F459710

General Info

Members Datasets Scaffolds Average Seq Length
528 311 519 202

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0268650|Ga0451576_0268650_463_1050
Length 195
Sequence MNILQINASIRGAASHSSRLASEVVARLQGAGDTVQLRDLGANPPATIDPAALQALFTPAEQRTPEQAARVAQDDALIAELQAADTLVIGMPMYNFTVPVQFKSWLDAICRAQVTFRYTANGPEGLLTGKRAVIVLARGGNYTPDSDTQVPYLRQVLGFVGITDITFIHAEGLNLGPDAEAAALASARSAIAALA

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221656 Pelomonas sp. Root405 Isolate Unclassified
6 2738541337 Pelomonas sp. BT06 Isolate Unclassified
7 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
8 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
214 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
215 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
216 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
217 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
218 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
270 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
291 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
292 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
293 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.8
Metatranscriptomes 12.5
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.42
Nodule 0
Rhizoplane 3.98
Rhizosphere 70.45
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1019066 3300002705 Bacteria 1248
2 JGI25154J39366_1004745 3300002738 Bacteria 2339
3 JGI25157J39369_1000038 3300002741 Bacteria 130270
4 JGI25152J39213_1016178 3300002773 Bacteria 1448
5 JGI25150J39212_1000655 3300002774 Bacteria 12871
6 JGI25159J45721_1010954 3300002987 Unclassified 2260
7 JGI25153J46596_10007539 3300003215 Bacteria 5330
8 rootH1_10003266 3300003316 Bacteria 13926
9 rootL2_10047996 3300003322 Bacteria 3629
10 rootL2_10072243 3300003322 Bacteria 2728
11 rootL2_10074193 3300003322 Bacteria 3346
12 rootH1_10001251 3300003323 Bacteria 8205
13 rootH1_10025546 3300003323 Bacteria 7590
14 JGI25161J50226_1000182 3300003374 Bacteria 42010
15 Ga0055539_1002371 3300003752 Bacteria 2924
16 Ga0055533_1000026 3300003756 Bacteria 323407
17 Ga0055525_1000525 3300003759 Bacteria 18477
18 Ga0055526_1000780 3300003771 Bacteria 23749
19 Ga0055526_1003391 3300003771 Bacteria 10146
20 Ga0055537_1003470 3300003773 Bacteria 4844
21 Ga0055524_1000187 3300003775 Bacteria 68927
22 Ga0055524_1018949 3300003775 Bacteria 2369
23 Ga0055524_1023255 3300003775 Unclassified 2000
24 Ga0055534_1002067 3300003784 Bacteria 7243
25 Ga0055528_1003283 3300003790 Bacteria 8223
26 Ga0055530_10000444 3300003791 Bacteria 36774
27 Ga0055530_10001759 3300003791 Bacteria 15132
28 Ga0055531_10000001 3300003794 Bacteria 543586
29 Ga0055531_10001467 3300003794 Bacteria 17357
30 Ga0055543_1000112 3300004625 Bacteria 69589
31 Ga0065165_1005676 3300005262 Bacteria 6881
32 Ga0065712_10179619 3300005290 Bacteria 1199
33 Ga0065715_10119799 3300005293 Bacteria 2276
34 Ga0070658_10022875 3300005327 Bacteria 5016
35 Ga0070658_10055262 3300005327 Bacteria 3225
36 Ga0070676_10287396 3300005328 Bacteria 1110
37 Ga0070690_100646440 3300005330 Bacteria 807
38 Ga0070670_100316581 3300005331 Bacteria 1366
39 Ga0070670_100762186 3300005331 Bacteria 872
40 Ga0070677_10001601 3300005333 Bacteria 7161
41 Ga0070677_10252453 3300005333 Bacteria 876
42 Ga0068869_100794247 3300005334 Bacteria 813
43 Ga0070682_100040109 3300005337 Bacteria 2880
44 Ga0070682_100645589 3300005337 Bacteria 842
45 Ga0068868_100011500 3300005338 Bacteria 6446
46 Ga0070660_100007544 3300005339 Bacteria 7579
47 Ga0070660_100023161 3300005339 Bacteria 4599
48 Ga0070660_100085866 3300005339 Bacteria 2475
49 Ga0070689_100268722 3300005340 Bacteria 1411
50 Ga0070661_100219477 3300005344 Bacteria 1458
51 Ga0070669_100008226 3300005353 Bacteria 7450
52 Ga0070675_100001473 3300005354 Bacteria 17347
53 Ga0070675_100242132 3300005354 Bacteria 1576
54 Ga0070671_100011093 3300005355 Bacteria 7236
55 Ga0070671_100030101 3300005355 Bacteria 4480
56 Ga0070674_100002004 3300005356 Bacteria 11146
57 Ga0070674_100327471 3300005356 Bacteria 1230
58 Ga0070673_100030008 3300005364 Bacteria 4063
59 Ga0070673_100050971 3300005364 Bacteria 3239
60 Ga0070673_100733199 3300005364 Bacteria 909
61 Ga0070667_100113363 3300005367 Bacteria 2353
62 Ga0070667_100145705 3300005367 Bacteria 2077
63 Ga0070700_100794532 3300005441 Bacteria 761
64 Ga0070708_100000818 3300005445 Bacteria 23467
65 Ga0070678_100005561 3300005456 Bacteria 7307
66 Ga0070678_100152466 3300005456 Bacteria 1863
67 Ga0070678_100616722 3300005456 Bacteria 970
68 Ga0070678_100868289 3300005456 Bacteria 823
69 Ga0070662_100005173 3300005457 Bacteria 8321
70 Ga0070662_100389227 3300005457 Bacteria 1149
71 Ga0068867_100000086 3300005459 Bacteria 58298
72 Ga0068867_100096314 3300005459 Bacteria 2253
73 Ga0068867_100160265 3300005459 Bacteria 1774
74 Ga0068867_100253022 3300005459 Bacteria 1433
75 Ga0070699_100273387 3300005518 Bacteria 1513
76 Ga0070684_100223041 3300005535 Bacteria 1720
77 Ga0068853_100388325 3300005539 Bacteria 1305
78 Ga0068853_100981307 3300005539 Bacteria 813
79 Ga0070672_100000367 3300005543 Bacteria 25974
80 Ga0070672_100007805 3300005543 Bacteria 7298
81 Ga0070686_100289371 3300005544 Bacteria 1211
82 Ga0070665_100068041 3300005548 Bacteria 3571
83 Ga0068855_100001767 3300005563 Bacteria 26998
84 Ga0068855_100038331 3300005563 Bacteria 5694
85 Ga0068855_100289055 3300005563 Bacteria 1818
86 Ga0068855_100653855 3300005563 Bacteria 1129
87 Ga0070664_100029166 3300005564 Bacteria 4599
88 Ga0068857_100004097 3300005577 Bacteria 12280
89 Ga0068857_100156332 3300005577 Bacteria 2068
90 Ga0068854_100009523 3300005578 Bacteria 6271
91 Ga0068856_100002296 3300005614 Bacteria 19713
92 Ga0068856_101183924 3300005614 Bacteria 781
93 Ga0068852_100786968 3300005616 Bacteria 965
94 Ga0068852_100875522 3300005616 Bacteria 915
95 Ga0068859_100918221 3300005617 Bacteria 960
96 Ga0068864_100018312 3300005618 Bacteria 5849
97 Ga0068864_100023287 3300005618 Bacteria 5199
98 Ga0068864_100142004 3300005618 Bacteria 2167
99 Ga0068861_100906416 3300005719 Bacteria 835
100 Ga0068870_10139262 3300005840 Bacteria 1418
101 Ga0068863_100074674 3300005841 Bacteria 3208
102 Ga0068860_100410901 3300005843 Bacteria 1340
103 Ga0068862_100031756 3300005844 Bacteria 4461
104 Ga0068862_100144841 3300005844 Bacteria 2111
105 Ga0075432_10066585 3300006058 Bacteria 1289
106 Ga0075362_10222980 3300006177 Bacteria 922
107 Ga0075366_10001671 3300006195 Bacteria 11141
108 Ga0075366_10002150 3300006195 Bacteria 10037
