F459627

General Info

Members Datasets Scaffolds Average Seq Length
528 262 1056 268

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10008094|Ga0070676_100080942
Length 323
Sequence VELILFESYFRTKFVSHPSGPVLYDIDSEAQIIVSVLGNNSFITCVDIFVDGVGKYLMVSKFPFIANEFSGKRVLVTGGTAGIGKAVVSRLLEGGAKVVTTAREKTMDDENREYEFVQADLSTSEGCTKVVKDVISHLGGIDILVNVVGASSAPSGGFSVLGDVEWQKELNINLMSAVRLDRGLLPGMIERGSGVIVHVSSIQRKLPLYQATLAYAAAKAALTTYSKGLSNEVGPKGIRVNSIAPGFIETSAAQQLIERLSKQSGTDMDTARQELMKSLGGIPIGRPGRPEEVAELVAFLVSDRAMSINGSEYVIDGGTVPTV

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
101 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
102 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
103 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
104 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
258 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
259 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
260 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
261 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
262 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0.19
Rhizoplane 2.08
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10008094 3300005328 Archaea 5653
2 2214795208 2209111006 Archaea 2147
3 ARcpr5oldR_c000447 3300000041 Archaea 5488
4 ARSoilYngRDRAFT_c00093 3300000042 Archaea 15110
5 ARcpr5yngRDRAFT_c001510 3300000043 Unclassified 2561
6 ARcpr5yngRDRAFT_c003002 3300000043 Bacteria 1698
7 ARSoilOldRDRAFT_c000320 3300000044 Archaea 6338
8 ARSoilOldRDRAFT_c000771 3300000044 Archaea 3265
9 ARCol0yngRDRAFT_1000434 3300000652 Archaea 5303
10 JGI25159J45721_1000648 3300002987 Bacteria 15415
11 rootL2_10129545 3300003322 Bacteria 2512
12 rootH1_10178656 3300003323 Bacteria 2714
13 JGI26145J50221_1000895 3300003371 Archaea 2398
14 JGI25161J50226_1000114 3300003374 Bacteria 62957
15 Ga0055526_1002812 3300003771 Bacteria 11527
16 Ga0055524_1011476 3300003775 Bacteria 3462
17 Ga0055528_1001115 3300003790 Bacteria 17596
18 Ga0055543_1000077 3300004625 Bacteria 86457
19 Ga0065165_1029009 3300005262 Bacteria 1778
20 Ga0065717_1001989 3300005276 Archaea 4046
21 Ga0065704_10003422 3300005289 Archaea 6566
22 Ga0065704_10007418 3300005289 Archaea 3230
23 Ga0065704_10016114 3300005289 Bacteria 1584
24 Ga0065704_10035288 3300005289 Archaea 1822
25 Ga0065712_10085112 3300005290 Archaea 2705
26 Ga0065712_10173012 3300005290 Unclassified 1209
27 Ga0065715_10012025 3300005293 Unclassified 2445
28 Ga0065707_10001051 3300005295 Archaea 11126
29 Ga0065707_10007382 3300005295 Bacteria 2356
30 Ga0065707_10156202 3300005295 Archaea 1606
31 Ga0065707_10172705 3300005295 Archaea 1472
32 Ga0070676_10007515 3300005328 Archaea 5851
33 Ga0070676_10018377 3300005328 Archaea 3874
34 Ga0070683_100002340 3300005329 Bacteria 15037
35 Ga0070670_100026446 3300005331 Archaea 4992
36 Ga0070677_10012755 3300005333 Archaea 2923
37 Ga0068869_100001841 3300005334 Bacteria 12746
38 Ga0068869_100012860 3300005334 Bacteria 5541
39 Ga0068869_100024430 3300005334 Bacteria 4186
40 Ga0070680_100128375 3300005336 Bacteria 2120
41 Ga0068868_100005125 3300005338 Bacteria 9202
42 Ga0068868_100006665 3300005338 Bacteria 8194
43 Ga0068868_100033447 3300005338 Bacteria 3963
44 Ga0068868_100086251 3300005338 Bacteria 2523
45 Ga0070660_100364520 3300005339 Archaea 1191
46 Ga0070692_10049800 3300005345 Bacteria 2174
47 Ga0070692_10210851 3300005345 Archaea 1143
48 Ga0070669_100050645 3300005353 Bacteria 3034
49 Ga0070669_100153769 3300005353 Bacteria 1782
50 Ga0070675_100002506 3300005354 Archaea 13750
51 Ga0070675_100116624 3300005354 Archaea 2265
52 Ga0070674_100467952 3300005356 Bacteria 1044
53 Ga0070709_10054444 3300005434 Bacteria 2522
54 Ga0070709_10244247 3300005434 Bacteria 1290
55 Ga0070714_100060871 3300005435 Bacteria 3241
56 Ga0070713_100134898 3300005436 Bacteria 2180
57 Ga0070713_100192511 3300005436 Bacteria 1838
58 Ga0070710_10089251 3300005437 Bacteria 1815
59 Ga0070710_10118294 3300005437 Bacteria 1600
60 Ga0070710_10161773 3300005437 Unclassified 1389
61 Ga0070701_10077585 3300005438 Archaea 1791
62 Ga0070711_100012005 3300005439 Bacteria 5397
63 Ga0070711_100066080 3300005439 Bacteria 2532
64 Ga0070711_100140770 3300005439 Bacteria 1808
65 Ga0070711_100245309 3300005439 Bacteria 1402
66 Ga0070700_100024231 3300005441 Archaea 3561
67 Ga0070700_100106743 3300005441 Archaea 1854
68 Ga0070700_100259127 3300005441 Archaea 1251
69 Ga0070694_100166350 3300005444 Archaea 1622
70 Ga0070708_100018782 3300005445 Bacteria 5789
71 Ga0070708_100116208 3300005445 Unclassified 2463
72 Ga0070708_100181097 3300005445 Bacteria 1970
73 Ga0070708_100188803 3300005445 Bacteria 1927
74 Ga0070708_100290340 3300005445 Unclassified 1540
75 Ga0070708_100399670 3300005445 Unclassified 1296
76 Ga0070708_100421591 3300005445 Bacteria 1259
77 Ga0070662_100199061 3300005457 Archaea 1588
78 Ga0070681_10037396 3300005458 Bacteria 4872
79 Ga0068867_100045204 3300005459 Archaea 3228
80 Ga0068867_100073477 3300005459 Archaea 2561
81 Ga0070706_100086068 3300005467 Bacteria 2912
82 Ga0070706_100158016 3300005467 Bacteria 2116
83 Ga0070706_100308768 3300005467 Bacteria 1475
