176 |
| 9 | 3300053154 | Ga0500619_000030 | Ga0500619_000030_42258_42806 | 179 |
| 10 | 3300049538 | Ga0501322_009782 | Ga0501322_009782_23_625 | 181 |
| 11 | 3300049540 | Ga0501324_008437 | Ga0501324_008437_289_885 | 182 |
| 12 | 3300025893 | Ga0207682_10168334 | Ga0207682_101683341 | 185 |
| 13 | 3300010375 | Ga0105239_10507692 | Ga0105239_105076922 | 187 |
| 14 | 3300013100 | Ga0157373_10004343 | Ga0157373_100043438 | 190 |
| 15 | 3300017792 | Ga0163161_10393364 | Ga0163161_103933642 | 190 |
| 16 | 3300032004 | Ga0307414_10294130 | Ga0307414_102941302 | 190 |
| 17 | 3300037068 | Ga0373925_0230941 | Ga0373925_0230941_315_917 | 190 |
| 18 | 3300042876 | Ga0451577_0114053 | Ga0451577_0114053_758_1345 | 190 |
| 19 | 3300045051 | Ga0451576_0268650 | Ga0451576_0268650_463_1050 | 190 |
| 20 | iso_pu_bacteria | 8055225921 | 8055228875 | 191 |
| 21 | 3300003374 | JGI25161J50226_1000182 | JGI25161J50226_100018247 | 192 |
| 22 | 3300003771 | Ga0055526_1000780 | Ga0055526_10007802 | 192 |
| 23 | 3300003775 | Ga0055524_1023255 | Ga0055524_10232552 | 192 |
| 24 | 3300004625 | Ga0055543_1000112 | Ga0055543_100011236 | 192 |
| 25 | 3300005262 | Ga0065165_1005676 | Ga0065165_10056766 | 192 |
| 26 | 3300025208 | Ga0209436_100484 | Ga0209436_1004849 | 192 |
| 27 | 3300025263 | Ga0209565_1000878 | Ga0209565_100087813 | 192 |
| 28 | 3300025284 | Ga0209130_1000237 | Ga0209130_100023747 | 192 |
| 29 | 3300025291 | Ga0209675_1004686 | Ga0209675_10046862 | 192 |
| 30 | 3300025295 | Ga0209564_1000311 | Ga0209564_100031144 | 192 |
| 31 | 3300049531 | Ga0501315_013319 | Ga0501315_013319_297_896 | 192 |
| 32 | iso_pu_bacteria | 2643221544 | 2643743391 | 192 |
| 33 | iso_pu_bacteria | 2643221585 | 2643932569 | 192 |
| 34 | iso_pu_bacteria | 2643221646 | 2644260839 | 192 |
| 35 | iso_pu_bacteria | 2643221656 | 2644313820 | 192 |
| 36 | iso_pu_bacteria | 2738541337 | 2739056312 | 192 |
| 37 | 3300049129 | Ga0501309_043192 | Ga0501309_043192_14_622 | 193 |
| 38 | iso_pu_bacteria | 2585428062 | 2587756789 | 193 |
| 39 | iso_pu_bacteria | 2932410948 | 2932413186 | 193 |
| 40 | iso_pu_bacteria | 2932416698 | 2932417247 | 193 |
| 41 | 3300031911 | Ga0307412_10881956 | Ga0307412_108819561 | 195 |
| 42 | 3300049528 | Ga0501312_027371 | Ga0501312_027371_34_633 | 195 |
| 43 | 3300003316 | rootH1_10003266 | rootH1_100032665 | 196 |
| 44 | 3300003322 | rootL2_10047996 | rootL2_100479961 | 196 |
| 45 | 3300003322 | rootL2_10072243 | rootL2_100722434 | 196 |
| 46 | 3300003794 | Ga0055531_10000001 | Ga0055531_10000001275 | 196 |
| 47 | 3300005328 | Ga0070676_10287396 | Ga0070676_102873962 | 196 |
| 48 | 3300005331 | Ga0070670_100762186 | Ga0070670_1007621861 | 196 |
| 49 | 3300005337 | Ga0070682_100040109 | Ga0070682_1000401092 | 196 |
| 50 | 3300005355 | Ga0070671_100011093 | Ga0070671_1000110934 | 196 |
| 51 | 3300005518 | Ga0070699_100273387 | Ga0070699_1002733872 | 196 |
| 52 | 3300005618 | Ga0068864_100018312 | Ga0068864_1000183126 | 196 |
| 53 | 3300005841 | Ga0068863_100074674 | Ga0068863_1000746742 | 196 |
| 54 | 3300006195 | Ga0075366_10205226 | Ga0075366_102052262 | 196 |
| 55 | 3300006195 | Ga0075366_10226641 | Ga0075366_102266412 | 196 |
| 56 | 3300006353 | Ga0075370_10038071 | Ga0075370_100380711 | 196 |
| 57 | 3300006353 | Ga0075370_10063586 | Ga0075370_100635863 | 196 |
| 58 | 3300009148 | Ga0105243_10047416 | Ga0105243_100474164 | 196 |
| 59 | 3300009177 | Ga0105248_10001875 | Ga0105248_1000187520 | 196 |
| 60 | 3300020078 | Ga0206352_10163021 | Ga0206352_101630212 | 196 |
| 61 | 3300025298 | Ga0209050_1001427 | Ga0209050_100142713 | 196 |
| 62 | 3300025303 | Ga0209051_1015749 | Ga0209051_10157492 | 196 |
| 63 | 3300025304 | Ga0209257_1000033 | Ga0209257_1000033362 | 196 |
| 64 | 3300025304 | Ga0209257_1010307 | Ga0209257_10103076 | 196 |
| 65 | 3300025925 | Ga0207650_10261946 | Ga0207650_102619463 | 196 |
| 66 | 3300025931 | Ga0207644_10012860 | Ga0207644_100128604 | 196 |
| 67 | 3300025935 | Ga0207709_10047846 | Ga0207709_100478462 | 196 |
| 68 | 3300025941 | Ga0207711_10001495 | Ga0207711_1000149519 | 196 |
| 69 | 3300026088 | Ga0207641_10436134 | Ga0207641_104361342 | 196 |
| 70 | 3300026095 | Ga0207676_10266404 | Ga0207676_102664042 | 196 |
| 71 | 3300028794 | Ga0307515_10066207 | Ga0307515_100662075 | 196 |
| 72 | 3300028794 | Ga0307515_10185483 | Ga0307515_101854833 | 196 |
| 73 | 3300031548 | Ga0307408_100000016 | Ga0307408_100000016242 | 196 |
| 74 | 3300031730 | Ga0307516_10529591 | Ga0307516_105295911 | 196 |
| 75 | 3300031995 | Ga0307409_100358191 | Ga0307409_1003581912 | 196 |
| 76 | 3300032005 | Ga0307411_10007222 | Ga0307411_100072223 | 196 |
| 77 | 3300037471 | Ga0395905_0000782 | Ga0395905_0000782_19941_20546 | 196 |
| 78 | 3300041512 | Ga0451853_0688630 | Ga0451853_0688630_213_818 | 196 |
| 79 | 3300042120 | Ga0450917_007568 | Ga0450917_007568_69_674 | 196 |