109 Ga0075366_10014138 3300006195 Bacteria 4555
110 Ga0075366_10028889 3300006195 Bacteria 3256
111 Ga0075366_10101444 3300006195 Bacteria 1727
112 Ga0075366_10102319 3300006195 Bacteria 1720
113 Ga0075366_10205226 3300006195 Unclassified 1199
114 Ga0075366_10214769 3300006195 Bacteria 1171
115 Ga0075366_10226641 3300006195 Bacteria 1139
116 Ga0075366_10307601 3300006195 Bacteria 970
117 Ga0075370_10001645 3300006353 Bacteria 9866
118 Ga0075370_10038071 3300006353 Bacteria 2706
119 Ga0075370_10063586 3300006353 Bacteria 2104
120 Ga0068871_100394113 3300006358 Bacteria 1232
121 Ga0068871_100532837 3300006358 Bacteria 1062
122 Ga0075429_100014531 3300006880 Bacteria 6822
123 Ga0097620_100918226 3300006931 Bacteria 960
124 Ga0075435_100102283 3300007076 Unclassified 2375
125 Ga0105240_10018658 3300009093 Bacteria 9297
126 Ga0105247_10289544 3300009101 Bacteria 1132
127 Ga0105243_10010856 3300009148 Bacteria 6891
128 Ga0105243_10047416 3300009148 Bacteria 3382
129 Ga0105243_10171712 3300009148 Bacteria 1878
130 Ga0105243_10751321 3300009148 Bacteria 956
131 Ga0105241_10009231 3300009174 Bacteria 7253
132 Ga0105242_10055776 3300009176 Bacteria 3233
133 Ga0105248_10000471 3300009177 Bacteria 45843
134 Ga0105248_10001875 3300009177 Bacteria 23322
135 Ga0105248_10146220 3300009177 Bacteria 2667
136 Ga0105237_10429091 3300009545 Bacteria 1327
137 Ga0105238_10047236 3300009551 Bacteria 4343
138 Ga0105239_10021588 3300010375 Bacteria 7100
139 Ga0105239_10507692 3300010375 Bacteria 1371
140 Ga0157373_10004343 3300013100 Bacteria 10672
141 Ga0157370_10348212 3300013104 Bacteria 1366
142 Ga0157369_10029515 3300013105 Bacteria 6059
143 Ga0157374_10064011 3300013296 Bacteria 3450
144 Ga0157378_10568233 3300013297 Bacteria 1142
145 Ga0157378_10690996 3300013297 Bacteria 1039
146 Ga0163162_10283320 3300013306 Bacteria 1789
147 Ga0163162_10388153 3300013306 Bacteria 1529
148 Ga0157372_10224846 3300013307 Bacteria 2176
149 Ga0157375_10410376 3300013308 Bacteria 1521
150 Ga0157375_10849141 3300013308 Bacteria 1060
151 Ga0163163_10028813 3300014325 Bacteria 5337
152 Ga0163163_10660601 3300014325 Bacteria 1109
153 Ga0157377_10000038 3300014745 Bacteria 113777
154 Ga0157379_10615951 3300014968 Bacteria 1014
155 Ga0157379_10620012 3300014968 Bacteria 1011
156 Ga0157376_10016519 3300014969 Bacteria 5607
157 Ga0157376_10319849 3300014969 Bacteria 1475
158 Ga0163161_10060906 3300017792 Bacteria 2748
159 Ga0163161_10149756 3300017792 Bacteria 1773
160 Ga0163161_10393364 3300017792 Bacteria 1110
161 Ga0206352_10163021 3300020078 Bacteria 924
162 Ga0213872_10011831 3300021361 Bacteria 4122
163 Ga0213872_10087888 3300021361 Bacteria 1392
164 Ga0209436_100484 3300025208 Bacteria 17563
165 Ga0209436_102860 3300025208 Bacteria 4886
166 Ga0209674_100024 3300025226 Bacteria 535481
167 Ga0209563_100069 3300025230 Bacteria 253154
168 Ga0207427_101384 3300025231 Bacteria 8888
169 Ga0209258_100870 3300025242 Bacteria 15963
170 Ga0207425_1000001 3300025245 Bacteria 2525432
171 Ga0207425_1000130 3300025245 Bacteria 70791
172 Ga0209646_1000012 3300025246 Bacteria 573300
173 Ga0209026_1000004 3300025250 Bacteria 949012
174 Ga0209677_100048 3300025253 Bacteria 183563
175 Ga0209677_100263 3300025253 Bacteria 35585
176 Ga0209677_101400 3300025253 Bacteria 10475
177 Ga0209759_1000003 3300025256 Bacteria 792130
178 Ga0209759_1001348 3300025256 Bacteria 14283
179 Ga0209759_1003047 3300025256 Bacteria 6903
180 Ga0209759_1013641 3300025256 Bacteria 2188
181 Ga0209129_1000003 3300025258 Bacteria 903689
182 Ga0209129_1008481 3300025258 Bacteria 2854
183 Ga0209565_1000572 3300025263 Bacteria 25033
184 Ga0209565_1000878 3300025263 Bacteria 16520
185 Ga0209565_1003147 3300025263 Bacteria 5511
186 Ga0209130_1000237 3300025284 Bacteria 70739
187 Ga0209130_1004662 3300025284 Bacteria 5089
188 Ga0209675_1004686 3300025291 Bacteria 6001
189 Ga0209675_1031846 3300025291 Bacteria 1242
190 Ga0209564_1000311 3300025295 Bacteria 95587
191 Ga0209564_1042286 3300025295 Bacteria 1211
192 Ga0209758_1000041 3300025297 Bacteria 410328
193 Ga0209050_1000011 3300025298 Bacteria 914037
194 Ga0209050_1000280 3300025298 Bacteria 108968
195 Ga0209050_1000664 3300025298 Bacteria 52795
196 Ga0209050_1001427 3300025298 Bacteria 25782
197 Ga0209256_1000068 3300025299 Bacteria 246064
198 Ga0209256_1000952 3300025299 Bacteria 35118
199 Ga0209256_1038346 3300025299 Bacteria 1242
200 Ga0207426_1003864 3300025302 Bacteria 7725
201 Ga0209051_1006353 3300025303 Bacteria 6685
202 Ga0209051_1015749 3300025303 Bacteria 3464
203 Ga0209257_1000003 3300025304 Bacteria 1702593
204 Ga0209257_1000033 3300025304 Bacteria 671006
205 Ga0209257_1010241 3300025304 Bacteria 4797
206 Ga0209257_1010307 3300025304 Bacteria 4756
207 Ga0207682_10001930 3300025893 Bacteria 9419
208 Ga0207682_10168334 3300025893 Bacteria 996
209 Ga0207692_10066964 3300025898 Bacteria 1879
210 Ga0207680_10075899 3300025903 Bacteria 2097
211 Ga0207645_10083293 3300025907 Bacteria 2051
212 Ga0207643_10122785 3300025908 Bacteria 1540
213 Ga0207705_10018721 3300025909 Bacteria 4954
214 Ga0207705_10064063 3300025909 Bacteria 2656
215 Ga0207654_10034576 3300025911 Bacteria 2809
216 Ga0207695_10015011 3300025913 Bacteria 9138
217 Ga0207671_10205106 3300025914 Bacteria 1541
218 Ga0207657_10035980 3300025919 Bacteria 4435
219 Ga0207657_10340135 3300025919 Bacteria 1184
220 Ga0207649_10140899 3300025920 Bacteria 1650
221 Ga0207649_10256540 3300025920 Bacteria 1262
222 Ga0207681_10134357 3300025923 Bacteria 1833
223 Ga0207694_10003229 3300025924 Bacteria 12990
224 Ga0207650_10002288 3300025925 Bacteria 13348
225 Ga0207650_10261946 3300025925 Bacteria 1403
226 Ga0207659_10008394 3300025926 Bacteria 6410
227 Ga0207659_10266419 3300025926 Bacteria 1396
228 Ga0207644_10004038 3300025931 Bacteria 9522
229 Ga0207644_10012860 3300025931 Bacteria 5567
230 Ga0207644_10019766 3300025931 Bacteria 4573
231 Ga0207644_10186620 3300025931 Bacteria 1628
232 Ga0207690_10084713 3300025932 Bacteria 2223
233 Ga0207706_10011506 3300025933 Bacteria 8059
234 Ga0207706_10064935 3300025933 Bacteria 3214
235 Ga0207686_10220807 3300025934 Bacteria 1368
236 Ga0207709_10009847 3300025935 Bacteria 5263
237 Ga0207709_10047846 3300025935 Bacteria 2602
238 Ga0207709_10095285 3300025935 Bacteria 1955
239 Ga0207709_10412626 3300025935 Bacteria 1035
240 Ga0207669_10408656 3300025937 Bacteria 1065
241 Ga0207691_10001841 3300025940 Bacteria 20724
242 Ga0207691_10283967 3300025940 Bacteria 1424
243 Ga0207711_10001495 3300025941 Bacteria 21766