84 Ga0070707_100000774 3300005468 Bacteria 31590
85 Ga0070707_100002032 3300005468 Bacteria 19355
86 Ga0070707_100030452 3300005468 Bacteria 5138
87 Ga0070707_100168337 3300005468 Bacteria 2135
88 Ga0070707_100235915 3300005468 Bacteria 1780
89 Ga0070707_100632705 3300005468 Bacteria 1032
90 Ga0070698_100083219 3300005471 Bacteria 3190
91 Ga0070698_100131716 3300005471 Bacteria 2456
92 Ga0070698_100323232 3300005471 Unclassified 1474
93 Ga0070698_100598617 3300005471 Bacteria 1043
94 Ga0070698_100620574 3300005471 Bacteria 1022
95 Ga0070699_100043053 3300005518 Bacteria 3909
96 Ga0070699_100126487 3300005518 Bacteria 2251
97 Ga0070699_100244535 3300005518 Bacteria 1602
98 Ga0070699_100308841 3300005518 Bacteria 1420
99 Ga0070699_100367000 3300005518 Bacteria 1298
100 Ga0070699_100419195 3300005518 Archaea 1211
101 Ga0070699_100696155 3300005518 Bacteria 928
102 Ga0070679_100065514 3300005530 Bacteria 3622
103 Ga0070697_100007485 3300005536 Bacteria 8500
104 Ga0070697_100102032 3300005536 Bacteria 2384
105 Ga0070697_100112640 3300005536 Unclassified 2269
106 Ga0070697_100183014 3300005536 Bacteria 1776
107 Ga0070697_100205692 3300005536 Bacteria 1674
108 Ga0070697_100228734 3300005536 Archaea 1586
109 Ga0070697_100511358 3300005536 Bacteria 1051
110 Ga0070672_100150916 3300005543 Bacteria 1922
111 Ga0070686_100129413 3300005544 Bacteria 1744
112 Ga0070686_100129770 3300005544 Unclassified 1741
113 Ga0070695_100204887 3300005545 Archaea 1412
114 Ga0070695_100263881 3300005545 Archaea 1259
115 Ga0070696_100089519 3300005546 Bacteria 2189
116 Ga0070696_100093499 3300005546 Bacteria 2144
117 Ga0070704_100170923 3300005549 Archaea 1729
118 Ga0070704_100292448 3300005549 Archaea 1354
119 Ga0068855_100002064 3300005563 Bacteria 24891
120 Ga0070664_100098218 3300005564 Archaea 2544
121 Ga0070664_100180940 3300005564 Bacteria 1874
122 Ga0068857_100036585 3300005577 Archaea 4349
123 Ga0068854_100137409 3300005578 Archaea 1872
124 Ga0068854_100162949 3300005578 Bacteria 1729
125 Ga0068856_100001724 3300005614 Bacteria 22874
126 Ga0068856_101002028 3300005614 Bacteria 854
127 Ga0068859_100092822 3300005617 Bacteria 3070
128 Ga0068864_100028240 3300005618 Bacteria 4740
129 Ga0068864_100101941 3300005618 Bacteria 2547
130 Ga0068864_100194176 3300005618 Bacteria 1862
131 Ga0068870_10003441 3300005840 Archaea 6708
132 Ga0068863_100000321 3300005841 Bacteria 48794
133 Ga0068863_100023864 3300005841 Bacteria 5836
134 Ga0068863_100077762 3300005841 Bacteria 3140
135 Ga0068863_100323873 3300005841 Bacteria 1497
136 Ga0068858_100091255 3300005842 Bacteria 2835
137 Ga0068860_100038221 3300005843 Archaea 4592
138 Ga0068860_100111326 3300005843 Bacteria 2617
139 Ga0068860_100398787 3300005843 Archaea 1361
140 Ga0068862_100077868 3300005844 Bacteria 2872
141 Ga0081455_10001534 3300005937 Bacteria 28453
142 Ga0081455_10002540 3300005937 Bacteria 21664
143 Ga0070717_10080252 3300006028 Bacteria 2737
144 Ga0070717_10337171 3300006028 Bacteria 1346
145 Ga0070717_10732904 3300006028 Bacteria 898
146 Ga0075432_10062885 3300006058 Archaea 1324
147 Ga0075432_10065319 3300006058 Archaea 1301
148 Ga0070715_10019140 3300006163 Bacteria 2620
149 Ga0070715_10081678 3300006163 Bacteria 1468
150 Ga0070716_100017076 3300006173 Bacteria 3756
151 Ga0070716_100090993 3300006173 Bacteria 1847
152 Ga0070716_100171300 3300006173 Bacteria 1417
153 Ga0070712_100086206 3300006175 Bacteria 2288
154 Ga0070712_100296940 3300006175 Bacteria 1306
155 Ga0097621_100000034 3300006237 Bacteria 69159
156 Ga0068871_100000444 3300006358 Bacteria 28514
157 Ga0075428_100052793 3300006844 Archaea 4454
158 Ga0075428_100105820 3300006844 Archaea 3067
159 Ga0075428_100446942 3300006844 Archaea 1385
160 Ga0075430_100085191 3300006846 Archaea 2646
161 Ga0075430_100346774 3300006846 Archaea 1226
162 Ga0075431_100046441 3300006847 Archaea 4478
163 Ga0075431_100068090 3300006847 Archaea 3674
164 Ga0075431_100146409 3300006847 Archaea 2434
165 Ga0075431_100338103 3300006847 Archaea 1515
166 Ga0075431_100796028 3300006847 Bacteria 919
167 Ga0075433_10005640 3300006852 Bacteria 9836
168 Ga0075433_10039059 3300006852 Archaea 4102
169 Ga0075433_10085452 3300006852 Bacteria 2785
170 Ga0075433_10354391 3300006852 Bacteria 1297
171 Ga0075433_10482121 3300006852 Bacteria 1092
172 Ga0075434_100006396 3300006871 Bacteria 10794
173 Ga0075434_100019816 3300006871 Bacteria 6513
174 Ga0075434_100021955 3300006871 Archaea 6212
175 Ga0075434_100027963 3300006871 Bacteria 5536
176 Ga0075434_100032567 3300006871 Bacteria 5140
177 Ga0075434_100034888 3300006871 Bacteria 4971
178 Ga0075434_100051230 3300006871 Archaea 4102
179 Ga0075434_100072053 3300006871 Bacteria 3447
180 Ga0075434_100115904 3300006871 Bacteria 2692
181 Ga0075434_100128047 3300006871 Archaea 2556
182 Ga0075434_100129644 3300006871 Bacteria 2540
183 Ga0075434_100299563 3300006871 Archaea 1628
184 Ga0075429_100029241 3300006880 Archaea 4786
185 Ga0068865_100282515 3300006881 Archaea 1322
186 Ga0075436_100003135 3300006914 Bacteria 11337
187 Ga0075436_100034434 3300006914 Archaea 3493