| 80 | 3300042126 | Ga0450888_007523 | Ga0450888_007523_168_773 | 196 |
| 81 | 3300042127 | Ga0450890_001567 | Ga0450890_001567_2570_3175 | 196 |
| 82 | 3300042130 | Ga0450892_000865 | Ga0450892_000865_2468_3073 | 196 |
| 83 | 3300042144 | Ga0450889_000295 | Ga0450889_000295_4598_5203 | 196 |
| 84 | 3300042438 | Ga0439459_0016544 | Ga0439459_0016544_178_783 | 196 |
| 85 | 3300042530 | Ga0450916_001506 | Ga0450916_001506_1644_2249 | 196 |
| 86 | 3300044712 | Ga0453684_0018778 | Ga0453684_0018778_2993_3598 | 196 |
| 87 | 3300044712 | Ga0453684_0668863 | Ga0453684_0668863_338_943 | 196 |
| 88 | 3300045051 | Ga0451576_0023757 | Ga0451576_0023757_19_624 | 196 |
| 89 | 3300046528 | Ga0495642_0036103 | Ga0495642_0036103_539_1135 | 196 |
| 90 | 3300046538 | Ga0495609_0005783 | Ga0495609_0005783_3061_3657 | 196 |
| 91 | 3300046648 | Ga0495611_0006678 | Ga0495611_0006678_2575_3171 | 196 |
| 92 | 3300047320 | Ga0495672_0118434 | Ga0495672_0118434_780_1376 | 196 |
| 93 | 3300047323 | Ga0495683_0052365 | Ga0495683_0052365_1252_1848 | 196 |
| 94 | 3300047445 | Ga0495677_0005267 | Ga0495677_0005267_3911_4507 | 196 |
| 95 | 3300047469 | Ga0495673_0024365 | Ga0495673_0024365_1166_1762 | 196 |
| 96 | 3300048907 | Ga0496104_0041019 | Ga0496104_0041019_817_1413 | 196 |
| 97 | 3300048912 | Ga0496109_0219499 | Ga0496109_0219499_761_1357 | 196 |
| 98 | 3300048913 | Ga0496110_0234851 | Ga0496110_0234851_13_609 | 196 |
| 99 | 3300048915 | Ga0496112_0090918 | Ga0496112_0090918_2064_2660 | 196 |
| 100 | 3300048916 | Ga0496113_0019957 | Ga0496113_0019957_2383_2979 | 196 |
| 101 | 3300049531 | Ga0501315_020848 | Ga0501315_020848_260_865 | 196 |
| 102 | 3300049538 | Ga0501322_007047 | Ga0501322_007047_193_798 | 196 |
| 103 | 3300049665 | Ga0501227_010609 | Ga0501227_010609_916_1521 | 196 |
| 104 | 3300049682 | Ga0501252_008151 | Ga0501252_008151_572_1168 | 196 |
| 105 | 3300049684 | Ga0501255_007710 | Ga0501255_007710_427_1032 | 196 |
| 106 | 3300050496 | nmdc:mga07m45_14185_c1 | nmdc:mga07m45_14185_c1_3586_4191 | 196 |
| 107 | 3300002773 | JGI25152J39213_1016178 | JGI25152J39213_10161782 | 197 |
| 108 | 3300002774 | JGI25150J39212_1000655 | JGI25150J39212_10006551 | 197 |
| 109 | 3300002987 | JGI25159J45721_1010954 | JGI25159J45721_10109543 | 197 |
| 110 | 3300003215 | JGI25153J46596_10007539 | JGI25153J46596_100075395 | 197 |
| 111 | 3300003771 | Ga0055526_1003391 | Ga0055526_10033912 | 197 |
| 112 | 3300003773 | Ga0055537_1003470 | Ga0055537_10034706 | 197 |
| 113 | 3300003775 | Ga0055524_1000187 | Ga0055524_10001878 | 197 |
| 114 | 3300003775 | Ga0055524_1018949 | Ga0055524_10189493 | 197 |
| 115 | 3300003784 | Ga0055534_1002067 | Ga0055534_10020676 | 197 |
| 116 | 3300003790 | Ga0055528_1003283 | Ga0055528_10032833 | 197 |
| 117 | 3300003791 | Ga0055530_10000444 | Ga0055530_100004443 | 197 |
| 118 | 3300003791 | Ga0055530_10001759 | Ga0055530_1000175911 | 197 |
| 119 | 3300003794 | Ga0055531_10001467 | Ga0055531_100014672 | 197 |
| 120 | 3300005290 | Ga0065712_10179619 | Ga0065712_101796192 | 197 |
| 121 | 3300005293 | Ga0065715_10119799 | Ga0065715_101197993 | 197 |
| 122 | 3300005330 | Ga0070690_100646440 | Ga0070690_1006464401 | 197 |
| 123 | 3300005331 | Ga0070670_100316581 | Ga0070670_1003165811 | 197 |
| 124 | 3300005333 | Ga0070677_10001601 | Ga0070677_100016013 | 197 |
| 125 | 3300005338 | Ga0068868_100011500 | Ga0068868_1000115004 | 197 |
| 126 | 3300005340 | Ga0070689_100268722 | Ga0070689_1002687222 | 197 |
| 127 | 3300005353 | Ga0070669_100008226 | Ga0070669_1000082267 | 197 |
| 128 | 3300005354 | Ga0070675_100001473 | Ga0070675_10000147310 | 197 |
| 129 | 3300005354 | Ga0070675_100242132 | Ga0070675_1002421322 | 197 |
| 130 | 3300005355 | Ga0070671_100030101 | Ga0070671_1000301014 | 197 |
| 131 | 3300005356 | Ga0070674_100002004 | Ga0070674_1000020047 | 197 |
| 132 | 3300005356 | Ga0070674_100327471 | Ga0070674_1003274712 | 197 |
| 133 | 3300005364 | Ga0070673_100030008 | Ga0070673_1000300084 | 197 |
| 134 | 3300005364 | Ga0070673_100733199 | Ga0070673_1007331991 | 197 |
| 135 | 3300005367 | Ga0070667_100113363 | Ga0070667_1001133632 | 197 |
| 136 | 3300005367 | Ga0070667_100145705 | Ga0070667_1001457053 | 197 |
| 137 | 3300005441 | Ga0070700_100794532 | Ga0070700_1007945321 | 197 |
| 138 | 3300005445 | Ga0070708_100000818 | Ga0070708_1000008185 | 197 |
| 139 | 3300005456 | Ga0070678_100005561 | Ga0070678_1000055618 | 197 |
| 140 | 3300005456 | Ga0070678_100616722 | Ga0070678_1006167221 | 197 |
| 141 | 3300005457 | Ga0070662_100389227 | Ga0070662_1003892272 | 197 |
| 142 | 3300005459 | Ga0068867_100000086 | Ga0068867_10000008623 | 197 |
| 143 | 3300005459 | Ga0068867_100160265 | Ga0068867_1001602651 | 197 |
| 144 | 3300005539 | Ga0068853_100981307 | Ga0068853_1009813071 | 197 |
| 145 | 3300005543 | Ga0070672_100000367 | Ga0070672_1000003678 | 197 |