244 Ga0207711_10085580 3300025941 Bacteria 2762
245 Ga0207689_10714861 3300025942 Bacteria 845
246 Ga0207679_10087070 3300025945 Bacteria 2404
247 Ga0207667_10003101 3300025949 Bacteria 20573
248 Ga0207667_10013387 3300025949 Bacteria 9386
249 Ga0207667_10061040 3300025949 Bacteria 3945
250 Ga0207651_10004659 3300025960 Bacteria 6950
251 Ga0207651_10007681 3300025960 Bacteria 5759
252 Ga0207658_10026500 3300025986 Bacteria 4064
253 Ga0207658_10046373 3300025986 Bacteria 3174
254 Ga0207677_10010426 3300026023 Bacteria 5258
255 Ga0207677_10205238 3300026023 Bacteria 1570
256 Ga0207639_10039927 3300026041 Bacteria 3500
257 Ga0207639_10226783 3300026041 Bacteria 1617
258 Ga0207639_10230622 3300026041 Bacteria 1604
259 Ga0207702_10005216 3300026078 Bacteria 11410
260 Ga0207702_10586637 3300026078 Bacteria 1093
261 Ga0207641_10303652 3300026088 Bacteria 1508
262 Ga0207641_10436134 3300026088 Bacteria 1264
263 Ga0207641_10947338 3300026088 Bacteria 856
264 Ga0207648_10000053 3300026089 Bacteria 107516
265 Ga0207648_10017318 3300026089 Bacteria 6562
266 Ga0207648_10075975 3300026089 Bacteria 2928
267 Ga0207648_10177150 3300026089 Bacteria 1886
268 Ga0207676_10021173 3300026095 Bacteria 4769
269 Ga0207676_10027340 3300026095 Bacteria 4248
270 Ga0207676_10266404 3300026095 Bacteria 1549
271 Ga0207675_100047872 3300026118 Bacteria 3991
272 Ga0207675_101005551 3300026118 Bacteria 852
273 Ga0207683_10005954 3300026121 Bacteria 10447
274 Ga0207683_10181403 3300026121 Bacteria 1909
275 Ga0207683_10505360 3300026121 Bacteria 1116
276 Ga0207698_10468311 3300026142 Bacteria 1220
277 Ga0207698_11412983 3300026142 Bacteria 711
278 Ga0209998_10048829 3300027717 Bacteria 976
279 Ga0209974_10004417 3300027876 Bacteria 5003
280 Ga0268266_10334911 3300028379 Bacteria 1419
281 Ga0268265_10396457 3300028380 Bacteria 1274
282 Ga0268264_10684018 3300028381 Bacteria 1018
283 Ga0307515_10001629 3300028794 Bacteria 49963
284 Ga0307515_10066207 3300028794 Bacteria 5010
285 Ga0307515_10076602 3300028794 Bacteria 4433
286 Ga0307515_10087646 3300028794 Bacteria 3946
287 Ga0307515_10185483 3300028794 Bacteria 2011
288 Ga0307515_10248555 3300028794 Bacteria 1535
289 Ga0307515_10381387 3300028794 Bacteria 1042
290 Ga0265324_10023001 3300029957 Bacteria 2223
291 Ga0307512_10034290 3300030522 Bacteria 4344
292 Ga0265330_10003812 3300031235 Bacteria 7771
293 Ga0265332_10000841 3300031238 Bacteria 18651
294 Ga0265325_10033294 3300031241 Bacteria 2748
295 Ga0265339_10024672 3300031249 Bacteria 3461
296 Ga0265331_10000936 3300031250 Bacteria 23357
297 Ga0265327_10016553 3300031251 Bacteria 4674
298 Ga0265316_10081530 3300031344 Bacteria 2480
299 Ga0307513_10018405 3300031456 Bacteria 8345
300 Ga0307513_10056239 3300031456 Bacteria 4202
301 Ga0307513_10208749 3300031456 Bacteria 1786
302 Ga0307408_100000016 3300031548 Bacteria 356896
303 Ga0307408_100001185 3300031548 Bacteria 19736
304 Ga0307408_100137393 3300031548 Bacteria 1914
305 Ga0307408_100259889 3300031548 Bacteria 1436
306 Ga0307408_100790460 3300031548 Bacteria 860
307 Ga0307508_10000133 3300031616 Bacteria 87867
308 Ga0307508_10008282 3300031616 Bacteria 9624
309 Ga0307514_10001199 3300031649 Bacteria 34587
310 Ga0310114_106115 3300031678 Bacteria 1229
311 Ga0265314_10022857 3300031711 Bacteria 4782
312 Ga0265314_10088545 3300031711 Bacteria 2021
313 Ga0265342_10011638 3300031712 Bacteria 6004
314 Ga0307516_10001653 3300031730 Bacteria 30675
315 Ga0307516_10004130 3300031730 Bacteria 18101
316 Ga0307516_10529591 3300031730 Bacteria 832
317 Ga0307405_10143158 3300031731 Bacteria 1670
318 Ga0307413_10008938 3300031824 Bacteria 4763
319 Ga0307413_10865361 3300031824 Bacteria 765
320 Ga0307410_10006974 3300031852 Bacteria 6149
321 Ga0307406_10680800 3300031901 Bacteria 857
322 Ga0307412_10021971 3300031911 Bacteria 3904
323 Ga0307412_10069539 3300031911 Bacteria 2397
324 Ga0307412_10205664 3300031911 Bacteria 1498
325 Ga0307412_10881956 3300031911 Bacteria 783
326 Ga0307409_100358191 3300031995 Bacteria 1379
327 Ga0307409_100373413 3300031995 Bacteria 1353
328 Ga0307409_101270618 3300031995 Bacteria 761
329 Ga0307416_100506068 3300032002 Bacteria 1273
330 Ga0307416_100561127 3300032002 Bacteria 1217
331 Ga0307414_10294130 3300032004 Bacteria 1370
332 Ga0307411_10001686 3300032005 Bacteria 9255
333 Ga0307411_10007222 3300032005 Bacteria 5634
334 Ga0307411_10366328 3300032005 Bacteria 1180
335 Ga0307507_10072829 3300033179 Bacteria 3093
336 Ga0373932_0030684 3300035112 Bacteria 1492
337 Ga0373932_0259455 3300035112 Bacteria 637
338 Ga0373956_0389125 3300035119 Bacteria 665
339 Ga0373931_0011014 3300035691 Bacteria 4360
340 Ga0373927_0278669 3300035695 Bacteria 1100
341 Ga0310110_009968 3300036535 Bacteria 1389
342 Ga0373925_0230941 3300037068 Bacteria 1479
343 Ga0395898_0035646 3300037466 Bacteria 4945
344 Ga0395905_0000782 3300037471 Bacteria 41773
345 Ga0395905_0029628 3300037471 Bacteria 5158
346 Ga0395905_0376182 3300037471 Bacteria 1314
347 Ga0395905_0516671 3300037471 Bacteria 1095
348 Ga0395901_0164392 3300038443 Bacteria 2330
349 Ga0436361_0089148 3300039447 Bacteria 4791
350 Ga0436361_0674953 3300039447 Bacteria 2121
351 Ga0451789_0665935 3300041443 Bacteria 761
352 Ga0451795_1163136 3300041456 Bacteria 2854
353 Ga0451837_1651674 3300041494 Bacteria 1057
354 Ga0451853_0688630 3300041512 Bacteria 1206
355 Ga0439449_0023753 3300042007 Bacteria 2293
356 Ga0450917_007568 3300042120 Bacteria 830
357 Ga0450888_007523 3300042126 Bacteria 1207
358 Ga0450890_001567 3300042127 Bacteria 3288
359 Ga0450892_000865 3300042130 Bacteria 3298
360 Ga0450889_000295 3300042144 Bacteria 5611
361 Ga0439459_0016544 3300042438 Bacteria 1364
362 Ga0439464_0086757 3300042439 Bacteria 940
363 Ga0450916_001506 3300042530 Bacteria 2341
364 Ga0451577_0002689 3300042876 Bacteria 20732
365 Ga0451577_0114053 3300042876 Bacteria 2419
366 Ga0466969_0000010 3300044656 Bacteria 117215
367 Ga0466963_0013321 3300044694 Bacteria 5049
368 Ga0453684_0018778 3300044712 Bacteria 10582
369 Ga0453684_0668863 3300044712 Bacteria 1131
370 Ga0451576_0023757 3300045051 Bacteria 6633
371 Ga0451576_0026680 3300045051 Bacteria 6211
372 Ga0451576_0268650 3300045051 Bacteria 1783
373 Ga0466967_0415475 3300045976 Bacteria 1310
374 Ga0495617_000739 3300046452 Bacteria 16079
375 Ga0495651_0272826 3300046462 Bacteria 1146
376 Ga0495650_0003225 3300046471 Bacteria 12118
377 Ga0495580_0074020 3300046472 Bacteria 2378
378 Ga0495639_0008991 3300046475 Bacteria 4283
379 Ga0495585_0000002 3300046492 Bacteria 529316
380 Ga0495583_0000022 3300046506 Bacteria 282544