188 Ga0075436_100064260 3300006914 Bacteria 2536
189 Ga0075436_100158992 3300006914 Bacteria 1592
190 Ga0097620_100092814 3300006931 Bacteria 3070
191 Ga0075435_100008482 3300007076 Bacteria 7376
192 Ga0075435_100008744 3300007076 Bacteria 7286
193 Ga0075435_100079232 3300007076 Unclassified 2695
194 Ga0075435_100082952 3300007076 Bacteria 2635
195 Ga0075435_100204885 3300007076 Bacteria 1672
196 Ga0075435_100265739 3300007076 Bacteria 1462
197 Ga0075435_100591182 3300007076 Bacteria 962
198 Ga0099794_10092637 3300007265 Bacteria 1501
199 Ga0099794_10172424 3300007265 Unclassified 1103
200 Ga0099795_10030633 3300007788 Unclassified 1848
201 Ga0111539_10061896 3300009094 Archaea 4433
202 Ga0111539_10079812 3300009094 Archaea 3849
203 Ga0111539_10764368 3300009094 Archaea 1125
204 Ga0105245_10812540 3300009098 Unclassified 973
205 Ga0114129_10057228 3300009147 Archaea 5458
206 Ga0114129_10149811 3300009147 Archaea 3193
207 Ga0114129_10168869 3300009147 Bacteria 2984
208 Ga0114129_10760221 3300009147 Bacteria 1240
209 Ga0114129_10780769 3300009147 Unclassified 1220
210 Ga0105241_10267691 3300009174 Bacteria 1454
211 Ga0105242_10051753 3300009176 Bacteria 3348
212 Ga0105242_10137606 3300009176 Archaea 2115
213 Ga0105242_10389165 3300009176 Unclassified 1298
214 Ga0105248_10145020 3300009177 Bacteria 2679
215 Ga0105248_10424708 3300009177 Bacteria 1497
216 Ga0105238_10086270 3300009551 Bacteria 3126
217 Ga0105249_10018990 3300009553 Archaea 6129
218 Ga0105249_10079804 3300009553 Bacteria 3038
219 Ga0105249_10248437 3300009553 Archaea 1762
220 Ga0099796_10032700 3300010159 Unclassified 1707
221 Ga0105239_10208827 3300010375 Bacteria 2188
222 Ga0105239_10219360 3300010375 Bacteria 2133
223 Ga0105239_10313694 3300010375 Archaea 1768
224 Ga0105239_10345227 3300010375 Bacteria 1680
225 Ga0105246_10035188 3300011119 Archaea 3346
226 Ga0105246_10039821 3300011119 Archaea 3168
227 Ga0105246_10187798 3300011119 Archaea 1597
228 Ga0105246_10396779 3300011119 Unclassified 1144
229 Ga0157325_1000077 3300012485 Archaea 4105
230 Ga0157322_1000735 3300012490 Archaea 1374
231 Ga0157341_1000072 3300012494 Archaea 4045
232 Ga0157324_1000182 3300012506 Archaea 2905
233 Ga0157342_1000611 3300012507 Archaea 2279
234 Ga0157327_1000057 3300012512 Archaea 4645
235 Ga0157338_1000430 3300012515 Archaea 2436
236 Ga0157373_10282753 3300013100 Archaea 1176
237 Ga0157371_10144290 3300013102 Bacteria 1696
238 Ga0157369_10544444 3300013105 Bacteria 1200
239 Ga0157374_10000249 3300013296 Bacteria 49808
240 Ga0157374_10003117 3300013296 Bacteria 13923
241 Ga0157374_10020646 3300013296 Bacteria 5849
242 Ga0157378_10000008 3300013297 Bacteria 162605
243 Ga0157378_10006933 3300013297 Bacteria 9893
244 Ga0157378_10007441 3300013297 Archaea 9565
245 Ga0157378_10008049 3300013297 Bacteria 9199
246 Ga0157378_10227910 3300013297 Bacteria 1774
247 Ga0163162_10123922 3300013306 Unclassified 2690
248 Ga0163162_10255839 3300013306 Bacteria 1883
249 Ga0163162_10331406 3300013306 Bacteria 1655
250 Ga0157372_10000436 3300013307 Bacteria 45959
251 Ga0157372_10660306 3300013307 Archaea 1217
252 Ga0157375_10015465 3300013308 Bacteria 6832
253 Ga0157375_10528613 3300013308 Bacteria 1342
254 Ga0157375_10939668 3300013308 Bacteria 1007
255 Ga0157380_10203410 3300014326 Archaea 1759
256 Ga0157377_10000847 3300014745 Bacteria 12695
257 Ga0157377_10001065 3300014745 Archaea 11591
258 Ga0157379_10209472 3300014968 Unclassified 1764
259 Ga0157376_10099250 3300014969 Bacteria 2540
260 Ga0157376_10199942 3300014969 Bacteria 1838
261 Ga0209436_100050 3300025208 Bacteria 65942
262 Ga0209129_1002867 3300025258 Bacteria 7959
263 Ga0209673_1002867 3300025273 Bacteria 10983
264 Ga0209130_1000030 3300025284 Bacteria 323323
265 Ga0209564_1000364 3300025295 Bacteria 84138
266 Ga0209256_1002320 3300025299 Bacteria 15934
267 Ga0207426_1000047 3300025302 Bacteria 417011
268 Ga0209257_1020897 3300025304 Bacteria 2399
269 Ga0207682_10173914 3300025893 Archaea 981
270 Ga0207692_10018973 3300025898 Unclassified 3098
271 Ga0207692_10179888 3300025898 Bacteria 1231
272 Ga0207642_10167499 3300025899 Bacteria 1186
273 Ga0207647_10009331 3300025904 Archaea 6975
274 Ga0207647_10012127 3300025904 Bacteria 6014
275 Ga0207647_10013071 3300025904 Archaea 5768
276 Ga0207685_10215240 3300025905 Bacteria 911
277 Ga0207699_10013650 3300025906 Bacteria 4164
278 Ga0207699_10092536 3300025906 Bacteria 1901
279 Ga0207699_10466420 3300025906 Bacteria 908
280 Ga0207645_10013114 3300025907 Archaea 5599
281 Ga0207645_10041078 3300025907 Bacteria 2962
282 Ga0207643_10371850 3300025908 Archaea 900
283 Ga0207684_10004889 3300025910 Bacteria 12511
284 Ga0207684_10009009 3300025910 Bacteria 8845
285 Ga0207684_10140629 3300025910 Bacteria 2075
286 Ga0207684_10242982 3300025910 Bacteria 1553
287 Ga0207684_10278268 3300025910 Bacteria 1443
288 Ga0207684_10419561 3300025910 Bacteria 1150
289 Ga0207707_10050205 3300025912 Bacteria 3634
290 Ga0207693_10008477 3300025915 Bacteria 8413
291 Ga0207693_10028643 3300025915 Bacteria 4402
292 Ga0207693_10030637 3300025915 Bacteria 4250
293 Ga0207693_10067218 3300025915 Bacteria 2806