| 146 | 3300005543 | Ga0070672_100007805 | Ga0070672_1000078055 | 197 |
| 147 | 3300005548 | Ga0070665_100068041 | Ga0070665_1000680414 | 197 |
| 148 | 3300005564 | Ga0070664_100029166 | Ga0070664_1000291665 | 197 |
| 149 | 3300005577 | Ga0068857_100156332 | Ga0068857_1001563323 | 197 |
| 150 | 3300005617 | Ga0068859_100918221 | Ga0068859_1009182212 | 197 |
| 151 | 3300005618 | Ga0068864_100023287 | Ga0068864_1000232875 | 197 |
| 152 | 3300005618 | Ga0068864_100142004 | Ga0068864_1001420042 | 197 |
| 153 | 3300005719 | Ga0068861_100906416 | Ga0068861_1009064161 | 197 |
| 154 | 3300005840 | Ga0068870_10139262 | Ga0068870_101392622 | 197 |
| 155 | 3300005843 | Ga0068860_100410901 | Ga0068860_1004109012 | 197 |
| 156 | 3300005844 | Ga0068862_100144841 | Ga0068862_1001448412 | 197 |
| 157 | 3300006058 | Ga0075432_10066585 | Ga0075432_100665852 | 197 |
| 158 | 3300006177 | Ga0075362_10222980 | Ga0075362_102229802 | 197 |
| 159 | 3300006195 | Ga0075366_10001671 | Ga0075366_100016715 | 197 |
| 160 | 3300006195 | Ga0075366_10002150 | Ga0075366_100021508 | 197 |
| 161 | 3300006195 | Ga0075366_10014138 | Ga0075366_100141386 | 197 |
| 162 | 3300006195 | Ga0075366_10101444 | Ga0075366_101014442 | 197 |
| 163 | 3300006195 | Ga0075366_10214769 | Ga0075366_102147692 | 197 |
| 164 | 3300006358 | Ga0068871_100394113 | Ga0068871_1003941132 | 197 |
| 165 | 3300006358 | Ga0068871_100532837 | Ga0068871_1005328371 | 197 |
| 166 | 3300006880 | Ga0075429_100014531 | Ga0075429_1000145316 | 197 |
| 167 | 3300006931 | Ga0097620_100918226 | Ga0097620_1009182261 | 197 |
| 168 | 3300007076 | Ga0075435_100102283 | Ga0075435_1001022832 | 197 |
| 169 | 3300009101 | Ga0105247_10289544 | Ga0105247_102895442 | 197 |
| 170 | 3300009148 | Ga0105243_10010856 | Ga0105243_100108566 | 197 |
| 171 | 3300009177 | Ga0105248_10000471 | Ga0105248_100004716 | 197 |
| 172 | 3300009177 | Ga0105248_10146220 | Ga0105248_101462203 | 197 |
| 173 | 3300013104 | Ga0157370_10348212 | Ga0157370_103482122 | 197 |
| 174 | 3300013296 | Ga0157374_10064011 | Ga0157374_100640112 | 197 |
| 175 | 3300013297 | Ga0157378_10690996 | Ga0157378_106909961 | 197 |
| 176 | 3300013306 | Ga0163162_10283320 | Ga0163162_102833202 | 197 |
| 177 | 3300013306 | Ga0163162_10388153 | Ga0163162_103881532 | 197 |
| 178 | 3300013308 | Ga0157375_10410376 | Ga0157375_104103762 | 197 |
| 179 | 3300014325 | Ga0163163_10028813 | Ga0163163_100288137 | 197 |
| 180 | 3300014325 | Ga0163163_10660601 | Ga0163163_106606011 | 197 |
| 181 | 3300014745 | Ga0157377_10000038 | Ga0157377_1000003897 | 197 |
| 182 | 3300014968 | Ga0157379_10620012 | Ga0157379_106200122 | 197 |
| 183 | 3300014969 | Ga0157376_10016519 | Ga0157376_100165198 | 197 |
| 184 | 3300014969 | Ga0157376_10319849 | Ga0157376_103198492 | 197 |
| 185 | 3300017792 | Ga0163161_10060906 | Ga0163161_100609064 | 197 |
| 186 | 3300017792 | Ga0163161_10149756 | Ga0163161_101497562 | 197 |
| 187 | 3300021361 | Ga0213872_10011831 | Ga0213872_100118314 | 197 |
| 188 | 3300025208 | Ga0209436_102860 | Ga0209436_1028604 | 197 |
| 189 | 3300025245 | Ga0207425_1000001 | Ga0207425_1000001209 | 197 |
| 190 | 3300025245 | Ga0207425_1000130 | Ga0207425_100013018 | 197 |
| 191 | 3300025258 | Ga0209129_1000003 | Ga0209129_1000003209 | 197 |
| 192 | 3300025258 | Ga0209129_1008481 | Ga0209129_10084813 | 197 |
| 193 | 3300025263 | Ga0209565_1000572 | Ga0209565_10005723 | 197 |
| 194 | 3300025263 | Ga0209565_1003147 | Ga0209565_10031472 | 197 |
| 195 | 3300025284 | Ga0209130_1004662 | Ga0209130_10046621 | 197 |
| 196 | 3300025291 | Ga0209675_1031846 | Ga0209675_10318462 | 197 |
| 197 | 3300025295 | Ga0209564_1042286 | Ga0209564_10422862 | 197 |
| 198 | 3300025297 | Ga0209758_1000041 | Ga0209758_1000041157 | 197 |
| 199 | 3300025298 | Ga0209050_1000011 | Ga0209050_1000011219 | 197 |
| 200 | 3300025298 | Ga0209050_1000280 | Ga0209050_10002802 | 197 |
| 201 | 3300025298 | Ga0209050_1000664 | Ga0209050_100066429 | 197 |
| 202 | 3300025299 | Ga0209256_1000068 | Ga0209256_100006885 | 197 |
| 203 | 3300025299 | Ga0209256_1000952 | Ga0209256_100095236 | 197 |
| 204 | 3300025299 | Ga0209256_1038346 | Ga0209256_10383462 | 197 |
| 205 | 3300025302 | Ga0207426_1003864 | Ga0207426_10038644 | 197 |
| 206 | 3300025303 | Ga0209051_1006353 | Ga0209051_10063536 | 197 |
| 207 | 3300025304 | Ga0209257_1000003 | Ga0209257_1000003991 | 197 |
| 208 | 3300025304 | Ga0209257_1010241 | Ga0209257_10102417 | 197 |
| 209 | 3300025893 | Ga0207682_10001930 | Ga0207682_100019308 | 197 |
| 210 | 3300025898 | Ga0207692_10066964 | Ga0207692_100669643 | 197 |
| 211 | 3300025903 | Ga0207680_10075899 | Ga0207680_100758992 | 197 |
| 212 | 3300025907 | Ga0207645_10083293 | Ga0207645_100832932 | 197 |
| 213 | 3300025908 | Ga0207643_10122785 | Ga0207643_101227852 | 197 |
| 214 | 3300025919 | Ga0207657_10340135 | Ga0207657_103401351 | 197 |
| 215 | 3300025923 | Ga0207681_10134357 | Ga0207681_101343572 | 197 |