381 Ga0495606_0000015 3300046507 Bacteria 288808
382 Ga0495606_0002047 3300046507 Bacteria 24702
383 Ga0495606_0379548 3300046507 Bacteria 742
384 Ga0495610_0130149 3300046512 Bacteria 1093
385 Ga0495616_0001036 3300046513 Bacteria 19887
386 Ga0495643_0073530 3300046522 Bacteria 1791
387 Ga0495648_0000012 3300046524 Bacteria 294111
388 Ga0495642_0036103 3300046528 Bacteria 1997
389 Ga0495609_0005783 3300046538 Bacteria 6424
390 Ga0495611_0006678 3300046648 Bacteria 4908
391 Ga0495625_0000836 3300046660 Bacteria 42292
392 Ga0495625_0015143 3300046660 Bacteria 6120
393 Ga0495658_0430497 3300046683 Bacteria 842
394 Ga0495649_0000107 3300046694 Bacteria 74394
395 Ga0495589_0012806 3300046794 Bacteria 4336
396 Ga0495672_0118434 3300047320 Bacteria 1411
397 Ga0495683_0052365 3300047323 Bacteria 2038
398 Ga0495683_0097141 3300047323 Bacteria 1420
399 Ga0495677_0005267 3300047445 Bacteria 4916
400 Ga0495673_0024365 3300047469 Bacteria 2925
401 Ga0495615_0020053 3300048090 Bacteria 1493
402 Ga0496101_0507573 3300048904 Bacteria 953
403 Ga0496102_0004336 3300048905 Bacteria 11995
404 Ga0496102_0043870 3300048905 Bacteria 4056
405 Ga0496104_0041019 3300048907 Bacteria 4339
406 Ga0496104_0266443 3300048907 Bacteria 1626
407 Ga0496104_0364401 3300048907 Bacteria 1358
408 Ga0496104_0599432 3300048907 Bacteria 1012
409 Ga0496105_0086151 3300048908 Bacteria 2596
410 Ga0496105_0446326 3300048908 Bacteria 1022
411 Ga0496106_0433763 3300048909 Bacteria 1056
412 Ga0496108_0132577 3300048911 Bacteria 2142
413 Ga0496109_0049985 3300048912 Bacteria 3809
414 Ga0496109_0219499 3300048912 Bacteria 1788
415 Ga0496109_0888812 3300048912 Bacteria 829
416 Ga0496110_0234851 3300048913 Bacteria 1668
417 Ga0496110_0263396 3300048913 Bacteria 1569
418 Ga0496110_0926171 3300048913 Bacteria 778
419 Ga0496112_0090918 3300048915 Bacteria 3021
420 Ga0496113_0019957 3300048916 Bacteria 4701
421 Ga0496126_0060046 3300048929 Bacteria 3422
422 Ga0501306_019325 3300049127 Bacteria 939
423 Ga0501306_022724 3300049127 Bacteria 886
424 Ga0501306_023974 3300049127 Bacteria 869
425 Ga0501306_036644 3300049127 Bacteria 748
426 Ga0501306_038126 3300049127 Bacteria 737
427 Ga0501306_047748 3300049127 Bacteria 680
428 Ga0501308_008344 3300049128 Bacteria 1107
429 Ga0501308_014112 3300049128 Bacteria 931
430 Ga0501308_017156 3300049128 Bacteria 874
431 Ga0501308_025863 3300049128 Bacteria 763
432 Ga0501308_032844 3300049128 Bacteria 703
433 Ga0501309_019874 3300049129 Bacteria 937
434 Ga0501309_022375 3300049129 Bacteria 894
435 Ga0501309_026787 3300049129 Bacteria 834
436 Ga0501309_042344 3300049129 Bacteria 699
437 Ga0501309_043192 3300049129 Bacteria 693
438 Ga0501310_005408 3300049130 Bacteria 1310
439 Ga0501310_015935 3300049130 Bacteria 896
440 Ga0501310_016771 3300049130 Bacteria 881
441 Ga0501310_032224 3300049130 Bacteria 701
442 Ga0501304_002111 3300049160 Bacteria 1353
443 Ga0501304_009171 3300049160 Bacteria 845
444 Ga0501304_010073 3300049160 Bacteria 821
445 Ga0501305_004967 3300049161 Bacteria 1589
446 Ga0501305_025679 3300049161 Bacteria 894
447 Ga0501305_061837 3300049161 Bacteria 646
448 Ga0501307_014970 3300049162 Bacteria 953
449 Ga0501307_015866 3300049162 Bacteria 934
450 Ga0501307_036511 3300049162 Bacteria 701
451 Ga0501301_001001 3300049524 Bacteria 1766
452 Ga0501311_021877 3300049527 Bacteria 875
453 Ga0501312_022694 3300049528 Bacteria 941
454 Ga0501312_027371 3300049528 Bacteria 879
455 Ga0501312_041842 3300049528 Bacteria 751
456 Ga0501313_004639 3300049529 Bacteria 1420
457 Ga0501313_012288 3300049529 Bacteria 996
458 Ga0501313_022124 3300049529 Bacteria 791
459 Ga0501314_005403 3300049530 Bacteria 1087
460 Ga0501314_006300 3300049530 Bacteria 1031
461 Ga0501314_009495 3300049530 Bacteria 894
462 Ga0501314_010826 3300049530 Bacteria 854
463 Ga0501315_013319 3300049531 Bacteria 1028
464 Ga0501315_013691 3300049531 Bacteria 1019
465 Ga0501315_019056 3300049531 Bacteria 910
466 Ga0501315_020848 3300049531 Bacteria 883
467 Ga0501315_046432 3300049531 Bacteria 671
468 Ga0501316_014237 3300049532 Bacteria 947
469 Ga0501318_016402 3300049534 Bacteria 895
470 Ga0501321_008375 3300049537 Bacteria 1096
471 Ga0501321_015649 3300049537 Bacteria 895
472 Ga0501321_032352 3300049537 Bacteria 705
473 Ga0501321_034690 3300049537 Bacteria 688
474 Ga0501321_044859 3300049537 Bacteria 632
475 Ga0501322_004430 3300049538 Bacteria 944
476 Ga0501322_005818 3300049538 Bacteria 863
477 Ga0501322_006249 3300049538 Bacteria 844
478 Ga0501322_007047 3300049538 Bacteria 811
479 Ga0501322_009782 3300049538 Bacteria 730
480 Ga0501322_011512 3300049538 Bacteria 693
481 Ga0501323_037184 3300049539 Bacteria 703
482 Ga0501324_008437 3300049540 Bacteria 908
483 Ga0501325_021040 3300049541 Bacteria 688
484 Ga0501334_10657 3300049550 Bacteria 666
485 Ga0501340_004446 3300049556 Bacteria 884
486 Ga0501032_0115274 3300049569 Bacteria 1777
487 Ga0501034_0274939 3300049571 Bacteria 1625
488 Ga0501043_0000002 3300049579 Bacteria 351081
489 Ga0501046_0000008 3300049580 Bacteria 351167
490 Ga0501047_0000003 3300049581 Bacteria 508375
491 Ga0501048_0122131 3300049582 Bacteria 1840
492 Ga0501211_011872 3300049658 Bacteria 859
493 Ga0501227_010609 3300049665 Bacteria 1999
494 Ga0501252_008151 3300049682 Bacteria 1200
495 Ga0501255_007710 3300049684 Bacteria 1148
496 Ga0501045_0001048 3300049824 Bacteria 18195
497 nmdc:mga03683_208573_c1 3300050489 Bacteria 898
498 nmdc:mga03n38_96993_c1 3300050490 Bacteria 1415
499 nmdc:mga0k408_1147_c1 3300050493 Bacteria 14519
500 nmdc:mga0k408_137125_c1 3300050493 Bacteria 1454
501 nmdc:mga0k408_14103_c1 3300050493 Bacteria 4395
502 nmdc:mga0k408_298415_c1 3300050493 Bacteria 962
503 nmdc:mga0k408_32895_c1 3300050493 Bacteria 2963
504 nmdc:mga0k408_4840_c1 3300050493 Bacteria 7141
505 nmdc:mga0k408_533_c1 3300050493 Bacteria 20949
506 nmdc:mga07m45_114_c1 3300050496 Bacteria 32256
507 nmdc:mga07m45_14185_c1 3300050496 Bacteria 4240
508 nmdc:mga09592_2396_c1 3300050508 Bacteria 15137
509 nmdc:mga0a205_200296_c1 3300050515 Unclassified 1887
510 Ga0495655_0176144 3300053083 Unclassified 687
511 Ga0500578_0256687 3300053086 Bacteria 1051
512 Ga0500608_092540 3300053122 Bacteria 1411
513 Ga0500559_0030666 3300053136 Bacteria 2306
514 Ga0500590_019010 3300053148 Bacteria 3560
515 Ga0500619_000030 3300053154 Bacteria 46680
516 Ga0500636_0002776 3300053177 Bacteria 9766
517 Ga0500587_002994 3300053739 Bacteria 2391
518 Ga0500661_004209 3300055283 Bacteria 2692
519 Ga0466962_0231622 3300061719 Bacteria 906