294 Ga0207693_10190109 3300025915 Archaea 1616
295 Ga0207693_10216706 3300025915 Bacteria 1504
296 Ga0207693_10289222 3300025915 Unclassified 1284
297 Ga0207663_10001325 3300025916 Bacteria 11448
298 Ga0207663_10018031 3300025916 Bacteria 3945
299 Ga0207663_10146402 3300025916 Bacteria 1652
300 Ga0207663_10149432 3300025916 Bacteria 1637
301 Ga0207663_10227365 3300025916 Archaea 1361
302 Ga0207649_10073223 3300025920 Archaea 2194
303 Ga0207652_10036141 3300025921 Bacteria 4176
304 Ga0207646_10000666 3300025922 Bacteria 44524
305 Ga0207646_10002017 3300025922 Bacteria 24426
306 Ga0207646_10002109 3300025922 Bacteria 23843
307 Ga0207646_10045426 3300025922 Bacteria 3943
308 Ga0207646_10054286 3300025922 Bacteria 3585
309 Ga0207646_10310288 3300025922 Unclassified 1425
310 Ga0207681_10045557 3300025923 Unclassified 2945
311 Ga0207681_10076331 3300025923 Bacteria 2353
312 Ga0207694_10168027 3300025924 Bacteria 1775
313 Ga0207650_10351556 3300025925 Archaea 1212
314 Ga0207700_10111811 3300025928 Bacteria 2199
315 Ga0207700_10120142 3300025928 Bacteria 2129
316 Ga0207700_10127938 3300025928 Bacteria 2069
317 Ga0207700_10709965 3300025928 Unclassified 898
318 Ga0207664_10693366 3300025929 Unclassified 916
319 Ga0207686_10032393 3300025934 Bacteria 3110
320 Ga0207704_10020039 3300025938 Bacteria 3529
321 Ga0207665_10051421 3300025939 Bacteria 2773
322 Ga0207665_10064006 3300025939 Bacteria 2499
323 Ga0207665_10162824 3300025939 Bacteria 1606
324 Ga0207665_10239273 3300025939 Bacteria 1337
325 Ga0207691_10002130 3300025940 Archaea 19363
326 Ga0207711_10050636 3300025941 Bacteria 3555
327 Ga0207689_10010141 3300025942 Bacteria 8121
328 Ga0207661_10352892 3300025944 Unclassified 1327
329 Ga0207679_10100101 3300025945 Archaea 2265
330 Ga0207679_10150608 3300025945 Bacteria 1893
331 Ga0207667_10052490 3300025949 Bacteria 4293
332 Ga0207712_10447407 3300025961 Bacteria 1095
333 Ga0207640_10144144 3300025981 Bacteria 1740
334 Ga0207640_10531968 3300025981 Archaea 984
335 Ga0207658_10112356 3300025986 Bacteria 2156
336 Ga0207677_10090837 3300026023 Bacteria 2220
337 Ga0207677_10149027 3300026023 Archaea 1802
338 Ga0207703_10005683 3300026035 Bacteria 10009
339 Ga0207639_10227716 3300026041 Archaea 1614
340 Ga0207639_10433548 3300026041 Unclassified 1190
341 Ga0207708_10031091 3300026075 Archaea 4051
342 Ga0207708_10091245 3300026075 Archaea 2349
343 Ga0207702_10013348 3300026078 Bacteria 6833
344 Ga0207702_10824766 3300026078 Bacteria 917
345 Ga0207641_10001476 3300026088 Bacteria 23063
346 Ga0207641_10129954 3300026088 Bacteria 2260
347 Ga0207641_10645991 3300026088 Bacteria 1039
348 Ga0207648_10013158 3300026089 Archaea 7712
349 Ga0207676_10012584 3300026095 Bacteria 6067
350 Ga0207676_10066048 3300026095 Bacteria 2883
351 Ga0207674_10018666 3300026116 Archaea 7533
352 Ga0207675_100141249 3300026118 Archaea 2288
353 Ga0207675_100202975 3300026118 Bacteria 1904
354 Ga0209973_1000118 3300027252 Archaea 4701
355 Ga0209969_1000314 3300027360 Archaea 6484
356 Ga0209967_1001571 3300027364 Archaea 2928
357 Ga0209984_1000246 3300027424 Archaea 6163
358 Ga0209999_1008360 3300027543 Archaea 1864
359 Ga0209982_1002848 3300027552 Archaea 2436
360 Ga0209982_1018127 3300027552 Archaea 1076
361 Ga0210002_1000364 3300027617 Archaea 6163
362 Ga0209983_1001650 3300027665 Archaea 4940
363 Ga0209588_1072558 3300027671 Unclassified 1112
364 Ga0209588_1075004 3300027671 Bacteria 1093
365 Ga0209588_1083611 3300027671 Bacteria 1031
366 Ga0209971_1002917 3300027682 Archaea 4085
367 Ga0209966_1013873 3300027695 Unclassified 1498
368 Ga0209998_10008763 3300027717 Archaea 2095
369 Ga0209974_10015998 3300027876 Archaea 2490
370 Ga0207428_10001113 3300027907 Archaea 29248
371 Ga0207428_10001647 3300027907 Archaea 23246
372 Ga0207428_10021911 3300027907 Archaea 5402
373 Ga0207428_10025438 3300027907 Archaea 4955
374 Ga0207428_10028821 3300027907 Archaea 4609
375 Ga0207428_10100323 3300027907 Bacteria 2237
376 Ga0268265_10015642 3300028380 Archaea 5194
377 Ga0268265_10060829 3300028380 Bacteria 2896
378 Ga0268264_10003046 3300028381 Bacteria 14528
379 Ga0268264_10086774 3300028381 Bacteria 2689
380 Ga0268264_10392084 3300028381 Archaea 1332
381 Ga0307409_100714330 3300031995 Bacteria 1003
382 Ga0373950_0030809 3300034818 Archaea 992
383 Ga0373951_0052500 3300035091 Bacteria 1006
384 Ga0373932_0096713 3300035112 Bacteria 955
385 Ga0373931_0142546 3300035691 Bacteria 1389
386 Ga0373935_0122064 3300035692 Bacteria 1742
387 Ga0373927_0003889 3300035695 Bacteria 10591
388 Ga0373927_0164525 3300035695 Archaea 1454
389 Ga0373947_0075320 3300035725 Archaea 2078
390 Ga0373925_0002855 3300037068 Bacteria 13629
391 Ga0373925_0229817 3300037068 Archaea 1483
392 Ga0395900_0003336 3300037418 Bacteria 17351
393 Ga0395898_0012084 3300037466 Bacteria 8940
394 Ga0395901_0002226 3300038443 Bacteria 19800
395 Ga0395901_0534502 3300038443 Bacteria 1190
396 Ga0453683_0410880 3300044673 Bacteria 873
397 Ga0453684_0199305 3300044712 Archaea 2335
398 Ga0453684_0409379 3300044712 Archaea 1517
399 Ga0451576_0031181 3300045051 Archaea 5686
400 Ga0495638_0004865 3300046460 Bacteria 10106