| 216 | 3300025925 | Ga0207650_10002288 | Ga0207650_100022887 | 197 |
| 217 | 3300025926 | Ga0207659_10008394 | Ga0207659_100083942 | 197 |
| 218 | 3300025926 | Ga0207659_10266419 | Ga0207659_102664192 | 197 |
| 219 | 3300025931 | Ga0207644_10004038 | Ga0207644_1000403810 | 197 |
| 220 | 3300025931 | Ga0207644_10019766 | Ga0207644_100197662 | 197 |
| 221 | 3300025931 | Ga0207644_10186620 | Ga0207644_101866202 | 197 |
| 222 | 3300025933 | Ga0207706_10064935 | Ga0207706_100649355 | 197 |
| 223 | 3300025935 | Ga0207709_10009847 | Ga0207709_100098472 | 197 |
| 224 | 3300025937 | Ga0207669_10408656 | Ga0207669_104086561 | 197 |
| 225 | 3300025940 | Ga0207691_10001841 | Ga0207691_1000184117 | 197 |
| 226 | 3300025940 | Ga0207691_10283967 | Ga0207691_102839672 | 197 |
| 227 | 3300025941 | Ga0207711_10085580 | Ga0207711_100855803 | 197 |
| 228 | 3300025945 | Ga0207679_10087070 | Ga0207679_100870702 | 197 |
| 229 | 3300025960 | Ga0207651_10007681 | Ga0207651_100076813 | 197 |
| 230 | 3300025986 | Ga0207658_10026500 | Ga0207658_100265006 | 197 |
| 231 | 3300025986 | Ga0207658_10046373 | Ga0207658_100463733 | 197 |
| 232 | 3300026023 | Ga0207677_10010426 | Ga0207677_100104264 | 197 |
| 233 | 3300026023 | Ga0207677_10205238 | Ga0207677_102052382 | 197 |
| 234 | 3300026041 | Ga0207639_10226783 | Ga0207639_102267832 | 197 |
| 235 | 3300026088 | Ga0207641_10303652 | Ga0207641_103036522 | 197 |
| 236 | 3300026088 | Ga0207641_10947338 | Ga0207641_109473382 | 197 |
| 237 | 3300026089 | Ga0207648_10000053 | Ga0207648_1000005384 | 197 |
| 238 | 3300026089 | Ga0207648_10017318 | Ga0207648_100173183 | 197 |
| 239 | 3300026095 | Ga0207676_10021173 | Ga0207676_100211733 | 197 |
| 240 | 3300026095 | Ga0207676_10027340 | Ga0207676_100273402 | 197 |
| 241 | 3300026118 | Ga0207675_101005551 | Ga0207675_1010055511 | 197 |
| 242 | 3300026121 | Ga0207683_10005954 | Ga0207683_100059548 | 197 |
| 243 | 3300026121 | Ga0207683_10505360 | Ga0207683_105053602 | 197 |
| 244 | 3300027717 | Ga0209998_10048829 | Ga0209998_100488292 | 197 |
| 245 | 3300027876 | Ga0209974_10004417 | Ga0209974_100044172 | 197 |
| 246 | 3300028379 | Ga0268266_10334911 | Ga0268266_103349112 | 197 |
| 247 | 3300028381 | Ga0268264_10684018 | Ga0268264_106840182 | 197 |
| 248 | 3300028794 | Ga0307515_10001629 | Ga0307515_1000162921 | 197 |
| 249 | 3300028794 | Ga0307515_10076602 | Ga0307515_100766023 | 197 |
| 250 | 3300028794 | Ga0307515_10087646 | Ga0307515_100876462 | 197 |
| 251 | 3300028794 | Ga0307515_10248555 | Ga0307515_102485552 | 197 |
| 252 | 3300029957 | Ga0265324_10023001 | Ga0265324_100230012 | 197 |
| 253 | 3300030522 | Ga0307512_10034290 | Ga0307512_100342904 | 197 |
| 254 | 3300031235 | Ga0265330_10003812 | Ga0265330_100038126 | 197 |
| 255 | 3300031238 | Ga0265332_10000841 | Ga0265332_1000084113 | 197 |
| 256 | 3300031241 | Ga0265325_10033294 | Ga0265325_100332943 | 197 |
| 257 | 3300031249 | Ga0265339_10024672 | Ga0265339_100246725 | 197 |
| 258 | 3300031250 | Ga0265331_10000936 | Ga0265331_1000093625 | 197 |
| 259 | 3300031251 | Ga0265327_10016553 | Ga0265327_100165533 | 197 |
| 260 | 3300031344 | Ga0265316_10081530 | Ga0265316_100815302 | 197 |
| 261 | 3300031456 | Ga0307513_10018405 | Ga0307513_100184055 | 197 |
| 262 | 3300031456 | Ga0307513_10056239 | Ga0307513_100562392 | 197 |
| 263 | 3300031456 | Ga0307513_10208749 | Ga0307513_102087492 | 197 |
| 264 | 3300031548 | Ga0307408_100001185 | Ga0307408_1000011856 | 197 |
| 265 | 3300031548 | Ga0307408_100137393 | Ga0307408_1001373932 | 197 |
| 266 | 3300031548 | Ga0307408_100259889 | Ga0307408_1002598892 | 197 |
| 267 | 3300031548 | Ga0307408_100790460 | Ga0307408_1007904602 | 197 |
| 268 | 3300031616 | Ga0307508_10000133 | Ga0307508_1000013383 | 197 |
| 269 | 3300031616 | Ga0307508_10008282 | Ga0307508_100082829 | 197 |
| 270 | 3300031649 | Ga0307514_10001199 | Ga0307514_100011998 | 197 |
| 271 | 3300031711 | Ga0265314_10022857 | Ga0265314_100228573 | 197 |
| 272 | 3300031711 | Ga0265314_10088545 | Ga0265314_100885452 | 197 |
| 273 | 3300031712 | Ga0265342_10011638 | Ga0265342_100116385 | 197 |
| 274 | 3300031730 | Ga0307516_10001653 | Ga0307516_1000165315 | 197 |
| 275 | 3300031731 | Ga0307405_10143158 | Ga0307405_101431582 | 197 |
| 276 | 3300031824 | Ga0307413_10008938 | Ga0307413_100089382 | 197 |
| 277 | 3300031824 | Ga0307413_10865361 | Ga0307413_108653611 | 197 |
| 278 | 3300031852 | Ga0307410_10006974 | Ga0307410_100069747 | 197 |
| 279 | 3300031901 | Ga0307406_10680800 | Ga0307406_106808002 | 197 |
| 280 | 3300031911 | Ga0307412_10021971 | Ga0307412_100219711 | 197 |
| 281 | 3300031911 | Ga0307412_10069539 | Ga0307412_100695393 | 197 |
| 282 | 3300031911 | Ga0307412_10205664 | Ga0307412_102056641 | 197 |
| 283 | 3300031995 | Ga0307409_100373413 | Ga0307409_1003734131 | 197 |
| 284 | 3300031995 | Ga0307409_101270618 | Ga0307409_1012706181 | 197 |