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0430497 Ga0495658_0430497_60_590 169
2 3300035119 Ga0373956_0389125 Ga0373956_0389125_112_645 174
3 3300005333 Ga0070677_10252453 Ga0070677_102524531 176
4 3300005456 Ga0070678_100152466 Ga0070678_1001524662 176
5 3300005459 Ga0068867_100096314 Ga0068867_1000963143 176
6 3300026089 Ga0207648_10177150 Ga0207648_101771502 176
7 3300026121 Ga0207683_10181403 Ga0207683_101814032 176
8 3300044694 Ga0466963_0013321 Ga0466963_0013321_4489_5025 176
9 3300053154 Ga0500619_000030 Ga0500619_000030_42258_42806 179
10 3300049538 Ga0501322_009782 Ga0501322_009782_23_625 181
11 3300049540 Ga0501324_008437 Ga0501324_008437_289_885 182
12 3300025893 Ga0207682_10168334 Ga0207682_101683341 185
13 3300010375 Ga0105239_10507692 Ga0105239_105076922 187
14 3300013100 Ga0157373_10004343 Ga0157373_100043438 190
15 3300017792 Ga0163161_10393364 Ga0163161_103933642 190
16 3300032004 Ga0307414_10294130 Ga0307414_102941302 190
17 3300037068 Ga0373925_0230941 Ga0373925_0230941_315_917 190
18 3300042876 Ga0451577_0114053 Ga0451577_0114053_758_1345 190
19 3300045051 Ga0451576_0268650 Ga0451576_0268650_463_1050 190
20 iso_pu_bacteria 8055225921 8055228875 191
21 3300003374 JGI25161J50226_1000182 JGI25161J50226_100018247 192
22 3300003771 Ga0055526_1000780 Ga0055526_10007802 192
23 3300003775 Ga0055524_1023255 Ga0055524_10232552 192
24 3300004625 Ga0055543_1000112 Ga0055543_100011236 192
25 3300005262 Ga0065165_1005676 Ga0065165_10056766 192
26 3300025208 Ga0209436_100484 Ga0209436_1004849 192
27 3300025263 Ga0209565_1000878 Ga0209565_100087813 192
28 3300025284 Ga0209130_1000237 Ga0209130_100023747 192
29 3300025291 Ga0209675_1004686 Ga0209675_10046862 192
30 3300025295 Ga0209564_1000311 Ga0209564_100031144 192
31 3300049531 Ga0501315_013319 Ga0501315_013319_297_896 192
32 iso_pu_bacteria 2643221544 2643743391 192
33 iso_pu_bacteria 2643221585 2643932569 192
34 iso_pu_bacteria 2643221646 2644260839 192
35 iso_pu_bacteria 2643221656 2644313820 192
36 iso_pu_bacteria 2738541337 2739056312 192
37 3300049129 Ga0501309_043192 Ga0501309_043192_14_622 193
38 iso_pu_bacteria 2585428062 2587756789 193
39 iso_pu_bacteria 2932410948 2932413186 193
40 iso_pu_bacteria 2932416698 2932417247 193
41 3300031911 Ga0307412_10881956 Ga0307412_108819561 195
42 3300049528 Ga0501312_027371 Ga0501312_027371_34_633 195
43 3300003316 rootH1_10003266 rootH1_100032665 196
44 3300003322 rootL2_10047996 rootL2_100479961 196
45 3300003322 rootL2_10072243 rootL2_100722434 196
46 3300003794 Ga0055531_10000001 Ga0055531_10000001275 196
47 3300005328 Ga0070676_10287396 Ga0070676_102873962 196
48 3300005331 Ga0070670_100762186 Ga0070670_1007621861 196
49 3300005337 Ga0070682_100040109 Ga0070682_1000401092 196
50 3300005355 Ga0070671_100011093 Ga0070671_1000110934 196
51 3300005518 Ga0070699_100273387 Ga0070699_1002733872 196
52 3300005618 Ga0068864_100018312 Ga0068864_1000183126 196
53 3300005841 Ga0068863_100074674 Ga0068863_1000746742 196
54 3300006195 Ga0075366_10205226 Ga0075366_102052262 196
55 3300006195 Ga0075366_10226641 Ga0075366_102266412 196
56 3300006353 Ga0075370_10038071 Ga0075370_100380711 196
57 3300006353 Ga0075370_10063586 Ga0075370_100635863 196
58 3300009148 Ga0105243_10047416 Ga0105243_100474164 196
59 3300009177 Ga0105248_10001875 Ga0105248_1000187520 196
60 3300020078 Ga0206352_10163021 Ga0206352_101630212 196
61 3300025298 Ga0209050_1001427 Ga0209050_100142713 196
62 3300025303 Ga0209051_1015749 Ga0209051_10157492 196
63 3300025304 Ga0209257_1000033 Ga0209257_1000033362 196
64 3300025304 Ga0209257_1010307 Ga0209257_10103076 196
65 3300025925 Ga0207650_10261946 Ga0207650_102619463 196
66 3300025931 Ga0207644_10012860 Ga0207644_100128604 196
67 3300025935 Ga0207709_10047846 Ga0207709_100478462 196
68 3300025941 Ga0207711_10001495 Ga0207711_1000149519 196
69 3300026088 Ga0207641_10436134 Ga0207641_104361342 196
70 3300026095 Ga0207676_10266404 Ga0207676_102664042 196
71 3300028794 Ga0307515_10066207 Ga0307515_100662075 196
72 3300028794 Ga0307515_10185483 Ga0307515_101854833 196
73 3300031548 Ga0307408_100000016 Ga0307408_100000016242 196
74 3300031730 Ga0307516_10529591 Ga0307516_105295911 196
75 3300031995 Ga0307409_100358191 Ga0307409_1003581912 196
76 3300032005 Ga0307411_10007222 Ga0307411_100072223 196
77 3300037471 Ga0395905_0000782 Ga0395905_0000782_19941_20546 196
78 3300041512 Ga0451853_0688630 Ga0451853_0688630_213_818 196
79 3300042120 Ga0450917_007568 Ga0450917_007568_69_674 196
80 3300042126 Ga0450888_007523 Ga0450888_007523_168_773 196
81 3300042127 Ga0450890_001567 Ga0450890_001567_2570_3175 196
82 3300042130 Ga0450892_000865 Ga0450892_000865_2468_3073 196
83 3300042144 Ga0450889_000295 Ga0450889_000295_4598_5203 196
84 3300042438 Ga0439459_0016544 Ga0439459_0016544_178_783 196
85 3300042530 Ga0450916_001506 Ga0450916_001506_1644_2249 196
86 3300044712 Ga0453684_0018778 Ga0453684_0018778_2993_3598 196
87 3300044712 Ga0453684_0668863 Ga0453684_0668863_338_943 196
88 3300045051 Ga0451576_0023757 Ga0451576_0023757_19_624 196
89 3300046528 Ga0495642_0036103 Ga0495642_0036103_539_1135 196
90 3300046538 Ga0495609_0005783 Ga0495609_0005783_3061_3657 196
91 3300046648 Ga0495611_0006678 Ga0495611_0006678_2575_3171 196
92 3300047320 Ga0495672_0118434 Ga0495672_0118434_780_1376 196
93 3300047323 Ga0495683_0052365 Ga0495683_0052365_1252_1848 196
94 3300047445 Ga0495677_0005267 Ga0495677_0005267_3911_4507 196
95 3300047469 Ga0495673_0024365 Ga0495673_0024365_1166_1762 196
96 3300048907 Ga0496104_0041019 Ga0496104_0041019_817_1413 196
97 3300048912 Ga0496109_0219499 Ga0496109_0219499_761_1357 196
98 3300048913 Ga0496110_0234851 Ga0496110_0234851_13_609 196
99 3300048915 Ga0496112_0090918 Ga0496112_0090918_2064_2660 196
100 3300048916 Ga0496113_0019957 Ga0496113_0019957_2383_2979 196
101 3300049531 Ga0501315_020848 Ga0501315_020848_260_865 196
102 3300049538 Ga0501322_007047 Ga0501322_007047_193_798 196
103 3300049665 Ga0501227_010609 Ga0501227_010609_916_1521 196
104 3300049682 Ga0501252_008151 Ga0501252_008151_572_1168 196
105 3300049684 Ga0501255_007710 Ga0501255_007710_427_1032 196
106 3300050496 nmdc:mga07m45_14185_c1 nmdc:mga07m45_14185_c1_3586_4191 196
107 3300002773 JGI25152J39213_1016178 JGI25152J39213_10161782 197
108 3300002774 JGI25150J39212_1000655 JGI25150J39212_10006551 197
109 3300002987 JGI25159J45721_1010954 JGI25159J45721_10109543 197
110 3300003215 JGI25153J46596_10007539 JGI25153J46596_100075395 197
111 3300003771 Ga0055526_1003391 Ga0055526_10033912 197
112 3300003773 Ga0055537_1003470 Ga0055537_10034706 197
113 3300003775 Ga0055524_1000187 Ga0055524_10001878 197
114 3300003775 Ga0055524_1018949 Ga0055524_10189493 197
115 3300003784 Ga0055534_1002067 Ga0055534_10020676 197
116 3300003790 Ga0055528_1003283 Ga0055528_10032833 197
117 3300003791 Ga0055530_10000444 Ga0055530_100004443 197
118 3300003791 Ga0055530_10001759 Ga0055530_1000175911 197
119 3300003794 Ga0055531_10001467 Ga0055531_100014672 197
120 3300005290 Ga0065712_10179619 Ga0065712_101796192 197
121 3300005293 Ga0065715_10119799 Ga0065715_101197993 197
122 3300005330 Ga0070690_100646440 Ga0070690_1006464401 197
123 3300005331 Ga0070670_100316581 Ga0070670_1003165811 197
124 3300005333 Ga0070677_10001601 Ga0070677_100016013 197
125 3300005338 Ga0068868_100011500 Ga0068868_1000115004 197
126 3300005340 Ga0070689_100268722 Ga0070689_1002687222 197
127 3300005353 Ga0070669_100008226 Ga0070669_1000082267 197
128 3300005354 Ga0070675_100001473 Ga0070675_10000147310 197
129 3300005354 Ga0070675_100242132 Ga0070675_1002421322 197
130 3300005355 Ga0070671_100030101 Ga0070671_1000301014 197
131 3300005356 Ga0070674_100002004 Ga0070674_1000020047 197
132 3300005356 Ga0070674_100327471 Ga0070674_1003274712 197
133 3300005364 Ga0070673_100030008 Ga0070673_1000300084 197
134 3300005364 Ga0070673_100733199 Ga0070673_1007331991 197
135 3300005367 Ga0070667_100113363 Ga0070667_1001133632 197
136 3300005367 Ga0070667_100145705 Ga0070667_1001457053 197
137 3300005441 Ga0070700_100794532 Ga0070700_1007945321 197
138 3300005445 Ga0070708_100000818 Ga0070708_1000008185 197
139 3300005456 Ga0070678_100005561 Ga0070678_1000055618 197
140 3300005456 Ga0070678_100616722 Ga0070678_1006167221 197
141 3300005457 Ga0070662_100389227 Ga0070662_1003892272 197