401 Ga0495580_0000365 3300046472 Bacteria 36943
402 Ga0495580_0223331 3300046472 Bacteria 1294
403 Ga0495605_0004789 3300046474 Bacteria 7912
404 Ga0495584_0027825 3300046491 Bacteria 2864
405 Ga0495584_0047338 3300046491 Bacteria 2168
406 Ga0495585_0013026 3300046492 Bacteria 4880
407 Ga0495585_0019695 3300046492 Bacteria 3888
408 Ga0495607_0050570 3300046501 Bacteria 2419
409 Ga0495607_0239962 3300046501 Bacteria 877
410 Ga0495583_0027853 3300046506 Bacteria 2784
411 Ga0495616_0033799 3300046513 Bacteria 2661
412 Ga0495630_0006530 3300046517 Bacteria 8306
413 Ga0495643_0002831 3300046522 Bacteria 13208
414 Ga0495644_0000163 3300046523 Bacteria 31558
415 Ga0495609_0003295 3300046538 Bacteria 9315
416 Ga0495633_0013593 3300046558 Bacteria 4283
417 Ga0495668_0019659 3300046616 Bacteria 3891
418 Ga0495611_0006858 3300046648 Bacteria 4840
419 Ga0495625_0050657 3300046660 Bacteria 2979
420 Ga0495625_0209857 3300046660 Bacteria 1280
421 Ga0495659_0000654 3300046664 Bacteria 12535
422 Ga0495613_0226325 3300046689 Bacteria 1311
423 Ga0495636_0000415 3300047318 Bacteria 15830
424 Ga0495636_0141227 3300047318 Bacteria 1076
425 Ga0495672_0030824 3300047320 Bacteria 3355
426 Ga0495676_0140592 3300047321 Bacteria 1731
427 Ga0495687_001223 3300047443 Bacteria 24535
428 Ga0495677_0002026 3300047445 Bacteria 8092
429 Ga0495673_0003751 3300047469 Bacteria 9863
430 Ga0495686_0090023 3300047472 Bacteria 1864
431 Ga0495614_0044091 3300048089 Bacteria 1913
432 Ga0496102_0088446 3300048905 Bacteria 2864
433 Ga0496102_0192655 3300048905 Bacteria 1921
434 Ga0496103_0106411 3300048906 Bacteria 1779
435 Ga0496104_0000019 3300048907 Bacteria 249440
436 Ga0496105_0364459 3300048908 Bacteria 1152
437 Ga0496106_0011548 3300048909 Archaea 6529
438 Ga0496106_0144055 3300048909 Unclassified 1876
439 Ga0496107_0033892 3300048910 Archaea 3655
440 Ga0496114_0141149 3300048917 Bacteria 2086
441 Ga0496115_0049716 3300048918 Bacteria 3357
442 Ga0496115_0132301 3300048918 Bacteria 2056
443 Ga0496121_0047236 3300048924 Bacteria 3675
444 Ga0496124_0295549 3300048927 Bacteria 1173
445 Ga0496126_0000095 3300048929 Bacteria 207654
446 Ga0495678_001775 3300049459 Bacteria 15966
447 Ga0495682_0000206 3300049460 Bacteria 47410
448 Ga0495682_0000923 3300049460 Bacteria 17837
449 Ga0501042_0024181 3300049578 Archaea 4260
450 Ga0501067_0101616 3300049583 Archaea 1598
451 Ga0501068_0180853 3300049584 Archaea 1333
452 Ga0501069_0191291 3300049585 Archaea 1184
453 Ga0501076_0137411 3300049592 Archaea 1985
454 Ga0501077_0199719 3300049593 Archaea 1270
455 Ga0501081_0542722 3300049743 Archaea 868
456 nmdc:mga05p37_104127_c1 3300050507 Archaea 3492
457 nmdc:mga05p37_146459_c1 3300050507 Archaea 2892
458 nmdc:mga05p37_21646_c1 3300050507 Archaea 7790
459 nmdc:mga05p37_47747_c1 3300050507 Archaea 5265
460 nmdc:mga05p37_561795_c1 3300050507 Bacteria 1296
461 nmdc:mga09592_104543_c1 3300050508 Archaea 2427
462 nmdc:mga09592_113275_c1 3300050508 Archaea 2328
463 nmdc:mga09592_120259_c1 3300050508 Archaea 2256
464 nmdc:mga09592_20604_c1 3300050508 Archaea 5424
465 nmdc:mga09592_29059_c1 3300050508 Archaea 4598
466 nmdc:mga09592_9181_c1 3300050508 Archaea 8047
467 nmdc:mga0qj67_128502_c1 3300050509 Archaea 2051
468 nmdc:mga0qj67_210433_c1 3300050509 Archaea 1580
469 nmdc:mga0qj67_55571_c1 3300050509 Archaea 3137
470 nmdc:mga06r32_203072_c1 3300050510 Archaea 1970
471 nmdc:mga06r32_21953_c1 3300050510 Archaea 5894
472 nmdc:mga06r32_23148_c1 3300050510 Archaea 5748
473 nmdc:mga06r32_266747_c1 3300050510 Archaea 1700
474 nmdc:mga06r32_299973_c1 3300050510 Archaea 1593
475 nmdc:mga06r32_602519_c1 3300050510 Archaea 1069
476 nmdc:mga06r32_92649_c1 3300050510 Archaea 2955
477 nmdc:mga08y16_19237_c1 3300050511 Archaea 7197
478 nmdc:mga08y16_35884_c1 3300050511 Archaea 5208
479 nmdc:mga08y16_443406_c1 3300050511 Archaea 1325
480 nmdc:mga08y16_49783_c1 3300050511 Bacteria 4385
481 nmdc:mga08y16_63343_c1 3300050511 Archaea 3862
482 nmdc:mga0n895_1032_c1 3300050512 Bacteria 20251
483 nmdc:mga0n895_125473_c1 3300050512 Bacteria 2590
484 nmdc:mga0n895_133701_c1 3300050512 Bacteria 2506
485 nmdc:mga0n895_1560_c1 3300050512 Bacteria 17216
486 nmdc:mga0n895_184927_c1 3300050512 Archaea 2115
487 nmdc:mga0n895_234895_c1 3300050512 Archaea 1861
488 nmdc:mga0n895_258698_c1 3300050512 Archaea 1767
489 nmdc:mga0n895_26338_c1 3300050512 Archaea 5506
490 nmdc:mga0n895_3870_c1 3300050512 Bacteria 12156
491 nmdc:mga0n895_467239_c1 3300050512 Archaea 1273
492 nmdc:mga0n895_58511_c1 3300050512 Bacteria 3800
493 nmdc:mga0n895_73733_c1 3300050512 Bacteria 3389
494 nmdc:mga0n895_766685_c1 3300050512 Bacteria 957
495 nmdc:mga0n895_8403_c1 3300050512 Bacteria 8939
496 nmdc:mga0n895_8992_c1 3300050512 Archaea 8709
497 nmdc:mga0rr50_11639_c1 3300050513 Bacteria 5642
498 nmdc:mga0rr50_1210_c1 3300050513 Bacteria 14029
499 nmdc:mga0rr50_25050_c1 3300050513 Bacteria 4143
500 nmdc:mga0rr50_322208_c1 3300050513 Bacteria 1296
501 nmdc:mga0rr50_362864_c1 3300050513 Bacteria 1219
502 nmdc:mga0rr50_493162_c1 3300050513 Bacteria 1041
503 nmdc:mga0rr50_9272_c1 3300050513 Archaea 6180
504 nmdc:mga08x19_126909_c1 3300050514 Bacteria 1714
505 nmdc:mga08x19_1329_c1 3300050514 Bacteria 15331
506 nmdc:mga08x19_17296_c1 3300050514 Bacteria 4411
507 nmdc:mga08x19_3005_c1 3300050514 Bacteria 10135
508 nmdc:mga08x19_3088_c1 3300050514 Bacteria 10009
509 nmdc:mga08x19_392830_c1 3300050514 Bacteria 972
510 nmdc:mga08x19_96744_c1 3300050514 Unclassified 1954
511 nmdc:mga0a205_12710_c1 3300050515 Archaea 7802
512 nmdc:mga0a205_173731_c1 3300050515 Bacteria 2051
513 nmdc:mga0a205_176295_c1 3300050515 Unclassified 2033
514 nmdc:mga0a205_209560_c1 3300050515 Archaea 1838
515 nmdc:mga0a205_3032_c1 3300050515 Bacteria 14885
516 nmdc:mga0a205_41600_c1 3300050515 Bacteria 4426
517 nmdc:mga0a205_54720_c1 3300050515 Archaea 3853
518 nmdc:mga0a205_73628_c1 3300050515 Archaea 3300
519 nmdc:mga0a205_834_c1 3300050515 Bacteria 25152
520 nmdc:mga0a205_96377_c1 3300050515 Unclassified 2857
521 Ga0501084_0325127 3300054114 Archaea 1299
522 Ga0501082_0072398 3300060353 Unclassified 2969
523 2585224864 2582581298 Bacteria 7315509
524 2585547420 2585427529 Bacteria 7395659
525 2644241784 2643221643 Bacteria 5749658
526 2689994413 2687453743 Bacteria 8361025
527 2819699084 2818991463 Bacteria 7948711
528 2883354951 2883354860 Bacteria 5865246
529 Ga0070676_10008094
530 2214795208
531 ARcpr5oldR_c000447
532 ARSoilYngRDRAFT_c00093
533 ARcpr5yngRDRAFT_c001510
534 ARcpr5yngRDRAFT_c003002
535 ARSoilOldRDRAFT_c000320
536 ARSoilOldRDRAFT_c000771
537 ARCol0yngRDRAFT_1000434
538 JGI25159J45721_1000648
539 rootL2_10129545
540 rootH1_10178656
541 JGI26145J50221_1000895
542 JGI25161J50226_1000114
543 Ga0055526_1002812
544 Ga0055524_1011476
545 Ga0055528_1001115
546 Ga0055543_1000077
547 Ga0065165_1029009
548 Ga0065717_1001989
549 Ga0065704_10003422
550 Ga0065704_10007418
551 Ga0065704_10016114
552 Ga0065704_10035288
553 Ga0065712_10085112
554 Ga0065712_10173012
555 Ga0065715_10012025
556 Ga0065707_10001051
557 Ga0065707_10007382
558 Ga0065707_10156202
559 Ga0065707_10172705
560 Ga0070676_10007515
561 Ga0070676_10018377
562 Ga0070683_100002340
563 Ga0070670_100026446
564 Ga0070677_10012755
565 Ga0068869_100001841
566 Ga0068869_100012860
567 Ga0068869_100024430
568 Ga0070680_100128375
569 Ga0068868_100005125
570 Ga0068868_100006665
571 Ga0068868_100033447
572 Ga0068868_100086251
573 Ga0070660_100364520
574 Ga0070692_10049800
575 Ga0070692_10210851
576 Ga0070669_100050645
577 Ga0070669_100153769
578 Ga0070675_100002506
579 Ga0070675_100116624
580 Ga0070674_100467952
581 Ga0070709_10054444
582 Ga0070709_10244247
583 Ga0070714_100060871
584 Ga0070713_100134898
585 Ga0070713_100192511
586 Ga0070710_10089251
587 Ga0070710_10118294
588 Ga0070710_10161773
589 Ga0070701_10077585
590 Ga0070711_100012005
591 Ga0070711_100066080
592 Ga0070711_100140770
593 Ga0070711_100245309
594 Ga0070700_100024231
595 Ga0070700_100106743
596 Ga0070700_100259127
597 Ga0070694_100166350
598 Ga0070708_100018782
599 Ga0070708_100116208
600 Ga0070708_100181097
601 Ga0070708_100188803
602 Ga0070708_100290340
603 Ga0070708_100399670
604 Ga0070708_100421591
605 Ga0070662_100199061
606 Ga0070681_10037396
607 Ga0068867_100045204
608 Ga0068867_100073477
609 Ga0070706_100086068
610 Ga0070706_100158016
611 Ga0070706_100308768
612 Ga0070707_100000774
613 Ga0070707_100002032
614 Ga0070707_100030452
615 Ga0070707_100168337
616 Ga0070707_100235915
617 Ga0070707_100632705
618 Ga0070698_100083219
619 Ga0070698_100131716
620 Ga0070698_100323232
621 Ga0070698_100598617
622 Ga0070698_100620574
623 Ga0070699_100043053
624 Ga0070699_100126487
625 Ga0070699_100244535
626 Ga0070699_100308841
627 Ga0070699_100367000
628 Ga0070699_100419195
629 Ga0070699_100696155
630 Ga0070679_100065514
631 Ga0070697_100007485
632 Ga0070697_100102032
633 Ga0070697_100112640
634 Ga0070697_100183014
635 Ga0070697_100205692
636 Ga0070697_100228734
637 Ga0070697_100511358
638 Ga0070672_100150916
639 Ga0070686_100129413
640 Ga0070686_100129770
641 Ga0070695_100204887
642 Ga0070695_100263881
643 Ga0070696_100089519
644 Ga0070696_100093499
645 Ga0070704_100170923
646 Ga0070704_100292448
647 Ga0068855_100002064
648 Ga0070664_100098218
649 Ga0070664_100180940
650 Ga0068857_100036585
651 Ga0068854_100137409
652 Ga0068854_100162949
653 Ga0068856_100001724
654 Ga0068856_101002028
655 Ga0068859_100092822
656 Ga0068864_100028240
657 Ga0068864_100101941
658 Ga0068864_100194176
659 Ga0068870_10003441
660 Ga0068863_100000321
661 Ga0068863_100023864
662 Ga0068863_100077762
663 Ga0068863_100323873
664 Ga0068858_100091255
665 Ga0068860_100038221
666 Ga0068860_100111326
667 Ga0068860_100398787
668 Ga0068862_100077868
669 Ga0081455_10001534
670 Ga0081455_10002540
671 Ga0070717_10080252
672 Ga0070717_10337171
673 Ga0070717_10732904
674 Ga0075432_10062885
675 Ga0075432_10065319
676 Ga0070715_10019140
677 Ga0070715_10081678
678 Ga0070716_100017076
679 Ga0070716_100090993
680 Ga0070716_100171300
681 Ga0070712_100086206
682 Ga0070712_100296940
683 Ga0097621_100000034
684 Ga0068871_100000444
685 Ga0075428_100052793
686 Ga0075428_100105820
687 Ga0075428_100446942
688 Ga0075430_100085191
689 Ga0075430_100346774
690 Ga0075431_100046441
691 Ga0075431_100068090
692 Ga0075431_100146409
693 Ga0075431_100338103
694 Ga0075431_100796028
695 Ga0075433_10005640
696 Ga0075433_10039059
697 Ga0075433_10085452
698 Ga0075433_10354391
699 Ga0075433_10482121
700 Ga0075434_100006396
701 Ga0075434_100019816
702 Ga0075434_100021955
703 Ga0075434_100027963
704 Ga0075434_100032567
705 Ga0075434_100034888
706 Ga0075434_100051230
707 Ga0075434_100072053
708 Ga0075434_100115904
709 Ga0075434_100128047
710 Ga0075434_100129644
711 Ga0075434_100299563
712 Ga0075429_100029241
713 Ga0068865_100282515
714 Ga0075436_100003135
715 Ga0075436_100034434
716 Ga0075436_100064260
717 Ga0075436_100158992
718 Ga0097620_100092814
719 Ga0075435_100008482
720 Ga0075435_100008744
721 Ga0075435_100079232
722 Ga0075435_100082952
723 Ga0075435_100204885
724 Ga0075435_100265739
725 Ga0075435_100591182
726 Ga0099794_10092637
727 Ga0099794_10172424
728 Ga0099795_10030633
729 Ga0111539_10061896
730 Ga0111539_10079812
731 Ga0111539_10764368
732 Ga0105245_10812540
733 Ga0114129_10057228
734 Ga0114129_10149811
735 Ga0114129_10168869
736 Ga0114129_10760221
737 Ga0114129_10780769
738 Ga0105241_10267691
739 Ga0105242_10051753
740 Ga0105242_10137606
741 Ga0105242_10389165
742 Ga0105248_10145020
743 Ga0105248_10424708
744 Ga0105238_10086270
745 Ga0105249_10018990
746 Ga0105249_10079804
747 Ga0105249_10248437
748 Ga0099796_10032700
749 Ga0105239_10208827
750 Ga0105239_10219360
751 Ga0105239_10313694
752 Ga0105239_10345227
753 Ga0105246_10035188
754 Ga0105246_10039821
755 Ga0105246_10187798
756 Ga0105246_10396779
757 Ga0157325_1000077
758 Ga0157322_1000735
759 Ga0157341_1000072
760 Ga0157324_1000182
761 Ga0157342_1000611
762 Ga0157327_1000057
763 Ga0157338_1000430
764 Ga0157373_10282753
765 Ga0157371_10144290
766 Ga0157369_10544444
767 Ga0157374_10000249
768 Ga0157374_10003117
769 Ga0157374_10020646
770 Ga0157378_10000008
771 Ga0157378_10006933
772 Ga0157378_10007441
773 Ga0157378_10008049
774 Ga0157378_10227910
775 Ga0163162_10123922
776 Ga0163162_10255839
777 Ga0163162_10331406
778 Ga0157372_10000436
779 Ga0157372_10660306
780 Ga0157375_10015465
781 Ga0157375_10528613
782 Ga0157375_10939668
783 Ga0157380_10203410
784 Ga0157377_10000847
785 Ga0157377_10001065
786 Ga0157379_10209472
787 Ga0157376_10099250
788 Ga0157376_10199942
789 Ga0209436_100050
790 Ga0209129_1002867
791 Ga0209673_1002867
792 Ga0209130_1000030
793 Ga0209564_1000364
794 Ga0209256_1002320
795 Ga0207426_1000047
796 Ga0209257_1020897
797 Ga0207682_10173914
798 Ga0207692_10018973
799 Ga0207692_10179888
800 Ga0207642_10167499
801 Ga0207647_10009331
802 Ga0207647_10012127
803 Ga0207647_10013071
804 Ga0207685_10215240
805 Ga0207699_10013650
806 Ga0207699_10092536
807 Ga0207699_10466420
808 Ga0207645_10013114
809 Ga0207645_10041078
810 Ga0207643_10371850
811 Ga0207684_10004889
812 Ga0207684_10009009
813 Ga0207684_10140629
814 Ga0207684_10242982
815 Ga0207684_10278268
816 Ga0207684_10419561
817 Ga0207707_10050205
818 Ga0207693_10008477
819 Ga0207693_10028643
820 Ga0207693_10030637
821 Ga0207693_10067218
822 Ga0207693_10190109
823 Ga0207693_10216706
824 Ga0207693_10289222
825 Ga0207663_10001325
826 Ga0207663_10018031
827 Ga0207663_10146402
828 Ga0207663_10149432
829 Ga0207663_10227365
830 Ga0207649_10073223
831 Ga0207652_10036141
832 Ga0207646_10000666
833 Ga0207646_10002017
834 Ga0207646_10002109
835 Ga0207646_10045426
836 Ga0207646_10054286
837 Ga0207646_10310288
838 Ga0207681_10045557
839 Ga0207681_10076331
840 Ga0207694_10168027
841 Ga0207650_10351556
842 Ga0207700_10111811
843 Ga0207700_10120142
844 Ga0207700_10127938
845 Ga0207700_10709965
846 Ga0207664_10693366
847 Ga0207686_10032393
848 Ga0207704_10020039
849 Ga0207665_10051421
850 Ga0207665_10064006
851 Ga0207665_10162824
852 Ga0207665_10239273
853 Ga0207691_10002130
854 Ga0207711_10050636
855 Ga0207689_10010141
856 Ga0207661_10352892
857 Ga0207679_10100101
858 Ga0207679_10150608
859 Ga0207667_10052490
860 Ga0207712_10447407
861 Ga0207640_10144144
862 Ga0207640_10531968
863 Ga0207658_10112356
864 Ga0207677_10090837
865 Ga0207677_10149027
866 Ga0207703_10005683
867 Ga0207639_10227716
868 Ga0207639_10433548
869 Ga0207708_10031091
870 Ga0207708_10091245
871 Ga0207702_10013348
872 Ga0207702_10824766
873 Ga0207641_10001476
874 Ga0207641_10129954
875 Ga0207641_10645991
876 Ga0207648_10013158
877 Ga0207676_10012584
878 Ga0207676_10066048
879 Ga0207674_10018666
880 Ga0207675_100141249
881 Ga0207675_100202975
882 Ga0209973_1000118
883 Ga0209969_1000314
884 Ga0209967_1001571
885 Ga0209984_1000246
886 Ga0209999_1008360
887 Ga0209982_1002848
888 Ga0209982_1018127
889 Ga0210002_1000364
890 Ga0209983_1001650
891 Ga0209588_1072558
892 Ga0209588_1075004
893 Ga0209588_1083611
894 Ga0209971_1002917
895 Ga0209966_1013873
896 Ga0209998_10008763
897 Ga0209974_10015998
898 Ga0207428_10001113
899 Ga0207428_10001647
900 Ga0207428_10021911
901 Ga0207428_10025438
902 Ga0207428_10028821
903 Ga0207428_10100323
904 Ga0268265_10015642
905 Ga0268265_10060829
906 Ga0268264_10003046
907 Ga0268264_10086774
908 Ga0268264_10392084
909 Ga0307409_100714330
910 Ga0373950_0030809
911 Ga0373951_0052500
912 Ga0373932_0096713
913 Ga0373931_0142546
914 Ga0373935_0122064
915 Ga0373927_0003889
916 Ga0373927_0164525
917 Ga0373947_0075320
918 Ga0373925_0002855
919 Ga0373925_0229817
920 Ga0395900_0003336
921 Ga0395898_0012084
922 Ga0395901_0002226
923 Ga0395901_0534502
924 Ga0453683_0410880
925 Ga0453684_0199305
926 Ga0453684_0409379
927 Ga0451576_0031181
928 Ga0495638_0004865
929 Ga0495580_0000365
930 Ga0495580_0223331
931 Ga0495605_0004789
932 Ga0495584_0027825
933 Ga0495584_0047338
934 Ga0495585_0013026
935 Ga0495585_0019695
936 Ga0495607_0050570
937 Ga0495607_0239962
938 Ga0495583_0027853
939 Ga0495616_0033799
940 Ga0495630_0006530
941 Ga0495643_0002831
942 Ga0495644_0000163
943 Ga0495609_0003295
944 Ga0495633_0013593
945 Ga0495668_0019659
946 Ga0495611_0006858
947 Ga0495625_0050657
948 Ga0495625_0209857
949 Ga0495659_0000654
950 Ga0495613_0226325
951 Ga0495636_0000415
952 Ga0495636_0141227
953 Ga0495672_0030824
954 Ga0495676_0140592
955 Ga0495687_001223
956 Ga0495677_0002026
957 Ga0495673_0003751
958 Ga0495686_0090023
959 Ga0495614_0044091
960 Ga0496102_0088446
961 Ga0496102_0192655
962 Ga0496103_0106411
963 Ga0496104_0000019
964 Ga0496105_0364459
965 Ga0496106_0011548
966 Ga0496106_0144055
967 Ga0496107_0033892
968 Ga0496114_0141149
969 Ga0496115_0049716
970 Ga0496115_0132301
971 Ga0496121_0047236
972 Ga0496124_0295549
973 Ga0496126_0000095
974 Ga0495678_001775
975 Ga0495682_0000206
976 Ga0495682_0000923
977 Ga0501042_0024181
978 Ga0501067_0101616
979 Ga0501068_0180853
980 Ga0501069_0191291
981 Ga0501076_0137411
982 Ga0501077_0199719
983 Ga0501081_0542722
984 nmdc:mga05p37_104127_c1
985 nmdc:mga05p37_146459_c1
986 nmdc:mga05p37_21646_c1
987 nmdc:mga05p37_47747_c1
988 nmdc:mga05p37_561795_c1
989 nmdc:mga09592_104543_c1
990 nmdc:mga09592_113275_c1
991 nmdc:mga09592_120259_c1
992 nmdc:mga09592_20604_c1
993 nmdc:mga09592_29059_c1
994 nmdc:mga09592_9181_c1
995 nmdc:mga0qj67_128502_c1
996 nmdc:mga0qj67_210433_c1
997 nmdc:mga0qj67_55571_c1
998 nmdc:mga06r32_203072_c1
999 nmdc:mga06r32_21953_c1
1000 nmdc:mga06r32_23148_c1
1001 nmdc:mga06r32_266747_c1
1002 nmdc:mga06r32_299973_c1
1003 nmdc:mga06r32_602519_c1
1004 nmdc:mga06r32_92649_c1
1005 nmdc:mga08y16_19237_c1
1006 nmdc:mga08y16_35884_c1
1007 nmdc:mga08y16_443406_c1
1008 nmdc:mga08y16_49783_c1
1009 nmdc:mga08y16_63343_c1
1010 nmdc:mga0n895_1032_c1
1011 nmdc:mga0n895_125473_c1
1012 nmdc:mga0n895_133701_c1
1013 nmdc:mga0n895_1560_c1
1014 nmdc:mga0n895_184927_c1
1015 nmdc:mga0n895_234895_c1
1016 nmdc:mga0n895_258698_c1
1017 nmdc:mga0n895_26338_c1
1018 nmdc:mga0n895_3870_c1
1019 nmdc:mga0n895_467239_c1
1020 nmdc:mga0n895_58511_c1
1021 nmdc:mga0n895_73733_c1
1022 nmdc:mga0n895_766685_c1
1023 nmdc:mga0n895_8403_c1
1024 nmdc:mga0n895_8992_c1
1025 nmdc:mga0rr50_11639_c1
1026 nmdc:mga0rr50_1210_c1
1027 nmdc:mga0rr50_25050_c1
1028 nmdc:mga0rr50_322208_c1
1029 nmdc:mga0rr50_362864_c1
1030 nmdc:mga0rr50_493162_c1
1031 nmdc:mga0rr50_9272_c1
1032 nmdc:mga08x19_126909_c1
1033 nmdc:mga08x19_1329_c1
1034 nmdc:mga08x19_17296_c1
1035 nmdc:mga08x19_3005_c1
1036 nmdc:mga08x19_3088_c1
1037 nmdc:mga08x19_392830_c1
1038 nmdc:mga08x19_96744_c1
1039 nmdc:mga0a205_12710_c1
1040 nmdc:mga0a205_173731_c1
1041 nmdc:mga0a205_176295_c1
1042 nmdc:mga0a205_209560_c1
1043 nmdc:mga0a205_3032_c1
1044 nmdc:mga0a205_41600_c1
1045 nmdc:mga0a205_54720_c1
1046 nmdc:mga0a205_73628_c1
1047 nmdc:mga0a205_834_c1
1048 nmdc:mga0a205_96377_c1
1049 Ga0501084_0325127
1050 Ga0501082_0072398
1051 2585224864
1052 2585547420
1053 2644241784
1054 2689994413
1055 2819699084
1056 2883354951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

72

261

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

78

320

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

74

267

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h16-assembly1.cif.gz_A crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p6422 0.9571 12 265
4h16-assembly1.cif.gz_A crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p6422 0.9354 12 265
2fwm-assembly1.cif.gz_X crystal structure of e. coli enta, a 2,3-dihydrodihydroxy benzoate dehydrogenase 0.9298 12 261
8u9a-assembly1.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (dbh bound) 0.9265 12 261
8sbw-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.926 12 261
ID Description Score Start End Superfamily
4h16A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9592 12 265 3.40.50.720
4h16A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 12 265 3.40.50.720
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9298 12 261 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9102 13 262 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.91 11 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2H9VPN8-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9379 1 265 GO:0016616
AF-A0A2H9VPN8-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.931 1 265 GO:0016616
AF-A0A831VBE3-F1-model_v4 SDR family oxidoreductase 0.918 60 265
AF-A0A7Y2L4Z9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9168 8 162 GO:0016616
GO:0030497
AF-A0A354VLQ3-F1-model_v4 deleted 0.9168 8 187

Map