| 285 | 3300032002 | Ga0307416_100506068 | Ga0307416_1005060682 | 197 |
| 286 | 3300032002 | Ga0307416_100561127 | Ga0307416_1005611271 | 197 |
| 287 | 3300032005 | Ga0307411_10001686 | Ga0307411_100016869 | 197 |
| 288 | 3300032005 | Ga0307411_10366328 | Ga0307411_103663282 | 197 |
| 289 | 3300033179 | Ga0307507_10072829 | Ga0307507_100728292 | 197 |
| 290 | 3300035112 | Ga0373932_0030684 | Ga0373932_0030684_377_988 | 197 |
| 291 | 3300035112 | Ga0373932_0259455 | Ga0373932_0259455_22_621 | 197 |
| 292 | 3300035691 | Ga0373931_0011014 | Ga0373931_0011014_98_709 | 197 |
| 293 | 3300035695 | Ga0373927_0278669 | Ga0373927_0278669_35_637 | 197 |
| 294 | 3300037471 | Ga0395905_0029628 | Ga0395905_0029628_1017_1619 | 197 |
| 295 | 3300037471 | Ga0395905_0376182 | Ga0395905_0376182_446_1048 | 197 |
| 296 | 3300039447 | Ga0436361_0674953 | Ga0436361_0674953_1117_1719 | 197 |
| 297 | 3300041443 | Ga0451789_0665935 | Ga0451789_0665935_28_627 | 197 |
| 298 | 3300041456 | Ga0451795_1163136 | Ga0451795_1163136_168_767 | 197 |
| 299 | 3300041494 | Ga0451837_1651674 | Ga0451837_1651674_142_741 | 197 |
| 300 | 3300042439 | Ga0439464_0086757 | Ga0439464_0086757_37_636 | 197 |
| 301 | 3300042876 | Ga0451577_0002689 | Ga0451577_0002689_9058_9657 | 197 |
| 302 | 3300045051 | Ga0451576_0026680 | Ga0451576_0026680_3438_4076 | 197 |
| 303 | 3300046452 | Ga0495617_000739 | Ga0495617_000739_15221_15820 | 197 |
| 304 | 3300046472 | Ga0495580_0074020 | Ga0495580_0074020_1153_1767 | 197 |
| 305 | 3300046492 | Ga0495585_0000002 | Ga0495585_0000002_306752_307351 | 197 |
| 306 | 3300046507 | Ga0495606_0000015 | Ga0495606_0000015_127496_128095 | 197 |
| 307 | 3300046507 | Ga0495606_0379548 | Ga0495606_0379548_73_675 | 197 |
| 308 | 3300046512 | Ga0495610_0130149 | Ga0495610_0130149_34_633 | 197 |
| 309 | 3300046513 | Ga0495616_0001036 | Ga0495616_0001036_5457_6056 | 197 |
| 310 | 3300046522 | Ga0495643_0073530 | Ga0495643_0073530_133_732 | 197 |
| 311 | 3300046524 | Ga0495648_0000012 | Ga0495648_0000012_221966_222565 | 197 |
| 312 | 3300046660 | Ga0495625_0000836 | Ga0495625_0000836_20019_20618 | 197 |
| 313 | 3300048090 | Ga0495615_0020053 | Ga0495615_0020053_613_1284 | 197 |
| 314 | 3300048904 | Ga0496101_0507573 | Ga0496101_0507573_164_835 | 197 |
| 315 | 3300048905 | Ga0496102_0004336 | Ga0496102_0004336_2638_3252 | 197 |
| 316 | 3300048905 | Ga0496102_0043870 | Ga0496102_0043870_1271_1873 | 197 |
| 317 | 3300048907 | Ga0496104_0364401 | Ga0496104_0364401_352_1023 | 197 |
| 318 | 3300048907 | Ga0496104_0599432 | Ga0496104_0599432_114_716 | 197 |
| 319 | 3300048908 | Ga0496105_0086151 | Ga0496105_0086151_1915_2586 | 197 |
| 320 | 3300048908 | Ga0496105_0446326 | Ga0496105_0446326_287_889 | 197 |
| 321 | 3300048909 | Ga0496106_0433763 | Ga0496106_0433763_331_1002 | 197 |
| 322 | 3300048911 | Ga0496108_0132577 | Ga0496108_0132577_54_725 | 197 |
| 323 | 3300048912 | Ga0496109_0049985 | Ga0496109_0049985_1710_2381 | 197 |
| 324 | 3300048912 | Ga0496109_0888812 | Ga0496109_0888812_182_784 | 197 |
| 325 | 3300048913 | Ga0496110_0263396 | Ga0496110_0263396_635_1237 | 197 |
| 326 | 3300048913 | Ga0496110_0926171 | Ga0496110_0926171_10_618 | 197 |
| 327 | 3300049127 | Ga0501306_019325 | Ga0501306_019325_23_625 | 197 |
| 328 | 3300049127 | Ga0501306_023974 | Ga0501306_023974_20_622 | 197 |
| 329 | 3300049127 | Ga0501306_036644 | Ga0501306_036644_17_619 | 197 |
| 330 | 3300049127 | Ga0501306_038126 | Ga0501306_038126_16_615 | 197 |
| 331 | 3300049127 | Ga0501306_047748 | Ga0501306_047748_20_622 | 197 |
| 332 | 3300049128 | Ga0501308_008344 | Ga0501308_008344_490_1092 | 197 |
| 333 | 3300049128 | Ga0501308_014112 | Ga0501308_014112_315_917 | 197 |
| 334 | 3300049128 | Ga0501308_017156 | Ga0501308_017156_249_851 | 197 |
| 335 | 3300049128 | Ga0501308_032844 | Ga0501308_032844_23_625 | 197 |
| 336 | 3300049129 | Ga0501309_019874 | Ga0501309_019874_313_915 | 197 |
| 337 | 3300049129 | Ga0501309_022375 | Ga0501309_022375_278_880 | 197 |
| 338 | 3300049129 | Ga0501309_026787 | Ga0501309_026787_35_634 | 197 |
| 339 | 3300049129 | Ga0501309_042344 | Ga0501309_042344_24_626 | 197 |
| 340 | 3300049130 | Ga0501310_005408 | Ga0501310_005408_16_618 | 197 |
| 341 | 3300049130 | Ga0501310_015935 | Ga0501310_015935_284_883 | 197 |
| 342 | 3300049130 | Ga0501310_016771 | Ga0501310_016771_23_625 | 197 |
| 343 | 3300049130 | Ga0501310_032224 | Ga0501310_032224_23_625 | 197 |
| 344 | 3300049160 | Ga0501304_002111 | Ga0501304_002111_20_622 | 197 |
| 345 | 3300049160 | Ga0501304_009171 | Ga0501304_009171_223_825 | 197 |
| 346 | 3300049160 | Ga0501304_010073 | Ga0501304_010073_23_625 | 197 |
| 347 | 3300049161 | Ga0501305_025679 | Ga0501305_025679_23_625 | 197 |
| 348 | 3300049161 | Ga0501305_061837 | Ga0501305_061837_20_622 | 197 |
| 349 | 3300049162 | Ga0501307_014970 | Ga0501307_014970_22_624 | 197 |