142 3300005459 Ga0068867_100000086 Ga0068867_10000008623 197
143 3300005459 Ga0068867_100160265 Ga0068867_1001602651 197
144 3300005539 Ga0068853_100981307 Ga0068853_1009813071 197
145 3300005543 Ga0070672_100000367 Ga0070672_1000003678 197
146 3300005543 Ga0070672_100007805 Ga0070672_1000078055 197
147 3300005548 Ga0070665_100068041 Ga0070665_1000680414 197
148 3300005564 Ga0070664_100029166 Ga0070664_1000291665 197
149 3300005577 Ga0068857_100156332 Ga0068857_1001563323 197
150 3300005617 Ga0068859_100918221 Ga0068859_1009182212 197
151 3300005618 Ga0068864_100023287 Ga0068864_1000232875 197
152 3300005618 Ga0068864_100142004 Ga0068864_1001420042 197
153 3300005719 Ga0068861_100906416 Ga0068861_1009064161 197
154 3300005840 Ga0068870_10139262 Ga0068870_101392622 197
155 3300005843 Ga0068860_100410901 Ga0068860_1004109012 197
156 3300005844 Ga0068862_100144841 Ga0068862_1001448412 197
157 3300006058 Ga0075432_10066585 Ga0075432_100665852 197
158 3300006177 Ga0075362_10222980 Ga0075362_102229802 197
159 3300006195 Ga0075366_10001671 Ga0075366_100016715 197
160 3300006195 Ga0075366_10002150 Ga0075366_100021508 197
161 3300006195 Ga0075366_10014138 Ga0075366_100141386 197
162 3300006195 Ga0075366_10101444 Ga0075366_101014442 197
163 3300006195 Ga0075366_10214769 Ga0075366_102147692 197
164 3300006358 Ga0068871_100394113 Ga0068871_1003941132 197
165 3300006358 Ga0068871_100532837 Ga0068871_1005328371 197
166 3300006880 Ga0075429_100014531 Ga0075429_1000145316 197
167 3300006931 Ga0097620_100918226 Ga0097620_1009182261 197
168 3300007076 Ga0075435_100102283 Ga0075435_1001022832 197
169 3300009101 Ga0105247_10289544 Ga0105247_102895442 197
170 3300009148 Ga0105243_10010856 Ga0105243_100108566 197
171 3300009177 Ga0105248_10000471 Ga0105248_100004716 197
172 3300009177 Ga0105248_10146220 Ga0105248_101462203 197
173 3300013104 Ga0157370_10348212 Ga0157370_103482122 197
174 3300013296 Ga0157374_10064011 Ga0157374_100640112 197
175 3300013297 Ga0157378_10690996 Ga0157378_106909961 197
176 3300013306 Ga0163162_10283320 Ga0163162_102833202 197
177 3300013306 Ga0163162_10388153 Ga0163162_103881532 197
178 3300013308 Ga0157375_10410376 Ga0157375_104103762 197
179 3300014325 Ga0163163_10028813 Ga0163163_100288137 197
180 3300014325 Ga0163163_10660601 Ga0163163_106606011 197
181 3300014745 Ga0157377_10000038 Ga0157377_1000003897 197
182 3300014968 Ga0157379_10620012 Ga0157379_106200122 197
183 3300014969 Ga0157376_10016519 Ga0157376_100165198 197
184 3300014969 Ga0157376_10319849 Ga0157376_103198492 197
185 3300017792 Ga0163161_10060906 Ga0163161_100609064 197
186 3300017792 Ga0163161_10149756 Ga0163161_101497562 197
187 3300021361 Ga0213872_10011831 Ga0213872_100118314 197
188 3300025208 Ga0209436_102860 Ga0209436_1028604 197
189 3300025245 Ga0207425_1000001 Ga0207425_1000001209 197
190 3300025245 Ga0207425_1000130 Ga0207425_100013018 197
191 3300025258 Ga0209129_1000003 Ga0209129_1000003209 197
192 3300025258 Ga0209129_1008481 Ga0209129_10084813 197
193 3300025263 Ga0209565_1000572 Ga0209565_10005723 197
194 3300025263 Ga0209565_1003147 Ga0209565_10031472 197
195 3300025284 Ga0209130_1004662 Ga0209130_10046621 197
196 3300025291 Ga0209675_1031846 Ga0209675_10318462 197
197 3300025295 Ga0209564_1042286 Ga0209564_10422862 197
198 3300025297 Ga0209758_1000041 Ga0209758_1000041157 197
199 3300025298 Ga0209050_1000011 Ga0209050_1000011219 197
200 3300025298 Ga0209050_1000280 Ga0209050_10002802 197
201 3300025298 Ga0209050_1000664 Ga0209050_100066429 197
202 3300025299 Ga0209256_1000068 Ga0209256_100006885 197
203 3300025299 Ga0209256_1000952 Ga0209256_100095236 197
204 3300025299 Ga0209256_1038346 Ga0209256_10383462 197
205 3300025302 Ga0207426_1003864 Ga0207426_10038644 197
206 3300025303 Ga0209051_1006353 Ga0209051_10063536 197
207 3300025304 Ga0209257_1000003 Ga0209257_1000003991 197
208 3300025304 Ga0209257_1010241 Ga0209257_10102417 197
209 3300025893 Ga0207682_10001930 Ga0207682_100019308 197
210 3300025898 Ga0207692_10066964 Ga0207692_100669643 197
211 3300025903 Ga0207680_10075899 Ga0207680_100758992 197
212 3300025907 Ga0207645_10083293 Ga0207645_100832932 197
213 3300025908 Ga0207643_10122785 Ga0207643_101227852 197
214 3300025919 Ga0207657_10340135 Ga0207657_103401351 197
215 3300025923 Ga0207681_10134357 Ga0207681_101343572 197
216 3300025925 Ga0207650_10002288 Ga0207650_100022887 197
217 3300025926 Ga0207659_10008394 Ga0207659_100083942 197
218 3300025926 Ga0207659_10266419 Ga0207659_102664192 197
219 3300025931 Ga0207644_10004038 Ga0207644_1000403810 197
220 3300025931 Ga0207644_10019766 Ga0207644_100197662 197
221 3300025931 Ga0207644_10186620 Ga0207644_101866202 197
222 3300025933 Ga0207706_10064935 Ga0207706_100649355 197
223 3300025935 Ga0207709_10009847 Ga0207709_100098472 197
224 3300025937 Ga0207669_10408656 Ga0207669_104086561 197
225 3300025940 Ga0207691_10001841 Ga0207691_1000184117 197
226 3300025940 Ga0207691_10283967 Ga0207691_102839672 197
227 3300025941 Ga0207711_10085580 Ga0207711_100855803 197
228 3300025945 Ga0207679_10087070 Ga0207679_100870702 197
229 3300025960 Ga0207651_10007681 Ga0207651_100076813 197
230 3300025986 Ga0207658_10026500 Ga0207658_100265006 197
231 3300025986 Ga0207658_10046373 Ga0207658_100463733 197
232 3300026023 Ga0207677_10010426 Ga0207677_100104264 197
233 3300026023 Ga0207677_10205238 Ga0207677_102052382 197
234 3300026041 Ga0207639_10226783 Ga0207639_102267832 197
235 3300026088 Ga0207641_10303652 Ga0207641_103036522 197
236 3300026088 Ga0207641_10947338 Ga0207641_109473382 197
237 3300026089 Ga0207648_10000053 Ga0207648_1000005384 197
238 3300026089 Ga0207648_10017318 Ga0207648_100173183 197
239 3300026095 Ga0207676_10021173 Ga0207676_100211733 197
240 3300026095 Ga0207676_10027340 Ga0207676_100273402 197
241 3300026118 Ga0207675_101005551 Ga0207675_1010055511 197
242 3300026121 Ga0207683_10005954 Ga0207683_100059548 197
243 3300026121 Ga0207683_10505360 Ga0207683_105053602 197
244 3300027717 Ga0209998_10048829 Ga0209998_100488292 197
245 3300027876 Ga0209974_10004417 Ga0209974_100044172 197
246 3300028379 Ga0268266_10334911 Ga0268266_103349112 197
247 3300028381 Ga0268264_10684018 Ga0268264_106840182 197
248 3300028794 Ga0307515_10001629 Ga0307515_1000162921 197
249 3300028794 Ga0307515_10076602 Ga0307515_100766023 197
250 3300028794 Ga0307515_10087646 Ga0307515_100876462 197
251 3300028794 Ga0307515_10248555 Ga0307515_102485552 197
252 3300029957 Ga0265324_10023001 Ga0265324_100230012 197
253 3300030522 Ga0307512_10034290 Ga0307512_100342904 197
254 3300031235 Ga0265330_10003812 Ga0265330_100038126 197
255 3300031238 Ga0265332_10000841 Ga0265332_1000084113 197
256 3300031241 Ga0265325_10033294 Ga0265325_100332943 197
257 3300031249 Ga0265339_10024672 Ga0265339_100246725 197
258 3300031250 Ga0265331_10000936 Ga0265331_1000093625 197
259 3300031251 Ga0265327_10016553 Ga0265327_100165533 197
260 3300031344 Ga0265316_10081530 Ga0265316_100815302 197
261 3300031456 Ga0307513_10018405 Ga0307513_100184055 197
262 3300031456 Ga0307513_10056239 Ga0307513_100562392 197
263 3300031456 Ga0307513_10208749 Ga0307513_102087492 197
264 3300031548 Ga0307408_100001185 Ga0307408_1000011856 197
265 3300031548 Ga0307408_100137393 Ga0307408_1001373932 197
266 3300031548 Ga0307408_100259889 Ga0307408_1002598892 197
267 3300031548 Ga0307408_100790460 Ga0307408_1007904602 197
268 3300031616 Ga0307508_10000133 Ga0307508_1000013383 197
269 3300031616 Ga0307508_10008282 Ga0307508_100082829 197
270 3300031649 Ga0307514_10001199 Ga0307514_100011998 197
271 3300031711 Ga0265314_10022857 Ga0265314_100228573 197
272 3300031711 Ga0265314_10088545 Ga0265314_100885452 197
273 3300031712 Ga0265342_10011638 Ga0265342_100116385 197
274 3300031730 Ga0307516_10001653 Ga0307516_1000165315 197
275 3300031731 Ga0307405_10143158 Ga0307405_101431582 197
276 3300031824 Ga0307413_10008938 Ga0307413_100089382 197
277 3300031824 Ga0307413_10865361 Ga0307413_108653611 197
278 3300031852 Ga0307410_10006974 Ga0307410_100069747 197
279 3300031901 Ga0307406_10680800 Ga0307406_106808002 197
280 3300031911 Ga0307412_10021971 Ga0307412_100219711 197
281 3300031911 Ga0307412_10069539 Ga0307412_100695393 197
282 3300031911 Ga0307412_10205664 Ga0307412_102056641 197
283 3300031995 Ga0307409_100373413 Ga0307409_1003734131 197
284 3300031995 Ga0307409_101270618 Ga0307409_1012706181 197
285 3300032002 Ga0307416_100506068 Ga0307416_1005060682 197
286 3300032002 Ga0307416_100561127 Ga0307416_1005611271 197
287 3300032005 Ga0307411_10001686 Ga0307411_100016869 197
288 3300032005 Ga0307411_10366328 Ga0307411_103663282 197
289 3300033179 Ga0307507_10072829 Ga0307507_100728292 197
290 3300035112 Ga0373932_0030684 Ga0373932_0030684_377_988 197
291 3300035112 Ga0373932_0259455 Ga0373932_0259455_22_621 197
292 3300035691 Ga0373931_0011014 Ga0373931_0011014_98_709 197
293 3300035695 Ga0373927_0278669 Ga0373927_0278669_35_637 197
294 3300037471 Ga0395905_0029628 Ga0395905_0029628_1017_1619 197
295 3300037471 Ga0395905_0376182 Ga0395905_0376182_446_1048 197
296 3300039447 Ga0436361_0674953 Ga0436361_0674953_1117_1719 197
297 3300041443 Ga0451789_0665935 Ga0451789_0665935_28_627 197
298 3300041456 Ga0451795_1163136 Ga0451795_1163136_168_767 197
299 3300041494 Ga0451837_1651674 Ga0451837_1651674_142_741 197
300 3300042439 Ga0439464_0086757 Ga0439464_0086757_37_636 197
301 3300042876 Ga0451577_0002689 Ga0451577_0002689_9058_9657 197
302 3300045051 Ga0451576_0026680 Ga0451576_0026680_3438_4076 197
303 3300046452 Ga0495617_000739 Ga0495617_000739_15221_15820 197
304 3300046472 Ga0495580_0074020 Ga0495580_0074020_1153_1767 197
305 3300046492 Ga0495585_0000002 Ga0495585_0000002_306752_307351 197
306 3300046507 Ga0495606_0000015 Ga0495606_0000015_127496_128095 197
307 3300046507 Ga0495606_0379548 Ga0495606_0379548_73_675 197
308 3300046512 Ga0495610_0130149 Ga0495610_0130149_34_633 197
309 3300046513 Ga0495616_0001036 Ga0495616_0001036_5457_6056 197
310 3300046522 Ga0495643_0073530 Ga0495643_0073530_133_732 197
311 3300046524 Ga0495648_0000012 Ga0495648_0000012_221966_222565 197
312 3300046660 Ga0495625_0000836 Ga0495625_0000836_20019_20618 197
313 3300048090 Ga0495615_0020053 Ga0495615_0020053_613_1284 197
314 3300048904 Ga0496101_0507573 Ga0496101_0507573_164_835 197
315 3300048905 Ga0496102_0004336 Ga0496102_0004336_2638_3252 197
316 3300048905 Ga0496102_0043870 Ga0496102_0043870_1271_1873 197
317 3300048907 Ga0496104_0364401 Ga0496104_0364401_352_1023 197
318 3300048907 Ga0496104_0599432 Ga0496104_0599432_114_716 197
319 3300048908 Ga0496105_0086151 Ga0496105_0086151_1915_2586 197
320 3300048908 Ga0496105_0446326 Ga0496105_0446326_287_889 197
321 3300048909 Ga0496106_0433763 Ga0496106_0433763_331_1002 197
322 3300048911 Ga0496108_0132577 Ga0496108_0132577_54_725 197
323 3300048912 Ga0496109_0049985 Ga0496109_0049985_1710_2381 197
324 3300048912 Ga0496109_0888812 Ga0496109_0888812_182_784 197
325 3300048913 Ga0496110_0263396 Ga0496110_0263396_635_1237 197
326 3300048913 Ga0496110_0926171 Ga0496110_0926171_10_618 197
327 3300049127 Ga0501306_019325 Ga0501306_019325_23_625 197
328 3300049127 Ga0501306_023974 Ga0501306_023974_20_622 197
329 3300049127 Ga0501306_036644 Ga0501306_036644_17_619 197
330 3300049127 Ga0501306_038126 Ga0501306_038126_16_615 197
331 3300049127 Ga0501306_047748 Ga0501306_047748_20_622 197
332 3300049128 Ga0501308_008344 Ga0501308_008344_490_1092 197
333 3300049128 Ga0501308_014112 Ga0501308_014112_315_917 197
334 3300049128 Ga0501308_017156 Ga0501308_017156_249_851 197
335 3300049128 Ga0501308_032844 Ga0501308_032844_23_625 197
336 3300049129 Ga0501309_019874 Ga0501309_019874_313_915 197
337 3300049129 Ga0501309_022375 Ga0501309_022375_278_880 197
338 3300049129 Ga0501309_026787 Ga0501309_026787_35_634 197
339 3300049129 Ga0501309_042344 Ga0501309_042344_24_626 197
340 3300049130 Ga0501310_005408 Ga0501310_005408_16_618 197
341 3300049130 Ga0501310_015935 Ga0501310_015935_284_883 197
342 3300049130 Ga0501310_016771 Ga0501310_016771_23_625 197
343 3300049130 Ga0501310_032224 Ga0501310_032224_23_625 197
344 3300049160 Ga0501304_002111 Ga0501304_002111_20_622 197
345 3300049160 Ga0501304_009171 Ga0501304_009171_223_825 197
346 3300049160 Ga0501304_010073 Ga0501304_010073_23_625 197
347 3300049161 Ga0501305_025679 Ga0501305_025679_23_625 197
348 3300049161 Ga0501305_061837 Ga0501305_061837_20_622 197
349 3300049162 Ga0501307_014970 Ga0501307_014970_22_624 197
350 3300049162 Ga0501307_015866 Ga0501307_015866_315_917 197
351 3300049162 Ga0501307_036511 Ga0501307_036511_23_625 197
352 3300049524 Ga0501301_001001 Ga0501301_001001_209_811 197
353 3300049527 Ga0501311_021877 Ga0501311_021877_258_860 197
354 3300049528 Ga0501312_022694 Ga0501312_022694_23_625 197
355 3300049529 Ga0501313_004639 Ga0501313_004639_20_622 197
356 3300049529 Ga0501313_022124 Ga0501313_022124_22_624 197
357 3300049530 Ga0501314_009495 Ga0501314_009495_15_617 197
358 3300049530 Ga0501314_010826 Ga0501314_010826_11_613 197
359 3300049531 Ga0501315_019056 Ga0501315_019056_290_892 197
360 3300049531 Ga0501315_046432 Ga0501315_046432_47_649 197
361 3300049532 Ga0501316_014237 Ga0501316_014237_20_622 197
362 3300049534 Ga0501318_016402 Ga0501318_016402_23_625 197
363 3300049537 Ga0501321_015649 Ga0501321_015649_23_625 197
364 3300049537 Ga0501321_032352 Ga0501321_032352_81_683 197
365 3300049537 Ga0501321_034690 Ga0501321_034690_20_622 197
366 3300049537 Ga0501321_044859 Ga0501321_044859_18_620 197
367 3300049538 Ga0501322_004430 Ga0501322_004430_11_613 197
368 3300049538 Ga0501322_005818 Ga0501322_005818_246_848 197
369 3300049538 Ga0501322_006249 Ga0501322_006249_230_832 197
370 3300049538 Ga0501322_011512 Ga0501322_011512_24_626 197
371 3300049539 Ga0501323_037184 Ga0501323_037184_85_687 197
372 3300049541 Ga0501325_021040 Ga0501325_021040_13_615 197
373 3300049550 Ga0501334_10657 Ga0501334_10657_23_622 197
374 3300049556 Ga0501340_004446 Ga0501340_004446_267_866 197
375 3300049569 Ga0501032_0115274 Ga0501032_0115274_750_1352 197
376 3300049579 Ga0501043_0000002 Ga0501043_0000002_111490_112092 197
377 3300049580 Ga0501046_0000008 Ga0501046_0000008_111573_112175 197
378 3300049581 Ga0501047_0000003 Ga0501047_0000003_134755_135357 197
379 3300049582 Ga0501048_0122131 Ga0501048_0122131_1149_1751 197
380 3300049658 Ga0501211_011872 Ga0501211_011872_191_790 197
381 3300049824 Ga0501045_0001048 Ga0501045_0001048_9580_10182 197
382 3300050489 nmdc:mga03683_208573_c1 nmdc:mga03683_208573_c1_111_710 197
383 3300050490 nmdc:mga03n38_96993_c1 nmdc:mga03n38_96993_c1_510_1109 197
384 3300050493 nmdc:mga0k408_1147_c1 nmdc:mga0k408_1147_c1_11499_12098 197
385 3300050493 nmdc:mga0k408_533_c1 nmdc:mga0k408_533_c1_8158_8877 197
386 3300050508 nmdc:mga09592_2396_c1 nmdc:mga09592_2396_c1_9969_10571 197
387 3300050515 nmdc:mga0a205_200296_c1 nmdc:mga0a205_200296_c1_768_1418 197
388 3300053083 Ga0495655_0176144 Ga0495655_0176144_45_647 197
389 3300053148 Ga0500590_019010 Ga0500590_019010_1903_2505 197
390 3300053739 Ga0500587_002994 Ga0500587_002994_453_1052 197
391 3300005456 Ga0070678_100868289 Ga0070678_1008682891 198
392 3300005459 Ga0068867_100253022 Ga0068867_1002530223 199
393 3300005844 Ga0068862_100031756 Ga0068862_1000317563 199
394 3300006195 Ga0075366_10028889 Ga0075366_100288891 199
395 3300006195 Ga0075366_10102319 Ga0075366_101023192 199
396 3300006195 Ga0075366_10307601 Ga0075366_103076012 199
397 3300009148 Ga0105243_10751321 Ga0105243_107513211 199
398 3300025935 Ga0207709_10412626 Ga0207709_104126262 199
399 3300026089 Ga0207648_10075975 Ga0207648_100759751 199
400 3300028380 Ga0268265_10396457 Ga0268265_103964571 199
401 3300049537 Ga0501321_008375 Ga0501321_008375_311_928 199
402 3300050493 nmdc:mga0k408_137125_c1 nmdc:mga0k408_137125_c1_495_1121 199
403 3300050493 nmdc:mga0k408_298415_c1 nmdc:mga0k408_298415_c1_150_776 199
404 3300050493 nmdc:mga0k408_32895_c1 nmdc:mga0k408_32895_c1_1372_1986 199
405 3300050493 nmdc:mga0k408_4840_c1 nmdc:mga0k408_4840_c1_1089_1730 199
406 3300021361 Ga0213872_10087888 Ga0213872_100878882 201
407 3300037471 Ga0395905_0516671 Ga0395905_0516671_284_913 201
408 3300039447 Ga0436361_0089148 Ga0436361_0089148_429_1052 201
409 3300044656 Ga0466969_0000010 Ga0466969_0000010_64502_65173 201
410 3300061719 Ga0466962_0231622 Ga0466962_0231622_30_650 201
411 3300005344 Ga0070661_100219477 Ga0070661_1002194772 202
412 3300005457 Ga0070662_100005173 Ga0070662_1000051737 202
413 3300025920 Ga0207649_10140899 Ga0207649_101408992 202
414 3300025933 Ga0207706_10011506 Ga0207706_100115068 202
415 3300025935 Ga0207709_10095285 Ga0207709_100952852 202
416 3300046471 Ga0495650_0003225 Ga0495650_0003225_4998_5609 202
417 3300002705 JGI25156J39149_1019066 JGI25156J39149_10190661 203
418 3300002738 JGI25154J39366_1004745 JGI25154J39366_10047451 203
419 3300002741 JGI25157J39369_1000038 JGI25157J39369_100003875 203
420 3300003322 rootL2_10074193 rootL2_100741933 203
421 3300003323 rootH1_10001251 rootH1_100012515 203
422 3300003323 rootH1_10025546 rootH1_100255466 203
423 3300003752 Ga0055539_1002371 Ga0055539_10023712 203
424 3300003756 Ga0055533_1000026 Ga0055533_1000026142 203
425 3300003759 Ga0055525_1000525 Ga0055525_10005252 203
426 3300005327 Ga0070658_10022875 Ga0070658_100228754 203
427 3300005327 Ga0070658_10055262 Ga0070658_100552623 203
428 3300005334 Ga0068869_100794247 Ga0068869_1007942471 203
429 3300005337 Ga0070682_100645589 Ga0070682_1006455891 203
430 3300005339 Ga0070660_100007544 Ga0070660_1000075443 203
431 3300005339 Ga0070660_100023161 Ga0070660_1000231612 203
432 3300005339 Ga0070660_100085866 Ga0070660_1000858662 203
433 3300005364 Ga0070673_100050971 Ga0070673_1000509713 203
434 3300005535 Ga0070684_100223041 Ga0070684_1002230412 203
435 3300005539 Ga0068853_100388325 Ga0068853_1003883252 203
436 3300005544 Ga0070686_100289371 Ga0070686_1002893712 203
437 3300005563 Ga0068855_100001767 Ga0068855_10000176728 203
438 3300005563 Ga0068855_100038331 Ga0068855_1000383313 203
439 3300005563 Ga0068855_100289055 Ga0068855_1002890553 203
440 3300005563 Ga0068855_100653855 Ga0068855_1006538552 203
441 3300005577 Ga0068857_100004097 Ga0068857_10000409711 203
442 3300005578 Ga0068854_100009523 Ga0068854_1000095233 203
443 3300005614 Ga0068856_100002296 Ga0068856_10000229610 203
444 3300005614 Ga0068856_101183924 Ga0068856_1011839241 203
445 3300005616 Ga0068852_100786968 Ga0068852_1007869681 203
446 3300005616 Ga0068852_100875522 Ga0068852_1008755222 203
447 3300006353 Ga0075370_10001645 Ga0075370_100016454 203
448 3300009093 Ga0105240_10018658 Ga0105240_100186582 203
449 3300009148 Ga0105243_10171712 Ga0105243_101717122 203
450 3300009174 Ga0105241_10009231 Ga0105241_100092314 203
451 3300009176 Ga0105242_10055776 Ga0105242_100557763 203
452 3300009545 Ga0105237_10429091 Ga0105237_104290912 203
453 3300009551 Ga0105238_10047236 Ga0105238_100472361 203
454 3300010375 Ga0105239_10021588 Ga0105239_100215884 203
455 3300013105 Ga0157369_10029515 Ga0157369_100295152 203
456 3300013297 Ga0157378_10568233 Ga0157378_105682332 203
457 3300013307 Ga0157372_10224846 Ga0157372_102248462 203
458 3300013308 Ga0157375_10849141 Ga0157375_108491411 203
459 3300014968 Ga0157379_10615951 Ga0157379_106159511 203
460 3300025226 Ga0209674_100024 Ga0209674_100024159 203
461 3300025230 Ga0209563_100069 Ga0209563_100069159 203
462 3300025231 Ga0207427_101384 Ga0207427_1013847 203
463 3300025242 Ga0209258_100870 Ga0209258_10087013 203
464 3300025246 Ga0209646_1000012 Ga0209646_1000012344 203
465 3300025250 Ga0209026_1000004 Ga0209026_1000004276 203
466 3300025253 Ga0209677_100048 Ga0209677_10004848 203
467 3300025253 Ga0209677_100263 Ga0209677_10026320 203
468 3300025253 Ga0209677_101400 Ga0209677_1014009 203
469 3300025256 Ga0209759_1000003 Ga0209759_1000003452 203
470 3300025256 Ga0209759_1001348 Ga0209759_100134811 203
471 3300025256 Ga0209759_1003047 Ga0209759_10030472 203
472 3300025256 Ga0209759_1013641 Ga0209759_10136411 203
473 3300025909 Ga0207705_10018721 Ga0207705_100187213 203
474 3300025909 Ga0207705_10064063 Ga0207705_100640633 203
475 3300025911 Ga0207654_10034576 Ga0207654_100345763 203
476 3300025913 Ga0207695_10015011 Ga0207695_100150119 203
477 3300025914 Ga0207671_10205106 Ga0207671_102051062 203
478 3300025919 Ga0207657_10035980 Ga0207657_100359802 203
479 3300025920 Ga0207649_10256540 Ga0207649_102565401 203
480 3300025924 Ga0207694_10003229 Ga0207694_1000322911 203
481 3300025932 Ga0207690_10084713 Ga0207690_100847131 203
482 3300025934 Ga0207686_10220807 Ga0207686_102208072 203
483 3300025942 Ga0207689_10714861 Ga0207689_107148611 203
484 3300025949 Ga0207667_10003101 Ga0207667_1000310123 203
485 3300025949 Ga0207667_10013387 Ga0207667_100133875 203
486 3300025949 Ga0207667_10061040 Ga0207667_100610402 203
487 3300025960 Ga0207651_10004659 Ga0207651_100046593 203
488 3300026041 Ga0207639_10039927 Ga0207639_100399272 203
489 3300026041 Ga0207639_10230622 Ga0207639_102306222 203
490 3300026078 Ga0207702_10005216 Ga0207702_100052164 203
491 3300026078 Ga0207702_10586637 Ga0207702_105866372 203
492 3300026118 Ga0207675_100047872 Ga0207675_1000478724 203
493 3300026142 Ga0207698_10468311 Ga0207698_104683112 203
494 3300026142 Ga0207698_11412983 Ga0207698_114129831 203
495 3300028794 Ga0307515_10381387 Ga0307515_103813872 203
496 3300031678 Ga0310114_106115 Ga0310114_1061151 203
497 3300031730 Ga0307516_10004130 Ga0307516_100041306 203
498 3300036535 Ga0310110_009968 Ga0310110_009968_51_680 203
499 3300037466 Ga0395898_0035646 Ga0395898_0035646_757_1386 203
500 3300038443 Ga0395901_0164392 Ga0395901_0164392_53_682 203
501 3300042007 Ga0439449_0023753 Ga0439449_0023753_417_1049 203
502 3300045976 Ga0466967_0415475 Ga0466967_0415475_384_1013 203
503 3300046462 Ga0495651_0272826 Ga0495651_0272826_379_1008 203
504 3300046475 Ga0495639_0008991 Ga0495639_0008991_753_1382 203
505 3300046506 Ga0495583_0000022 Ga0495583_0000022_45863_46492 203
506 3300046507 Ga0495606_0002047 Ga0495606_0002047_11132_11761 203
507 3300046660 Ga0495625_0015143 Ga0495625_0015143_4782_5411 203
508 3300046694 Ga0495649_0000107 Ga0495649_0000107_1613_2242 203
509 3300046794 Ga0495589_0012806 Ga0495589_0012806_1923_2552 203
510 3300047323 Ga0495683_0097141 Ga0495683_0097141_245_874 203
511 3300048907 Ga0496104_0266443 Ga0496104_0266443_386_997 203
512 3300048929 Ga0496126_0060046 Ga0496126_0060046_2260_2886 203
513 3300049127 Ga0501306_022724 Ga0501306_022724_15_647 203
514 3300049128 Ga0501308_025863 Ga0501308_025863_31_666 203
515 3300049161 Ga0501305_004967 Ga0501305_004967_31_666 203
516 3300049528 Ga0501312_041842 Ga0501312_041842_88_723 203
517 3300049529 Ga0501313_012288 Ga0501313_012288_31_666 203
518 3300049530 Ga0501314_005403 Ga0501314_005403_428_1063 203
519 3300049530 Ga0501314_006300 Ga0501314_006300_374_1009 203
520 3300049531 Ga0501315_013691 Ga0501315_013691_356_991 203
521 3300049571 Ga0501034_0274939 Ga0501034_0274939_285_935 203
522 3300050493 nmdc:mga0k408_14103_c1 nmdc:mga0k408_14103_c1_629_1258 203
523 3300050496 nmdc:mga07m45_114_c1 nmdc:mga07m45_114_c1_9951_10580 203
524 3300053086 Ga0500578_0256687 Ga0500578_0256687_384_1013 203
525 3300053122 Ga0500608_092540 Ga0500608_092540_601_1230 203
526 3300053136 Ga0500559_0030666 Ga0500559_0030666_648_1277 203
527 3300053177 Ga0500636_0002776 Ga0500636_0002776_5057_5686 203
528 3300055283 Ga0500661_004209 Ga0500661_004209_1805_2434 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

1

195

0.93

PF03358

FMN_red

NADPH-dependent FMN reductase

1

168

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9537 1 200
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9533 1 200
7n2x-assembly1.cif.gz_A the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli 0.9496 2 200
1tik-assembly1.cif.gz_A crystal structure of acyl carrier protein phosphodiesterase 0.9494 2 200
1t5b-assembly1.cif.gz_B structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase 0.9483 2 198
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9472 2 200 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9186 1 199 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9064 2 200 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8959 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8924 1 199 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A519ZS40-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9888 1 203 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-U3TZ50-F1-model_v4 NAD(P)H dehydrogenase 0.9887 79 202
AF-A0A149PSZ8-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9861 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-Q2SUH7-F1-model_v4 FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9858 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A132C5Q7-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9856 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Feature Viewer

pLDDT pTM Quality
96.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map