| 350 | 3300049162 | Ga0501307_015866 | Ga0501307_015866_315_917 | 197 |
| 351 | 3300049162 | Ga0501307_036511 | Ga0501307_036511_23_625 | 197 |
| 352 | 3300049524 | Ga0501301_001001 | Ga0501301_001001_209_811 | 197 |
| 353 | 3300049527 | Ga0501311_021877 | Ga0501311_021877_258_860 | 197 |
| 354 | 3300049528 | Ga0501312_022694 | Ga0501312_022694_23_625 | 197 |
| 355 | 3300049529 | Ga0501313_004639 | Ga0501313_004639_20_622 | 197 |
| 356 | 3300049529 | Ga0501313_022124 | Ga0501313_022124_22_624 | 197 |
| 357 | 3300049530 | Ga0501314_009495 | Ga0501314_009495_15_617 | 197 |
| 358 | 3300049530 | Ga0501314_010826 | Ga0501314_010826_11_613 | 197 |
| 359 | 3300049531 | Ga0501315_019056 | Ga0501315_019056_290_892 | 197 |
| 360 | 3300049531 | Ga0501315_046432 | Ga0501315_046432_47_649 | 197 |
| 361 | 3300049532 | Ga0501316_014237 | Ga0501316_014237_20_622 | 197 |
| 362 | 3300049534 | Ga0501318_016402 | Ga0501318_016402_23_625 | 197 |
| 363 | 3300049537 | Ga0501321_015649 | Ga0501321_015649_23_625 | 197 |
| 364 | 3300049537 | Ga0501321_032352 | Ga0501321_032352_81_683 | 197 |
| 365 | 3300049537 | Ga0501321_034690 | Ga0501321_034690_20_622 | 197 |
| 366 | 3300049537 | Ga0501321_044859 | Ga0501321_044859_18_620 | 197 |
| 367 | 3300049538 | Ga0501322_004430 | Ga0501322_004430_11_613 | 197 |
| 368 | 3300049538 | Ga0501322_005818 | Ga0501322_005818_246_848 | 197 |
| 369 | 3300049538 | Ga0501322_006249 | Ga0501322_006249_230_832 | 197 |
| 370 | 3300049538 | Ga0501322_011512 | Ga0501322_011512_24_626 | 197 |
| 371 | 3300049539 | Ga0501323_037184 | Ga0501323_037184_85_687 | 197 |
| 372 | 3300049541 | Ga0501325_021040 | Ga0501325_021040_13_615 | 197 |
| 373 | 3300049550 | Ga0501334_10657 | Ga0501334_10657_23_622 | 197 |
| 374 | 3300049556 | Ga0501340_004446 | Ga0501340_004446_267_866 | 197 |
| 375 | 3300049569 | Ga0501032_0115274 | Ga0501032_0115274_750_1352 | 197 |
| 376 | 3300049579 | Ga0501043_0000002 | Ga0501043_0000002_111490_112092 | 197 |
| 377 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_111573_112175 | 197 |
| 378 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_134755_135357 | 197 |
| 379 | 3300049582 | Ga0501048_0122131 | Ga0501048_0122131_1149_1751 | 197 |
| 380 | 3300049658 | Ga0501211_011872 | Ga0501211_011872_191_790 | 197 |
| 381 | 3300049824 | Ga0501045_0001048 | Ga0501045_0001048_9580_10182 | 197 |
| 382 | 3300050489 | nmdc:mga03683_208573_c1 | nmdc:mga03683_208573_c1_111_710 | 197 |
| 383 | 3300050490 | nmdc:mga03n38_96993_c1 | nmdc:mga03n38_96993_c1_510_1109 | 197 |
| 384 | 3300050493 | nmdc:mga0k408_1147_c1 | nmdc:mga0k408_1147_c1_11499_12098 | 197 |
| 385 | 3300050493 | nmdc:mga0k408_533_c1 | nmdc:mga0k408_533_c1_8158_8877 | 197 |
| 386 | 3300050508 | nmdc:mga09592_2396_c1 | nmdc:mga09592_2396_c1_9969_10571 | 197 |
| 387 | 3300050515 | nmdc:mga0a205_200296_c1 | nmdc:mga0a205_200296_c1_768_1418 | 197 |
| 388 | 3300053083 | Ga0495655_0176144 | Ga0495655_0176144_45_647 | 197 |
| 389 | 3300053148 | Ga0500590_019010 | Ga0500590_019010_1903_2505 | 197 |
| 390 | 3300053739 | Ga0500587_002994 | Ga0500587_002994_453_1052 | 197 |
| 391 | 3300005456 | Ga0070678_100868289 | Ga0070678_1008682891 | 198 |
| 392 | 3300005459 | Ga0068867_100253022 | Ga0068867_1002530223 | 199 |
| 393 | 3300005844 | Ga0068862_100031756 | Ga0068862_1000317563 | 199 |
| 394 | 3300006195 | Ga0075366_10028889 | Ga0075366_100288891 | 199 |
| 395 | 3300006195 | Ga0075366_10102319 | Ga0075366_101023192 | 199 |
| 396 | 3300006195 | Ga0075366_10307601 | Ga0075366_103076012 | 199 |
| 397 | 3300009148 | Ga0105243_10751321 | Ga0105243_107513211 | 199 |
| 398 | 3300025935 | Ga0207709_10412626 | Ga0207709_104126262 | 199 |
| 399 | 3300026089 | Ga0207648_10075975 | Ga0207648_100759751 | 199 |
| 400 | 3300028380 | Ga0268265_10396457 | Ga0268265_103964571 | 199 |
| 401 | 3300049537 | Ga0501321_008375 | Ga0501321_008375_311_928 | 199 |
| 402 | 3300050493 | nmdc:mga0k408_137125_c1 | nmdc:mga0k408_137125_c1_495_1121 | 199 |
| 403 | 3300050493 | nmdc:mga0k408_298415_c1 | nmdc:mga0k408_298415_c1_150_776 | 199 |
| 404 | 3300050493 | nmdc:mga0k408_32895_c1 | nmdc:mga0k408_32895_c1_1372_1986 | 199 |
| 405 | 3300050493 | nmdc:mga0k408_4840_c1 | nmdc:mga0k408_4840_c1_1089_1730 | 199 |
| 406 | 3300021361 | Ga0213872_10087888 | Ga0213872_100878882 | 201 |
| 407 | 3300037471 | Ga0395905_0516671 | Ga0395905_0516671_284_913 | 201 |
| 408 | 3300039447 | Ga0436361_0089148 | Ga0436361_0089148_429_1052 | 201 |
| 409 | 3300044656 | Ga0466969_0000010 | Ga0466969_0000010_64502_65173 | 201 |
| 410 | 3300061719 | Ga0466962_0231622 | Ga0466962_0231622_30_650 | 201 |
| 411 | 3300005344 | Ga0070661_100219477 | Ga0070661_1002194772 | 202 |
| 412 | 3300005457 | Ga0070662_100005173 | Ga0070662_1000051737 | 202 |
| 413 | 3300025920 | Ga0207649_10140899 | Ga0207649_101408992 | 202 |
| 414 | 3300025933 | Ga0207706_10011506 | Ga0207706_100115068 | 202 |
| 415 | 3300025935 | Ga0207709_10095285 | Ga0207709_100952852 | 202 |
| 416 | 3300046471 | Ga0495650_0003225 | Ga0495650_0003225_4998_5609 | 202 |
| 417 | 3300002705 | JGI25156J39149_1019066 | JGI25156J39149_10190661 | 203 |
| 418 | 3300002738 | JGI25154J39366_1004745 | JGI25154J39366_10047451 | 203 |
| 419 | 3300002741 | JGI25157J39369_1000038 | JGI25157J39369_100003875 | 203 |
| 420 | 3300003322 | rootL2_10074193 | rootL2_100741933 | 203 |
| 421 | 3300003323 | rootH1_10001251 | rootH1_100012515 | 203 |
| 422 | 3300003323 | rootH1_10025546 | rootH1_100255466 | 203 |
| 423 | 3300003752 | Ga0055539_1002371 | Ga0055539_10023712 | 203 |
| 424 | 3300003756 | Ga0055533_1000026 | Ga0055533_1000026142 | 203 |
| 425 | 3300003759 | Ga0055525_1000525 | Ga0055525_10005252 | 203 |
| 426 | 3300005327 | Ga0070658_10022875 | Ga0070658_100228754 | 203 |
| 427 | 3300005327 | Ga0070658_10055262 | Ga0070658_100552623 | 203 |
| 428 | 3300005334 | Ga0068869_100794247 | Ga0068869_1007942471 | 203 |
| 429 | 3300005337 | Ga0070682_100645589 | Ga0070682_1006455891 | 203 |
| 430 | 3300005339 | Ga0070660_100007544 | Ga0070660_1000075443 | 203 |
| 431 | 3300005339 | Ga0070660_100023161 | Ga0070660_1000231612 | 203 |
| 432 | 3300005339 | Ga0070660_100085866 | Ga0070660_1000858662 | 203 |
| 433 | 3300005364 | Ga0070673_100050971 | Ga0070673_1000509713 | 203 |
| 434 | 3300005535 | Ga0070684_100223041 | Ga0070684_1002230412 | 203 |
| 435 | 3300005539 | Ga0068853_100388325 | Ga0068853_1003883252 | 203 |
| 436 | 3300005544 | Ga0070686_100289371 | Ga0070686_1002893712 | 203 |
| 437 | 3300005563 | Ga0068855_100001767 | Ga0068855_10000176728 | 203 |
| 438 | 3300005563 | Ga0068855_100038331 | Ga0068855_1000383313 | 203 |
| 439 | 3300005563 | Ga0068855_100289055 | Ga0068855_1002890553 | 203 |
| 440 | 3300005563 | Ga0068855_100653855 | Ga0068855_1006538552 | 203 |
| 441 | 3300005577 | Ga0068857_100004097 | Ga0068857_10000409711 | 203 |
| 442 | 3300005578 | Ga0068854_100009523 | Ga0068854_1000095233 | 203 |
| 443 | 3300005614 | Ga0068856_100002296 | Ga0068856_10000229610 | 203 |
| 444 | 3300005614 | Ga0068856_101183924 | Ga0068856_1011839241 | 203 |
| 445 | 3300005616 | Ga0068852_100786968 | Ga0068852_1007869681 | 203 |
| 446 | 3300005616 | Ga0068852_100875522 | Ga0068852_1008755222 | 203 |
| 447 | 3300006353 | Ga0075370_10001645 | Ga0075370_100016454 | 203 |
| 448 | 3300009093 | Ga0105240_10018658 | Ga0105240_100186582 | 203 |
| 449 | 3300009148 | Ga0105243_10171712 | Ga0105243_101717122 | 203 |
| 450 | 3300009174 | Ga0105241_10009231 | Ga0105241_100092314 | 203 |
| 451 | 3300009176 | Ga0105242_10055776 | Ga0105242_100557763 | 203 |
| 452 | 3300009545 | Ga0105237_10429091 | Ga0105237_104290912 | 203 |
| 453 | 3300009551 | Ga0105238_10047236 | Ga0105238_100472361 | 203 |
| 454 | 3300010375 | Ga0105239_10021588 | Ga0105239_100215884 | 203 |
| 455 | 3300013105 | Ga0157369_10029515 | Ga0157369_100295152 | 203 |
| 456 | 3300013297 | Ga0157378_10568233 | Ga0157378_105682332 | 203 |
| 457 | 3300013307 | Ga0157372_10224846 | Ga0157372_102248462 | 203 |
| 458 | 3300013308 | Ga0157375_10849141 | Ga0157375_108491411 | 203 |
| 459 | 3300014968 | Ga0157379_10615951 | Ga0157379_106159511 | 203 |
| 460 | 3300025226 | Ga0209674_100024 | Ga0209674_100024159 | 203 |
| 461 | 3300025230 | Ga0209563_100069 | Ga0209563_100069159 | 203 |
| 462 | 3300025231 | Ga0207427_101384 | Ga0207427_1013847 | 203 |
| 463 | 3300025242 | Ga0209258_100870 | Ga0209258_10087013 | 203 |
| 464 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012344 | 203 |
| 465 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004276 | 203 |
| 466 | 3300025253 | Ga0209677_100048 | Ga0209677_10004848 | 203 |
| 467 | 3300025253 | Ga0209677_100263 | Ga0209677_10026320 | 203 |
| 468 | 3300025253 | Ga0209677_101400 | Ga0209677_1014009 | 203 |
| 469 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003452 | 203 |
| 470 | 3300025256 | Ga0209759_1001348 | Ga0209759_100134811 | 203 |
| 471 | 3300025256 | Ga0209759_1003047 | Ga0209759_10030472 | 203 |
| 472 | 3300025256 | Ga0209759_1013641 | Ga0209759_10136411 | 203 |
| 473 | 3300025909 | Ga0207705_10018721 | Ga0207705_100187213 | 203 |
| 474 | 3300025909 | Ga0207705_10064063 | Ga0207705_100640633 | 203 |
| 475 | 3300025911 | Ga0207654_10034576 | Ga0207654_100345763 | 203 |
| 476 | 3300025913 | Ga0207695_10015011 | Ga0207695_100150119 | 203 |
| 477 | 3300025914 | Ga0207671_10205106 | Ga0207671_102051062 | 203 |
| 478 | 3300025919 | Ga0207657_10035980 | Ga0207657_100359802 | 203 |
| 479 | 3300025920 | Ga0207649_10256540 | Ga0207649_102565401 | 203 |
| 480 | 3300025924 | Ga0207694_10003229 | Ga0207694_1000322911 | 203 |
| 481 | 3300025932 | Ga0207690_10084713 | Ga0207690_100847131 | 203 |
| 482 | 3300025934 | Ga0207686_10220807 | Ga0207686_102208072 | 203 |
| 483 | 3300025942 | Ga0207689_10714861 | Ga0207689_107148611 | 203 |
| 484 | 3300025949 | Ga0207667_10003101 | Ga0207667_1000310123 | 203 |
| 485 | 3300025949 | Ga0207667_10013387 | Ga0207667_100133875 | 203 |
| 486 | 3300025949 | Ga0207667_10061040 | Ga0207667_100610402 | 203 |
| 487 | 3300025960 | Ga0207651_10004659 | Ga0207651_100046593 | 203 |
| 488 | 3300026041 | Ga0207639_10039927 | Ga0207639_100399272 | 203 |
| 489 | 3300026041 | Ga0207639_10230622 | Ga0207639_102306222 | 203 |
| 490 | 3300026078 | Ga0207702_10005216 | Ga0207702_100052164 | 203 |
| 491 | 3300026078 | Ga0207702_10586637 | Ga0207702_105866372 | 203 |
| 492 | 3300026118 | Ga0207675_100047872 | Ga0207675_1000478724 | 203 |
| 493 | 3300026142 | Ga0207698_10468311 | Ga0207698_104683112 | 203 |
| 494 | 3300026142 | Ga0207698_11412983 | Ga0207698_114129831 | 203 |
| 495 | 3300028794 | Ga0307515_10381387 | Ga0307515_103813872 | 203 |
| 496 | 3300031678 | Ga0310114_106115 | Ga0310114_1061151 | 203 |
| 497 | 3300031730 | Ga0307516_10004130 | Ga0307516_100041306 | 203 |
| 498 | 3300036535 | Ga0310110_009968 | Ga0310110_009968_51_680 | 203 |
| 499 | 3300037466 | Ga0395898_0035646 | Ga0395898_0035646_757_1386 | 203 |
| 500 | 3300038443 | Ga0395901_0164392 | Ga0395901_0164392_53_682 | 203 |
| 501 | 3300042007 | Ga0439449_0023753 | Ga0439449_0023753_417_1049 | 203 |
| 502 | 3300045976 | Ga0466967_0415475 | Ga0466967_0415475_384_1013 | 203 |
| 503 | 3300046462 | Ga0495651_0272826 | Ga0495651_0272826_379_1008 | 203 |
| 504 | 3300046475 | Ga0495639_0008991 | Ga0495639_0008991_753_1382 | 203 |
| 505 | 3300046506 | Ga0495583_0000022 | Ga0495583_0000022_45863_46492 | 203 |
| 506 | 3300046507 | Ga0495606_0002047 | Ga0495606_0002047_11132_11761 | 203 |
| 507 | 3300046660 | Ga0495625_0015143 | Ga0495625_0015143_4782_5411 | 203 |
| 508 | 3300046694 | Ga0495649_0000107 | Ga0495649_0000107_1613_2242 | 203 |
| 509 | 3300046794 | Ga0495589_0012806 | Ga0495589_0012806_1923_2552 | 203 |
| 510 | 3300047323 | Ga0495683_0097141 | Ga0495683_0097141_245_874 | 203 |
| 511 | 3300048907 | Ga0496104_0266443 | Ga0496104_0266443_386_997 | 203 |
| 512 | 3300048929 | Ga0496126_0060046 | Ga0496126_0060046_2260_2886 | 203 |
| 513 | 3300049127 | Ga0501306_022724 | Ga0501306_022724_15_647 | 203 |
| 514 | 3300049128 | Ga0501308_025863 | Ga0501308_025863_31_666 | 203 |
| 515 | 3300049161 | Ga0501305_004967 | Ga0501305_004967_31_666 | 203 |
| 516 | 3300049528 | Ga0501312_041842 | Ga0501312_041842_88_723 | 203 |
| 517 | 3300049529 | Ga0501313_012288 | Ga0501313_012288_31_666 | 203 |
| 518 | 3300049530 | Ga0501314_005403 | Ga0501314_005403_428_1063 | 203 |
| 519 | 3300049530 | Ga0501314_006300 | Ga0501314_006300_374_1009 | 203 |
| 520 | 3300049531 | Ga0501315_013691 | Ga0501315_013691_356_991 | 203 |
| 521 | 3300049571 | Ga0501034_0274939 | Ga0501034_0274939_285_935 | 203 |
| 522 | 3300050493 | nmdc:mga0k408_14103_c1 | nmdc:mga0k408_14103_c1_629_1258 | 203 |
| 523 | 3300050496 | nmdc:mga07m45_114_c1 | nmdc:mga07m45_114_c1_9951_10580 | 203 |
| 524 | 3300053086 | Ga0500578_0256687 | Ga0500578_0256687_384_1013 | 203 |
| 525 | 3300053122 | Ga0500608_092540 | Ga0500608_092540_601_1230 | 203 |
| 526 | 3300053136 | Ga0500559_0030666 | Ga0500559_0030666_648_1277 | 203 |
| 527 | 3300053177 | Ga0500636_0002776 | Ga0500636_0002776_5057_5686 | 203 |
| 528 | 3300055283 | Ga0500661_004209 | Ga0500661_004209_1805_2434 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9537 | 1 | 200 |
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.9533 | 1 | 200 |
| 7n2x-assembly1.cif.gz_A | the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli | 0.9496 | 2 | 200 |
| 1tik-assembly1.cif.gz_A | crystal structure of acyl carrier protein phosphodiesterase | 0.9494 | 2 | 200 |
| 1t5b-assembly1.cif.gz_B | structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase | 0.9483 | 2 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9472 | 2 | 200 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9186 | 1 | 199 | 3.40.50.360 |
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9064 | 2 | 200 | 3.40.50.360 |
| 6dxpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8959 | 2 | 199 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8924 | 1 | 199 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ZS40-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9888 | 1 | 203 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-U3TZ50-F1-model_v4 | NAD(P)H dehydrogenase | 0.9887 | 79 | 202 |
|
| AF-A0A149PSZ8-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9861 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-Q2SUH7-F1-model_v4 | FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9858 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-A0A132C5Q7-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9856 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar