F459538

General Info

Members Datasets Scaffolds Average Seq Length
527 311 1054 265

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10056500|Ga0182008_100565003
Length 278
Sequence VKQKKNSQERRNMSDILDKIMAVKRQEIAAAQKKSPLEAVRFDAESRVLTRDFEGALRARIAAGHAAVIAEVKKASPSKGVLREDFIPADIAQSYAEGDGEISAACLSVLTDKQFFQGGVDYLKQARASCDLPVLRKDFIVDAYQVYESRAMGADAVLLIAACLDDAQMKDYEAIARGLGMAVLVEVHDAAELERALKLKTPLIGVNNRNLRNFEVSIQATIDLLPRLPADRLAVTESGIATREDVATLRAAGVHAFLVGEAFMRAKEPGEALAALFK

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
119 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
120 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
121 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
122 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
123 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
166 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
170 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
174 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
246 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
250 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
263 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
264 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
265 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
266 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
267 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
268 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
269 2643221570 Acidovorax sp. Root568 Isolate Unclassified
270 2643221596 Acidovorax sp. Root70 Isolate Unclassified
271 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
272 2643221658 Variovorax sp. Root411 Isolate Unclassified
273 2643221672 Variovorax sp. Root434 Isolate Unclassified
274 2643221683 Variovorax sp. Root473 Isolate Unclassified
275 2738541277 Variovorax sp. GV051 Isolate Unclassified
276 2738541307 Variovorax sp. GV008 Isolate Unclassified
277 2738543019 Variovorax sp. GV040 Isolate Unclassified
278 2816332133 Acidovorax radicis 2721A Isolate Unclassified
279 2818991446 Variovorax sp. 1180 Isolate Unclassified
280 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
281 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
282 2842677519 Variovorax sp. R-72495 Isolate Unclassified
283 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
284 2842733646 Variovorax sp. R-72446 Isolate Unclassified
285 2842747753 Variovorax sp. R-72060 Isolate Unclassified
286 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
287 2885198086 Variovorax sp. 679 Isolate Unclassified
288 2885211737 Variovorax sp. 553 Isolate Unclassified
289 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
290 2899924645 Variovorax sp. 369 Isolate Unclassified
291 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
292 2904456579 Variovorax sp. 2002 Isolate Unclassified
293 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
294 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
295 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
296 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
297 2928037797 Variovorax sp. 1126 Isolate Unclassified
298 2928044640 Variovorax sp. 1128 Isolate Unclassified
299 2928051484 Variovorax sp. 1133 Isolate Unclassified
300 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
301 2928070936 Variovorax gossypii 1167 Isolate Unclassified
302 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
303 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
304 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
305 2929520902 Variovorax beijingensis 502 Isolate Unclassified
306 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
307 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
308 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
309 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
310 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
311 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.75
Metatranscriptomes 0.76
Isolates 9.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.18
Nodule 0.95
Rhizoplane 2.66
Rhizosphere 40.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10056500 3300014497 Bacteria 1939
2 JGI25155J39150_1000106 3300002704 Bacteria 44262
3 JGI25156J39149_1000024 3300002705 Bacteria 141748
4 JGI25154J39366_1000043 3300002738 Bacteria 142417
5 JGI25157J39369_1000031 3300002741 Bacteria 141953
6 JGI25152J39213_1009129 3300002773 Bacteria 2385
7 JGI25152J39213_1009340 3300002773 Bacteria 2337
8 JGI25150J39212_1005111 3300002774 Bacteria 2834
9 JGI25150J39212_1010048 3300002774 Bacteria 1775
10 JGI25159J45721_1000371 3300002987 Bacteria 20825
11 JGI25159J45721_1001251 3300002987 Bacteria 10713
12 JGI25159J45721_1004361 3300002987 Bacteria 4716
13 JGI25159J45721_1010337 3300002987 Bacteria 2385
14 JGI25151J46595_10001261 3300003187 Bacteria 17933
15 JGI25151J46595_10007970 3300003187 Bacteria 5136
16 JGI25151J46595_10016514 3300003187 Bacteria 3226
17 JGI25151J46595_10018410 3300003187 Bacteria 2999
18 JGI25151J46595_10025532 3300003187 Bacteria 2402
19 JGI25151J46595_10025775 3300003187 Bacteria 2385
20 JGI25151J46595_10026511 3300003187 Bacteria 2337
21 JGI25153J46596_10017497 3300003215 Bacteria 2822
22 JGI25153J46596_10022319 3300003215 Bacteria 2337
23 rootH2_10048172 3300003320 Bacteria 2093
24 JGI25160J50197_1000276 3300003354 Bacteria 37602
25 JGI25160J50197_1004789 3300003354 Bacteria 5772
26 JGI25160J50197_1016432 3300003354 Bacteria 2385
27 JGI25161J50226_1000021 3300003374 Bacteria 163584
28 JGI25161J50226_1004872 3300003374 Bacteria 2730
29 JGI25161J50226_1005699 3300003374 Bacteria 2368
30 Ga0006562J51391_1004331 3300003578 Bacteria 3872
31 Ga0006562J51391_1004334 3300003578 Bacteria 7020
32 Ga0055535_1004285 3300003761 Bacteria 3531
33 Ga0055542_1000301 3300003762 Bacteria 54975
34 Ga0055526_1005008 3300003771 Bacteria 7750
35 Ga0055526_1020190 3300003771 Bacteria 2385
36 Ga0055526_1020192 3300003771 Bacteria 2385
37 Ga0055537_1000230 3300003773 Bacteria 40840
38 Ga0055537_1000418 3300003773 Bacteria 27742
39 Ga0055537_1002775 3300003773 Bacteria 5644
40 Ga0055537_1008408 3300003773 Bacteria 2385
41 Ga0055537_1009090 3300003773 Bacteria 2226
42 Ga0055537_1009091 3300003773 Bacteria 2226
43 Ga0055524_1000039 3300003775 Bacteria 159897
44 Ga0055524_1018815 3300003775 Bacteria 2385
45 Ga0055524_1018817 3300003775 Bacteria 2385
46 Ga0055536_1006928 3300003781 Bacteria 5165
47 Ga0055536_1007839 3300003781 Bacteria 4704
48 Ga0055536_1014289 3300003781 Bacteria 2801
49 Ga0055536_1015681 3300003781 Bacteria 2577
50 Ga0055536_1016979 3300003781 Bacteria 2405
51 Ga0055534_1001835 3300003784 Bacteria 7931
52 Ga0055534_1002741 3300003784 Bacteria 5918
53 Ga0055534_1008223 3300003784 Bacteria 2385
54 Ga0055534_1008497 3300003784 Bacteria 2318
55 Ga0055528_1003778 3300003790 Bacteria 7465
56 Ga0055528_1015662 3300003790 Bacteria 2726
57 Ga0055528_1018254 3300003790 Bacteria 2385
58 Ga0055528_1019658 3300003790 Bacteria 2226
59 Ga0055528_1019660 3300003790 Bacteria 2226
60 Ga0055528_1030300 3300003790 Bacteria 1439
61 Ga0055530_10002833 3300003791 Bacteria 10616
62 Ga0055530_10004496 3300003791 Bacteria 7149
63 Ga0055530_10013905 3300003791 Bacteria 2716
64 Ga0055540_1000047 3300003792 Bacteria 146914
65 Ga0055540_1005380 3300003792 Bacteria 5407
66 Ga0055540_1005543 3300003792 Bacteria 5275
67 Ga0055540_1005738 3300003792 Bacteria 5117
68 Ga0055540_1012265 3300003792 Bacteria 2702
69 Ga0055540_1014215 3300003792 Bacteria 2385
70 Ga0055531_10008997 3300003794 Bacteria 5165
71 Ga0055531_10009109 3300003794 Bacteria 5119
72 Ga0055531_10022652 3300003794 Bacteria 2385
73 Ga0055543_1000701 3300004625 Bacteria 17085
74 Ga0055543_1002717 3300004625 Bacteria 5651
75 Ga0065165_1012745 3300005262 Bacteria 3399
76 Ga0065165_1012746 3300005262 Bacteria 3399
77 Ga0065165_1019450 3300005262 Bacteria 2423
78 Ga0065704_10122814 3300005289 Bacteria 1743
79 Ga0070666_10121053 3300005335 Bacteria 1815
80 Ga0070666_10172948 3300005335 Bacteria 1513
81 Ga0070661_100081621 3300005344 Bacteria 2387
82 Ga0070669_100026536 3300005353 Bacteria 4167
83 Ga0070659_100079319 3300005366 Bacteria 2620
84 Ga0070662_100241132 3300005457 Bacteria 1450
85 Ga0070706_100108375 3300005467 Bacteria 2584
86 Ga0068853_100128480 3300005539 Bacteria 2266
87 Ga0070664_100005763 3300005564 Bacteria 9989
88 Ga0068857_100193107 3300005577 Bacteria 1855
89 Ga0068852_100117300 3300005616 Bacteria 2430
90 Ga0068859_100430773 3300005617 Bacteria 1415
91 Ga0068864_100028078 3300005618 Bacteria 4755
92 Ga0075365_10071282 3300006038 Bacteria 2339
93 Ga0075365_10171184 3300006038 Bacteria 1516
94 Ga0075363_100010202 3300006048 Bacteria 4446
95 Ga0075363_100068660 3300006048 Bacteria 1922
96 Ga0075364_10056669 3300006051 Bacteria 2566
97 Ga0075364_10222643 3300006051 Bacteria 1281
98 Ga0075432_10011363 3300006058 Bacteria 3024
99 Ga0075362_10004139 3300006177 Bacteria 5175
100 Ga0075362_10022501 3300006177 Bacteria 2656
101 Ga0075362_10035041 3300006177 Bacteria 2190
102 Ga0075362_10039523 3300006177 Bacteria 2074
103 Ga0075367_10106301 3300006178 Bacteria 1719
104 Ga0075366_10009581 3300006195 Bacteria 5410
105 Ga0075366_10065153 3300006195 Bacteria 2167
106 Ga0075366_10215355 3300006195 Bacteria 1170
107 Ga0097621_100145967 3300006237 Bacteria 2026
108 Ga0097621_100489309 3300006237 Bacteria 1113
109 Ga0075370_10009012 3300006353 Bacteria 5160
110 Ga0075370_10017449 3300006353 Bacteria 3880
111 Ga0075370_10061369 3300006353 Bacteria 2141
112 Ga0075370_10082784 3300006353 Bacteria 1846
113 Ga0097620_100430784 3300006931 Bacteria 1415
114 Ga0099826_10018166 3300006948 Bacteria 5313
115 Ga0099826_10038002 3300006948 Bacteria 3386
116 Ga0105244_10032770 3300009036 Bacteria 2746
117 Ga0105240_10182998 3300009093 Bacteria 2471
118 Ga0105243_10002392 3300009148 Bacteria 15724
119 Ga0105243_10083074 3300009148 Bacteria 2619
120 Ga0105243_10110976 3300009148 Bacteria 2295
121 Ga0105242_10557794 3300009176 Bacteria 1099
122 Ga0105237_10043079 3300009545 Bacteria 4549
123 Ga0105239_10281712 3300010375 Bacteria 1871
124 Ga0105246_10369138 3300011119 Bacteria 1182
125 Ga0157347_1000608 3300012502 Bacteria 2424
126 Ga0157373_10101553 3300013100 Bacteria 2024
127 Ga0157373_10203560 3300013100 Bacteria 1395
128 Ga0157371_10078527 3300013102 Bacteria 2338
129 Ga0157370_10010303 3300013104 Bacteria 9858
130 Ga0157369_10007891 3300013105 Bacteria 12238
131 Ga0157372_10312918 3300013307 Bacteria 1828
132 Ga0157375_10401772 3300013308 Bacteria 1537
133 Ga0182008_10007777 3300014497 Bacteria 5897
134 Ga0182008_10015084 3300014497 Bacteria 4040
135 Ga0182008_10019549 3300014497 Bacteria 3495
136 Ga0182008_10049959 3300014497 Bacteria 2076
137 Ga0182006_1007691 3300015261 Bacteria 4922
138 Ga0182006_1028001 3300015261 Bacteria 2295
139 Ga0182007_10006641 3300015262 Bacteria 4951
140 Ga0163161_10008429 3300017792 Bacteria 7136
141 Ga0163161_10012393 3300017792 Bacteria 5919
142 Ga0163161_10059706 3300017792 Bacteria 2774
143 Ga0213872_10012990 3300021361 Bacteria 3904
144 Ga0209435_100008 3300025206 Bacteria 503644
145 Ga0209436_105594 3300025208 Bacteria 2863
146 Ga0209436_108251 3300025208 Bacteria 2091
147 Ga0209436_111973 3300025208 Bacteria 1494
148 Ga0209672_101179 3300025228 Bacteria 10647
149 Ga0209258_100020 3300025242 Bacteria 565241
150 Ga0207425_1003159 3300025245 Bacteria 5390
151 Ga0207425_1007445 3300025245 Bacteria 2886
152 Ga0207425_1017653 3300025245 Bacteria 1562
153 Ga0209646_1000079 3300025246 Bacteria 207677
154 Ga0209026_1000067 3300025250 Bacteria 207677
155 Ga0209148_1000031 3300025254 Bacteria 564601
156 Ga0209759_1000056 3300025256 Bacteria 207677
157 Ga0209129_1000277 3300025258 Bacteria 49016
158 Ga0209129_1006779 3300025258 Bacteria 3598
159 Ga0209129_1013597 3300025258 Bacteria 1782
160 Ga0209565_1000070 3300025263 Bacteria 168957
161 Ga0209565_1000080 3300025263 Bacteria 156999
162 Ga0209565_1000465 3300025263 Bacteria 30541
163 Ga0209565_1000746 3300025263 Bacteria 19208
164 Ga0209565_1007676 3300025263 Bacteria 2886
165 Ga0209565_1009627 3300025263 Bacteria 2437
166 Ga0209673_1000088 3300025273 Bacteria 204629
167 Ga0209673_1000518 3300025273 Bacteria 63151
168 Ga0209673_1006336 3300025273 Bacteria 5735
169 Ga0209673_1017034 3300025273 Bacteria 2691
170 Ga0209673_1021229 3300025273 Bacteria 2277
171 Ga0209130_1000949 3300025284 Bacteria 22975
172 Ga0209130_1001036 3300025284 Bacteria 21242
173 Ga0209130_1003234 3300025284 Bacteria 7150
174 Ga0209130_1003468 3300025284 Bacteria 6669
175 Ga0209130_1011052 3300025284 Bacteria 2437
176 Ga0209675_1000069 3300025291 Bacteria 170538
177 Ga0209675_1000278 3300025291 Bacteria 48974
178 Ga0209675_1002333 3300025291 Bacteria 9806
179 Ga0209675_1002726 3300025291 Bacteria 8845
180 Ga0209675_1010677 3300025291 Bacteria 3113
181 Ga0209675_1014654 3300025291 Bacteria 2374
182 Ga0209675_1014893 3300025291 Bacteria 2340
183 Ga0209675_1015696 3300025291 Bacteria 2237
184 Ga0209676_1000073 3300025292 Bacteria 305947
185 Ga0209676_1000195 3300025292 Bacteria 135920
186 Ga0209676_1002376 3300025292 Bacteria 13516
187 Ga0209676_1004350 3300025292 Bacteria 7935
188 Ga0209676_1006675 3300025292 Bacteria 5624
189 Ga0209676_1018274 3300025292 Bacteria 2450
190 Ga0209676_1042298 3300025292 Bacteria 1266
191 Ga0209025_1000526 3300025294 Bacteria 72957
192 Ga0209025_1000940 3300025294 Bacteria 44330
193 Ga0209025_1002510 3300025294 Bacteria 19216
194 Ga0209025_1010190 3300025294 Bacteria 6413
195 Ga0209025_1010784 3300025294 Bacteria 6140
196 Ga0209025_1025885 3300025294 Bacteria 2968
197 Ga0209025_1030703 3300025294 Bacteria 2564
198 Ga0209025_1032494 3300025294 Bacteria 2437
199 Ga0209564_1000101 3300025295 Bacteria 222879
200 Ga0209564_1001748 3300025295 Bacteria 20323
201 Ga0209564_1001835 3300025295 Bacteria 19455
202 Ga0209564_1002907 3300025295 Bacteria 12475
203 Ga0209564_1020317 3300025295 Bacteria 2437
204 Ga0209564_1033977 3300025295 Bacteria 1505
205 Ga0209758_1000127 3300025297 Bacteria 189368
206 Ga0209758_1037399 3300025297 Bacteria 1877
207 Ga0209050_1000008 3300025298 Bacteria 1144179
208 Ga0209050_1000021 3300025298 Bacteria 574406
209 Ga0209050_1001285 3300025298 Bacteria 28571
210 Ga0209050_1007150 3300025298 Bacteria 6361
211 Ga0209050_1007364 3300025298 Bacteria 6188
212 Ga0209050_1049021 3300025298 Bacteria 1086
213 Ga0209256_1000096 3300025299 Bacteria 204629
214 Ga0209256_1000104 3300025299 Bacteria 189367
215 Ga0209256_1017050 3300025299 Bacteria 2437
216 Ga0207426_1000149 3300025302 Bacteria 189367
217 Ga0207426_1000731 3300025302 Bacteria 37628
218 Ga0207426_1000808 3300025302 Bacteria 33859
219 Ga0207426_1010080 3300025302 Bacteria 3693
220 Ga0209051_1000005 3300025303 Bacteria 1142353
221 Ga0209051_1000028 3300025303 Bacteria 404269
222 Ga0209051_1000184 3300025303 Bacteria 112134
223 Ga0209051_1003269 3300025303 Bacteria 10749
224 Ga0209051_1008100 3300025303 Bacteria 5619
225 Ga0209051_1012688 3300025303 Bacteria 4059
226 Ga0209051_1022749 3300025303 Bacteria 2628
227 Ga0209257_1000031 3300025304 Bacteria 688770
228 Ga0209257_1000889 3300025304 Bacteria 41956
229 Ga0209257_1006599 3300025304 Bacteria 7395
230 Ga0209257_1008006 3300025304 Bacteria 6171
231 Ga0209257_1008770 3300025304 Bacteria 5619
232 Ga0209257_1010658 3300025304 Bacteria 4597
233 Ga0207656_10013690 3300025321 Bacteria 3106
234 Ga0207655_1003947 3300025728 Bacteria 10757
235 Ga0207688_10120258 3300025901 Bacteria 1532
236 Ga0207649_10079640 3300025920 Bacteria 2117
237 Ga0207681_10005589 3300025923 Bacteria 7722
238 Ga0207706_10405699 3300025933 Bacteria 1181
239 Ga0207709_10001520 3300025935 Bacteria 16003
240 Ga0207709_10050274 3300025935 Bacteria 2549
241 Ga0207709_10078154 3300025935 Bacteria 2123
242 Ga0207679_10034475 3300025945 Bacteria 3571
243 Ga0207667_10121226 3300025949 Bacteria 2694
244 Ga0207640_10019038 3300025981 Bacteria 4048
245 Ga0207658_10174615 3300025986 Bacteria 1773
246 Ga0207677_10435517 3300026023 Bacteria 1120
247 Ga0207639_10104927 3300026041 Bacteria 2292
248 Ga0207639_10129712 3300026041 Bacteria 2085
249 Ga0207702_10521303 3300026078 Bacteria 1160
250 Ga0207676_10102373 3300026095 Bacteria 2377
251 Ga0207674_10130868 3300026116 Bacteria 2472
252 Ga0207674_10433797 3300026116 Bacteria 1270
253 Ga0209970_1000292 3300027614 Bacteria 8228
254 Ga0209983_1014182 3300027665 Bacteria 1642
255 Ga0209282_1053909 3300027666 Bacteria 2286
256 Ga0209971_1007151 3300027682 Bacteria 2646
257 Ga0209998_10006425 3300027717 Bacteria 2441
258 Ga0209974_10000744 3300027876 Bacteria 11146
259 Ga0209974_10004724 3300027876 Bacteria 4836
260 Ga0209974_10092304 3300027876 Bacteria 1051
261 Ga0207428_10082406 3300027907 Bacteria 2510
262 Ga0268266_10113255 3300028379 Bacteria 2405
263 Ga0307515_10002595 3300028794 Bacteria 38945
264 Ga0307515_10199897 3300028794 Bacteria 1878
265 Ga0307515_10213165 3300028794 Bacteria 1770
266 Ga0316177_1017951 3300030731 Bacteria 4695
267 Ga0316176_1211419 3300030732 Bacteria 2846
268 Ga0314311_1098150 3300030733 Bacteria 2409
269 Ga0316179_1109674 3300030734 Bacteria 1891
270 Ga0316178_1058202 3300030735 Bacteria 2673
271 Ga0316180_1005383 3300030736 Bacteria 2713
272 Ga0316183_1038041 3300030742 Bacteria 6683
273 Ga0316181_1098684 3300030744 Bacteria 2694
274 Ga0316182_1271523 3300030745 Bacteria 4376
275 Ga0316182_1408608 3300030745 Bacteria 2236
276 Ga0265330_10000012 3300031235 Bacteria 180837
277 Ga0265332_10000012 3300031238 Bacteria 272641
278 Ga0265328_10032672 3300031239 Bacteria 1930
279 Ga0265325_10003322 3300031241 Bacteria 10577
280 Ga0265340_10030519 3300031247 Bacteria 2701
281 Ga0265327_10000674 3300031251 Bacteria 54882
282 Ga0265327_10044669 3300031251 Bacteria 2360
283 Ga0307513_10001864 3300031456 Bacteria 29946
284 Ga0307513_10047429 3300031456 Bacteria 4674
285 Ga0307513_10154649 3300031456 Bacteria 2196
286 Ga0307408_100009731 3300031548 Bacteria 6334
287 Ga0307408_100012534 3300031548 Bacteria 5619
288 Ga0307408_100033702 3300031548 Bacteria 3580
289 Ga0307408_100086250 3300031548 Bacteria 2359
290 Ga0307408_100407170 3300031548 Bacteria 1169
291 Ga0307508_10003800 3300031616 Bacteria 15074
292 Ga0307514_10020016 3300031649 Bacteria 5469
293 Ga0307514_10023788 3300031649 Bacteria 4966
294 Ga0265314_10000029 3300031711 Bacteria 272506
295 Ga0307516_10000506 3300031730 Bacteria 51918
296 Ga0307516_10001680 3300031730 Bacteria 30456
297 Ga0307405_10025900 3300031731 Bacteria 3373
298 Ga0307405_10093513 3300031731 Bacteria 1997
299 Ga0307405_10164294 3300031731 Bacteria 1576
300 Ga0307405_10184586 3300031731 Bacteria 1500
301 Ga0307405_10434738 3300031731 Bacteria 1036
302 Ga0307406_10008625 3300031901 Bacteria 5694
303 Ga0307406_10075307 3300031901 Bacteria 2226
304 Ga0307412_10007404 3300031911 Bacteria 6225
305 Ga0307412_10082749 3300031911 Bacteria 2223
306 Ga0307412_10359026 3300031911 Bacteria 1172
307 Ga0307416_100005418 3300032002 Bacteria 7833
308 Ga0307416_100021195 3300032002 Bacteria 4660
309 Ga0307414_10073291 3300032004 Bacteria 2476
310 Ga0307414_10791806 3300032004 Bacteria 864
311 Ga0307411_10012293 3300032005 Bacteria 4664
312 Ga0307411_10404447 3300032005 Bacteria 1129
313 Ga0316593_10026749 3300032168 Bacteria 1846
314 Ga0307507_10036736 3300033179 Bacteria 5001
315 Ga0316596_1011760 3300033541 Bacteria 2144
316 Ga0316574_0003658 3300035398 Bacteria 7961
317 Ga0316574_0011017 3300035398 Bacteria 5127
318 Ga0316584_0038240 3300036712 Bacteria 3568
319 Ga0316584_0149866 3300036712 Bacteria 1736
320 Ga0400485_11271 3300038735 Bacteria 1930
321 Ga0400486_19710 3300038742 Bacteria 4349
322 Ga0436361_0677039 3300039447 Bacteria 4211
323 Ga0436361_0963032 3300039447 Bacteria 2798
324 Ga0439447_014619 3300041407 Bacteria 2197
325 Ga0439466_0004881 3300041411 Bacteria 5155
326 Ga0439466_0014801 3300041411 Bacteria 2837
327 Ga0439465_0008505 3300041413 Bacteria 3238
328 Ga0451789_1013970 3300041443 Bacteria 2229
329 Ga0439431_0008281 3300041997 Bacteria 2335
330 Ga0439431_0017737 3300041997 Bacteria 1677
331 Ga0439442_009395 3300042002 Bacteria 1979
332 Ga0439445_0005887 3300042004 Bacteria 2805
333 Ga0439432_016028 3300042006 Bacteria 2525
334 Ga0439449_0015777 3300042007 Bacteria 2839
335 Ga0439449_0023958 3300042007 Bacteria 2282
336 Ga0439452_005229 3300042010 Bacteria 4212
337 Ga0439457_008101 3300042014 Bacteria 2491
338 Ga0439462_0047961 3300042015 Bacteria 1145
339 Ga0450919_004221 3300042121 Bacteria 1762
340 Ga0450920_005009 3300042122 Bacteria 2347
341 Ga0450923_005993 3300042125 Bacteria 1990
342 Ga0450898_004347 3300042134 Bacteria 2090
343 Ga0450906_011389 3300042145 Bacteria 1664
344 Ga0450907_015669 3300042146 Bacteria 1265
345 Ga0439446_0036155 3300042156 Bacteria 1442
346 Ga0450908_020469 3300042184 Bacteria 1162
347 Ga0450909_003065 3300042185 Bacteria 2375
348 Ga0450893_0016322 3300042532 Bacteria 1257
349 Ga0451577_0000093 3300042876 Bacteria 196838
350 Ga0451577_0014449 3300042876 Bacteria 7361
351 Ga0453683_0007761 3300044673 Bacteria 7255
352 Ga0466965_0020012 3300044683 Bacteria 3215
353 Ga0466966_0029228 3300044684 Bacteria 3587
354 Ga0466961_0027488 3300044693 Bacteria 3658
355 Ga0466963_0087329 3300044694 Bacteria 2120
356 Ga0466964_0004187 3300044706 Bacteria 5308
357 Ga0453684_0000450 3300044712 Bacteria 166110
358 Ga0453684_0011270 3300044712 Bacteria 15040
359 Ga0453684_0165343 3300044712 Bacteria 2612
360 Ga0453684_0186712 3300044712 Bacteria 2428
361 Ga0453684_0434659 3300044712 Bacteria 1463
362 Ga0466971_0018165 3300044719 Bacteria 3113
363 Ga0466970_0002134 3300044765 Bacteria 9544
364 Ga0466957_0015104 3300044842 Bacteria 4506
365 Ga0466959_0001954 3300045049 Bacteria 12989
366 Ga0451576_0005426 3300045051 Bacteria 16006
367 Ga0451576_0021664 3300045051 Bacteria 6982
368 Ga0451576_0631666 3300045051 Bacteria 1125
369 Ga0451576_0744611 3300045051 Bacteria 1029
370 Ga0466958_0171062 3300045836 Bacteria 1375
371 Ga0495627_005101 3300046453 Bacteria 5365
372 Ga0495627_018549 3300046453 Bacteria 2344
373 Ga0495629_0120242 3300046459 Bacteria 1830
374 Ga0495639_0079806 3300046475 Bacteria 1522
375 Ga0495610_0126954 3300046512 Bacteria 1111
376 Ga0495616_0002894 3300046513 Bacteria 11205
377 Ga0495620_0030887 3300046515 Bacteria 2460
378 Ga0495620_0048429 3300046515 Bacteria 1824
379 Ga0495631_0000496 3300046518 Bacteria 26216
380 Ga0495632_0013833 3300046519 Bacteria 4588
381 Ga0495632_0132444 3300046519 Bacteria 1159
382 Ga0495637_0001602 3300046520 Bacteria 13138
383 Ga0495654_0164805 3300046530 Bacteria 970
384 Ga0495633_0030239 3300046558 Bacteria 2632
385 Ga0495668_0163132 3300046616 Bacteria 1221
386 Ga0495625_0000146 3300046660 Bacteria 108123
387 Ga0495625_0002807 3300046660 Bacteria 18358
388 Ga0495625_0204062 3300046660 Bacteria 1303
389 Ga0495635_0203407 3300046663 Bacteria 1343
390 Ga0495658_0031848 3300046683 Bacteria 2875
391 Ga0495671_0006416 3300046692 Bacteria 6792
392 Ga0495676_0002384 3300047321 Bacteria 16678
393 Ga0495677_0115415 3300047445 Bacteria 1022
394 Ga0495685_041939 3300047447 Bacteria 1563
395 Ga0495593_0002547 3300047673 Bacteria 10932
396 Ga0495614_0023727 3300048089 Bacteria 2647
397 Ga0496100_0029364 3300048903 Bacteria 3400
398 Ga0496102_0048296 3300048905 Bacteria 3869
399 Ga0496103_0040799 3300048906 Bacteria 2852
400 Ga0496104_0046824 3300048907 Bacteria 4074
401 Ga0496106_0057268 3300048909 Bacteria 2947
402 Ga0496107_0114048 3300048910 Bacteria 1988
403 Ga0496108_0195926 3300048911 Bacteria 1752
404 Ga0496110_0117453 3300048913 Bacteria 2395
405 Ga0496111_0060850 3300048914 Bacteria 2737
406 Ga0496114_0072567 3300048917 Bacteria 2895
407 Ga0496116_0057505 3300048919 Bacteria 2542
408 Ga0496116_0102227 3300048919 Bacteria 1709
409 Ga0496117_0027904 3300048920 Bacteria 4382
410 Ga0496117_0066614 3300048920 Bacteria 2441
411 Ga0496117_0095057 3300048920 Bacteria 1906
412 Ga0496117_0181759 3300048920 Bacteria 1208
413 Ga0496118_0021240 3300048921 Bacteria 5722
414 Ga0496118_0193945 3300048921 Bacteria 1211
415 Ga0496121_0081449 3300048924 Bacteria 2562
416 Ga0496121_0116908 3300048924 Bacteria 2021
417 Ga0496121_0214654 3300048924 Bacteria 1360
418 Ga0496122_0004844 3300048925 Bacteria 16393
419 Ga0496122_0096715 3300048925 Bacteria 1990
420 Ga0496123_0006860 3300048926 Bacteria 10904
421 Ga0496123_0062035 3300048926 Bacteria 2398
422 Ga0496123_0065853 3300048926 Bacteria 2299
423 Ga0496123_0075543 3300048926 Bacteria 2079
424 Ga0496123_0078218 3300048926 Bacteria 2027
425 Ga0496124_0028232 3300048927 Bacteria 5022
426 Ga0496124_0061912 3300048927 Bacteria 3134
427 Ga0496124_0082240 3300048927 Bacteria 2644
428 Ga0496125_0084867 3300048928 Bacteria 2402
429 Ga0496125_0105725 3300048928 Bacteria 2057
430 Ga0496125_0114745 3300048928 Bacteria 1939
431 Ga0501031_0008415 3300049568 Bacteria 6711
432 Ga0501262_001233 3300049759 Bacteria 2877
433 nmdc:mga03683_4677_c1 3300050489 Bacteria 4564
434 nmdc:mga03683_81741_c1 3300050489 Bacteria 1396
435 nmdc:mga03n38_23891_c1 3300050490 Bacteria 2493
436 nmdc:mga03n38_250831_c1 3300050490 Bacteria 935
437 nmdc:mga03n38_87420_c1 3300050490 Bacteria 1477
438 nmdc:mga00v17_6213_c1 3300050491 Bacteria 6335
439 nmdc:mga0yw44_164910_c1 3300050492 Bacteria 1452
440 nmdc:mga0yw44_22027_c1 3300050492 Bacteria 3565
441 nmdc:mga0yw44_543092_c1 3300050492 Bacteria 789
442 nmdc:mga0yw44_9062_c1 3300050492 Bacteria 5005
443 nmdc:mga0k408_168192_c1 3300050493 Bacteria 1307
444 nmdc:mga07m45_1518_c1 3300050496 Bacteria 10643
445 Ga0500610_0065976 3300053079 Bacteria 1887
446 Ga0500643_012940 3300053087 Bacteria 2970
447 Ga0500644_0005955 3300053088 Bacteria 3100
448 Ga0500651_0001339 3300053093 Bacteria 12300
449 Ga0500562_016644 3300053108 Bacteria 1891
450 Ga0500571_000048 3300053110 Bacteria 37193
451 Ga0500593_025858 3300053117 Bacteria 2612
452 Ga0500594_0004352 3300053118 Bacteria 3118
453 Ga0500607_009708 3300053121 Bacteria 5780
454 Ga0500607_092926 3300053121 Bacteria 1514
455 Ga0500608_026397 3300053122 Bacteria 2728
456 Ga0500608_086694 3300053122 Bacteria 1469
457 Ga0500655_002695 3300053133 Bacteria 3218
458 Ga0500658_0000114 3300053134 Bacteria 38111
459 Ga0500658_0000282 3300053134 Bacteria 23110
460 Ga0500559_0017111 3300053136 Bacteria 3061
461 Ga0500559_0036585 3300053136 Bacteria 2124
462 Ga0500561_0009527 3300053137 Bacteria 1976
463 Ga0500564_039048 3300053138 Bacteria 2188
464 Ga0500568_0009431 3300053139 Bacteria 4638
465 Ga0500574_000162 3300053141 Bacteria 7782
466 Ga0500574_027138 3300053141 Bacteria 1508
467 Ga0500616_0019334 3300053153 Bacteria 3841
468 Ga0500627_0005661 3300053158 Bacteria 4171
469 Ga0500634_0032900 3300053161 Bacteria 2826
470 Ga0500638_001937 3300053162 Bacteria 6911
471 Ga0500636_0042921 3300053177 Bacteria 2672
472 Ga0500625_148543 3300053729 Bacteria 886
473 Ga0500645_001672 3300053730 Bacteria 10887
474 Ga0500645_003175 3300053730 Bacteria 6831
475 Ga0500645_007884 3300053730 Bacteria 3676
476 Ga0500661_007030 3300055283 Bacteria 2088
477 Ga0466962_0051328 3300061719 Bacteria 1971
478 2511246866 2511231002 Bacteria 5042903
479 2513228046 2513020051 Bacteria 6053213
480 2588294206 2588253510 Bacteria 6901809
481 2599622012 2599185214 Bacteria 8209958
482 2599676992 2599185226 Bacteria 8233575
483 2599680581 2599185227 Bacteria 8246414
484 2599692597 2599185229 Bacteria 8216126
485 2643868346 2643221570 Bacteria 5103772
486 2643994463 2643221596 Bacteria 5006805
487 2644161138 2643221628 Bacteria 5745828
488 2644326266 2643221658 Bacteria 6064537
489 2644399368 2643221672 Bacteria 6322190
490 2644469688 2643221683 Bacteria 5749203
491 2738723754 2738541277 Bacteria 7458140
492 2738886062 2738541307 Bacteria 8606193
493 2739284485 2738543019 Bacteria 7459457
494 2816473746 2816332133 Bacteria 7249298
495 2819598804 2818991446 Bacteria 7757362
496 2831269442 2831265667 Bacteria 7184833
497 2838058616 2838054893 Bacteria 7451788
498 2842682741 2842677519 Bacteria 5615038
499 2842722317 2842718218 Bacteria 4560148
500 2842738895 2842733646 Bacteria 5716726
501 2842749939 2842747753 Bacteria 5578255
502 2885193669 2885192300 Bacteria 5882526
503 2885202697 2885198086 Bacteria 7212419
504 2885216350 2885211737 Bacteria 7212420
505 2894023708 2894023352 Bacteria 5167372
506 2899929621 2899924645 Bacteria 7487985
507 2904455654 2904449895 Bacteria 6927402
508 2904462265 2904456579 Bacteria 6819253
509 2904483683 2904479285 Bacteria 5073931
510 2904545831 2904541872 Bacteria 8915136
511 2919464784 2919462493 Bacteria 5817112
512 2919705579 2919704043 Bacteria 5560311
513 2928042439 2928037797 Bacteria 7273642
514 2928048464 2928044640 Bacteria 7271509
515 2928054789 2928051484 Bacteria 7773759
516 2928068208 2928064002 Bacteria 7419480
517 2928073903 2928070936 Bacteria 8062541
518 2928086183 2928084124 Bacteria 7159212
519 2928121156 2928115317 Bacteria 6477646
520 2929161017 2929160207 Bacteria 9075316
521 2929525553 2929520902 Bacteria 6765052
522 2945915896 2945909444 Bacteria 7065066
523 2945950151 2945945610 Bacteria 5951079
524 2945975202 2945972063 Bacteria 6086495
525 2945988672 2945984333 Bacteria 7358892
526 2954770377 2954767861 Bacteria 5535784
527 2990715373 2990710928 Bacteria 5002431
528 Ga0182008_10056500
529 JGI25155J39150_1000106
530 JGI25156J39149_1000024
531 JGI25154J39366_1000043
532 JGI25157J39369_1000031
533 JGI25152J39213_1009129
534 JGI25152J39213_1009340
535 JGI25150J39212_1005111
536 JGI25150J39212_1010048
537 JGI25159J45721_1000371
538 JGI25159J45721_1001251
539 JGI25159J45721_1004361
540 JGI25159J45721_1010337
541 JGI25151J46595_10001261
542 JGI25151J46595_10007970
543 JGI25151J46595_10016514
544 JGI25151J46595_10018410
545 JGI25151J46595_10025532
546 JGI25151J46595_10025775
547 JGI25151J46595_10026511
548 JGI25153J46596_10017497
549 JGI25153J46596_10022319
550 rootH2_10048172
551 JGI25160J50197_1000276
552 JGI25160J50197_1004789
553 JGI25160J50197_1016432
554 JGI25161J50226_1000021
555 JGI25161J50226_1004872
556 JGI25161J50226_1005699
557 Ga0006562J51391_1004331
558 Ga0006562J51391_1004334
559 Ga0055535_1004285
560 Ga0055542_1000301
561 Ga0055526_1005008
562 Ga0055526_1020190
563 Ga0055526_1020192
564 Ga0055537_1000230
565 Ga0055537_1000418
566 Ga0055537_1002775
567 Ga0055537_1008408
568 Ga0055537_1009090
569 Ga0055537_1009091
570 Ga0055524_1000039
571 Ga0055524_1018815
572 Ga0055524_1018817
573 Ga0055536_1006928
574 Ga0055536_1007839
575 Ga0055536_1014289
576 Ga0055536_1015681
577 Ga0055536_1016979
578 Ga0055534_1001835
579 Ga0055534_1002741
580 Ga0055534_1008223
581 Ga0055534_1008497
582 Ga0055528_1003778
583 Ga0055528_1015662
584 Ga0055528_1018254
585 Ga0055528_1019658
586 Ga0055528_1019660
587 Ga0055528_1030300
588 Ga0055530_10002833
589 Ga0055530_10004496
590 Ga0055530_10013905
591 Ga0055540_1000047
592 Ga0055540_1005380
593 Ga0055540_1005543
594 Ga0055540_1005738
595 Ga0055540_1012265
596 Ga0055540_1014215
597 Ga0055531_10008997
598 Ga0055531_10009109
599 Ga0055531_10022652
600 Ga0055543_1000701
601 Ga0055543_1002717
602 Ga0065165_1012745
603 Ga0065165_1012746
604 Ga0065165_1019450
605 Ga0065704_10122814
606 Ga0070666_10121053
607 Ga0070666_10172948
608 Ga0070661_100081621
609 Ga0070669_100026536
610 Ga0070659_100079319
611 Ga0070662_100241132
612 Ga0070706_100108375
613 Ga0068853_100128480
614 Ga0070664_100005763
615 Ga0068857_100193107
616 Ga0068852_100117300
617 Ga0068859_100430773
618 Ga0068864_100028078
619 Ga0075365_10071282
620 Ga0075365_10171184
621 Ga0075363_100010202
622 Ga0075363_100068660
623 Ga0075364_10056669
624 Ga0075364_10222643
625 Ga0075432_10011363
626 Ga0075362_10004139
627 Ga0075362_10022501
628 Ga0075362_10035041
629 Ga0075362_10039523
630 Ga0075367_10106301
631 Ga0075366_10009581
632 Ga0075366_10065153
633 Ga0075366_10215355
634 Ga0097621_100145967
635 Ga0097621_100489309
636 Ga0075370_10009012
637 Ga0075370_10017449
638 Ga0075370_10061369
639 Ga0075370_10082784
640 Ga0097620_100430784
641 Ga0099826_10018166
642 Ga0099826_10038002
643 Ga0105244_10032770
644 Ga0105240_10182998
645 Ga0105243_10002392
646 Ga0105243_10083074
647 Ga0105243_10110976
648 Ga0105242_10557794
649 Ga0105237_10043079
650 Ga0105239_10281712
651 Ga0105246_10369138
652 Ga0157347_1000608
653 Ga0157373_10101553
654 Ga0157373_10203560
655 Ga0157371_10078527
656 Ga0157370_10010303
657 Ga0157369_10007891
658 Ga0157372_10312918
659 Ga0157375_10401772
660 Ga0182008_10007777
661 Ga0182008_10015084
662 Ga0182008_10019549
663 Ga0182008_10049959
664 Ga0182006_1007691
665 Ga0182006_1028001
666 Ga0182007_10006641
667 Ga0163161_10008429
668 Ga0163161_10012393
669 Ga0163161_10059706
670 Ga0213872_10012990
671 Ga0209435_100008
672 Ga0209436_105594
673 Ga0209436_108251
674 Ga0209436_111973
675 Ga0209672_101179
676 Ga0209258_100020
677 Ga0207425_1003159
678 Ga0207425_1007445
679 Ga0207425_1017653
680 Ga0209646_1000079
681 Ga0209026_1000067
682 Ga0209148_1000031
683 Ga0209759_1000056
684 Ga0209129_1000277
685 Ga0209129_1006779
686 Ga0209129_1013597
687 Ga0209565_1000070
688 Ga0209565_1000080
689 Ga0209565_1000465
690 Ga0209565_1000746
691 Ga0209565_1007676
692 Ga0209565_1009627
693 Ga0209673_1000088
694 Ga0209673_1000518
695 Ga0209673_1006336
696 Ga0209673_1017034
697 Ga0209673_1021229
698 Ga0209130_1000949
699 Ga0209130_1001036
700 Ga0209130_1003234
701 Ga0209130_1003468
702 Ga0209130_1011052
703 Ga0209675_1000069
704 Ga0209675_1000278
705 Ga0209675_1002333
706 Ga0209675_1002726
707 Ga0209675_1010677
708 Ga0209675_1014654
709 Ga0209675_1014893
710 Ga0209675_1015696
711 Ga0209676_1000073
712 Ga0209676_1000195
713 Ga0209676_1002376
714 Ga0209676_1004350
715 Ga0209676_1006675
716 Ga0209676_1018274
717 Ga0209676_1042298
718 Ga0209025_1000526
719 Ga0209025_1000940
720 Ga0209025_1002510
721 Ga0209025_1010190
722 Ga0209025_1010784
723 Ga0209025_1025885
724 Ga0209025_1030703
725 Ga0209025_1032494
726 Ga0209564_1000101
727 Ga0209564_1001748
728 Ga0209564_1001835
729 Ga0209564_1002907
730 Ga0209564_1020317
731 Ga0209564_1033977
732 Ga0209758_1000127
733 Ga0209758_1037399
734 Ga0209050_1000008
735 Ga0209050_1000021
736 Ga0209050_1001285
737 Ga0209050_1007150
738 Ga0209050_1007364
739 Ga0209050_1049021
740 Ga0209256_1000096
741 Ga0209256_1000104
742 Ga0209256_1017050
743 Ga0207426_1000149
744 Ga0207426_1000731
745 Ga0207426_1000808
746 Ga0207426_1010080
747 Ga0209051_1000005
748 Ga0209051_1000028
749 Ga0209051_1000184
750 Ga0209051_1003269
751 Ga0209051_1008100
752 Ga0209051_1012688
753 Ga0209051_1022749
754 Ga0209257_1000031
755 Ga0209257_1000889
756 Ga0209257_1006599
757 Ga0209257_1008006
758 Ga0209257_1008770
759 Ga0209257_1010658
760 Ga0207656_10013690
761 Ga0207655_1003947
762 Ga0207688_10120258
763 Ga0207649_10079640
764 Ga0207681_10005589
765 Ga0207706_10405699
766 Ga0207709_10001520
767 Ga0207709_10050274
768 Ga0207709_10078154
769 Ga0207679_10034475
770 Ga0207667_10121226
771 Ga0207640_10019038
772 Ga0207658_10174615
773 Ga0207677_10435517
774 Ga0207639_10104927
775 Ga0207639_10129712
776 Ga0207702_10521303
777 Ga0207676_10102373
778 Ga0207674_10130868
779 Ga0207674_10433797
780 Ga0209970_1000292
781 Ga0209983_1014182
782 Ga0209282_1053909
783 Ga0209971_1007151
784 Ga0209998_10006425
785 Ga0209974_10000744
786 Ga0209974_10004724
787 Ga0209974_10092304
788 Ga0207428_10082406
789 Ga0268266_10113255
790 Ga0307515_10002595
791 Ga0307515_10199897
792 Ga0307515_10213165
793 Ga0316177_1017951
794 Ga0316176_1211419
795 Ga0314311_1098150
796 Ga0316179_1109674
797 Ga0316178_1058202
798 Ga0316180_1005383
799 Ga0316183_1038041
800 Ga0316181_1098684
801 Ga0316182_1271523
802 Ga0316182_1408608
803 Ga0265330_10000012
804 Ga0265332_10000012
805 Ga0265328_10032672
806 Ga0265325_10003322
807 Ga0265340_10030519
808 Ga0265327_10000674
809 Ga0265327_10044669
810 Ga0307513_10001864
811 Ga0307513_10047429
812 Ga0307513_10154649
813 Ga0307408_100009731
814 Ga0307408_100012534
815 Ga0307408_100033702
816 Ga0307408_100086250
817 Ga0307408_100407170
818 Ga0307508_10003800
819 Ga0307514_10020016
820 Ga0307514_10023788
821 Ga0265314_10000029
822 Ga0307516_10000506
823 Ga0307516_10001680
824 Ga0307405_10025900
825 Ga0307405_10093513
826 Ga0307405_10164294
827 Ga0307405_10184586
828 Ga0307405_10434738
829 Ga0307406_10008625
830 Ga0307406_10075307
831 Ga0307412_10007404
832 Ga0307412_10082749
833 Ga0307412_10359026
834 Ga0307416_100005418
835 Ga0307416_100021195
836 Ga0307414_10073291
837 Ga0307414_10791806
838 Ga0307411_10012293
839 Ga0307411_10404447
840 Ga0316593_10026749
841 Ga0307507_10036736
842 Ga0316596_1011760
843 Ga0316574_0003658
844 Ga0316574_0011017
845 Ga0316584_0038240
846 Ga0316584_0149866
847 Ga0400485_11271
848 Ga0400486_19710
849 Ga0436361_0677039
850 Ga0436361_0963032
851 Ga0439447_014619
852 Ga0439466_0004881
853 Ga0439466_0014801
854 Ga0439465_0008505
855 Ga0451789_1013970
856 Ga0439431_0008281
857 Ga0439431_0017737
858 Ga0439442_009395
859 Ga0439445_0005887
860 Ga0439432_016028
861 Ga0439449_0015777
862 Ga0439449_0023958
863 Ga0439452_005229
864 Ga0439457_008101
865 Ga0439462_0047961
866 Ga0450919_004221
867 Ga0450920_005009
868 Ga0450923_005993
869 Ga0450898_004347
870 Ga0450906_011389
871 Ga0450907_015669
872 Ga0439446_0036155
873 Ga0450908_020469
874 Ga0450909_003065
875 Ga0450893_0016322
876 Ga0451577_0000093
877 Ga0451577_0014449
878 Ga0453683_0007761
879 Ga0466965_0020012
880 Ga0466966_0029228
881 Ga0466961_0027488
882 Ga0466963_0087329
883 Ga0466964_0004187
884 Ga0453684_0000450
885 Ga0453684_0011270
886 Ga0453684_0165343
887 Ga0453684_0186712
888 Ga0453684_0434659
889 Ga0466971_0018165
890 Ga0466970_0002134
891 Ga0466957_0015104
892 Ga0466959_0001954
893 Ga0451576_0005426
894 Ga0451576_0021664
895 Ga0451576_0631666
896 Ga0451576_0744611
897 Ga0466958_0171062
898 Ga0495627_005101
899 Ga0495627_018549
900 Ga0495629_0120242
901 Ga0495639_0079806
902 Ga0495610_0126954
903 Ga0495616_0002894
904 Ga0495620_0030887
905 Ga0495620_0048429
906 Ga0495631_0000496
907 Ga0495632_0013833
908 Ga0495632_0132444
909 Ga0495637_0001602
910 Ga0495654_0164805
911 Ga0495633_0030239
912 Ga0495668_0163132
913 Ga0495625_0000146
914 Ga0495625_0002807
915 Ga0495625_0204062
916 Ga0495635_0203407
917 Ga0495658_0031848
918 Ga0495671_0006416
919 Ga0495676_0002384
920 Ga0495677_0115415
921 Ga0495685_041939
922 Ga0495593_0002547
923 Ga0495614_0023727
924 Ga0496100_0029364
925 Ga0496102_0048296
926 Ga0496103_0040799
927 Ga0496104_0046824
928 Ga0496106_0057268
929 Ga0496107_0114048
930 Ga0496108_0195926
931 Ga0496110_0117453
932 Ga0496111_0060850
933 Ga0496114_0072567
934 Ga0496116_0057505
935 Ga0496116_0102227
936 Ga0496117_0027904
937 Ga0496117_0066614
938 Ga0496117_0095057
939 Ga0496117_0181759
940 Ga0496118_0021240
941 Ga0496118_0193945
942 Ga0496121_0081449
943 Ga0496121_0116908
944 Ga0496121_0214654
945 Ga0496122_0004844
946 Ga0496122_0096715
947 Ga0496123_0006860
948 Ga0496123_0062035
949 Ga0496123_0065853
950 Ga0496123_0075543
951 Ga0496123_0078218
952 Ga0496124_0028232
953 Ga0496124_0061912
954 Ga0496124_0082240
955 Ga0496125_0084867
956 Ga0496125_0105725
957 Ga0496125_0114745
958 Ga0501031_0008415
959 Ga0501262_001233
960 nmdc:mga03683_4677_c1
961 nmdc:mga03683_81741_c1
962 nmdc:mga03n38_23891_c1
963 nmdc:mga03n38_250831_c1
964 nmdc:mga03n38_87420_c1
965 nmdc:mga00v17_6213_c1
966 nmdc:mga0yw44_164910_c1
967 nmdc:mga0yw44_22027_c1
968 nmdc:mga0yw44_543092_c1
969 nmdc:mga0yw44_9062_c1
970 nmdc:mga0k408_168192_c1
971 nmdc:mga07m45_1518_c1
972 Ga0500610_0065976
973 Ga0500643_012940
974 Ga0500644_0005955
975 Ga0500651_0001339
976 Ga0500562_016644
977 Ga0500571_000048
978 Ga0500593_025858
979 Ga0500594_0004352
980 Ga0500607_009708
981 Ga0500607_092926
982 Ga0500608_026397
983 Ga0500608_086694
984 Ga0500655_002695
985 Ga0500658_0000114
986 Ga0500658_0000282
987 Ga0500559_0017111
988 Ga0500559_0036585
989 Ga0500561_0009527
990 Ga0500564_039048
991 Ga0500568_0009431
992 Ga0500574_000162
993 Ga0500574_027138
994 Ga0500616_0019334
995 Ga0500627_0005661
996 Ga0500634_0032900
997 Ga0500638_001937
998 Ga0500636_0042921
999 Ga0500625_148543
1000 Ga0500645_001672
1001 Ga0500645_003175
1002 Ga0500645_007884
1003 Ga0500661_007030
1004 Ga0466962_0051328
1005 2511246866
1006 2513228046
1007 2588294206
1008 2599622012
1009 2599676992
1010 2599680581
1011 2599692597
1012 2643868346
1013 2643994463
1014 2644161138
1015 2644326266
1016 2644399368
1017 2644469688
1018 2738723754
1019 2738886062
1020 2739284485
1021 2816473746
1022 2819598804
1023 2831269442
1024 2838058616
1025 2842682741
1026 2842722317
1027 2842738895
1028 2842749939
1029 2885193669
1030 2885202697
1031 2885216350
1032 2894023708
1033 2899929621
1034 2904455654
1035 2904462265
1036 2904483683
1037 2904545831
1038 2919464784
1039 2919705579
1040 2928042439
1041 2928048464
1042 2928054789
1043 2928068208
1044 2928073903
1045 2928086183
1046 2928121156
1047 2929161017
1048 2929525553
1049 2945915896
1050 2945950151
1051 2945975202
1052 2945988672
1053 2954770377
1054 2990715373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00218

IGPS

Indole-3-glycerol phosphate synthase

17

276

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9775 3 265
3t55-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba) 0.964 5 268
3t40-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg) 0.9596 4 265
3t78-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate 0.9595 5 266
6y88-assembly8.cif.gz_H igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp 0.9593 3 265
ID Description Score Start End Superfamily
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9597 4 265 3.20.20.70
3o6yX00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9474 35 267 3.20.20.70
af_Q0JCI6_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9472 35 268 3.20.20.70
af_B4FS35_106_381_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9466 4 268 3.20.20.70
af_P00909_2_259_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9426 5 268 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2P9H5L2-F1-model_v4 Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48) 0.9972 38 265 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A1T2LCT9-F1-model_v4 Multifunctional fusion protein [Includes: Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48); Anthranilate phosphoribosyltransferase (EC 2.4.2.18)] 0.995 12 266 GO:0000162
GO:0000287
GO:0004048
GO:0004425
GO:0005829
GO:0006568
AF-A0A645EWE4-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.995 98 265 GO:0000162
GO:0004425
GO:0004640
AF-A0A4Q6GLX9-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9947 35 265 GO:0000162
GO:0004425
GO:0004640
GO:0006568
AF-A0A349SKL8-F1-model_v4 indole-3-glycerol-phosphate synthase (EC 4.1.1.48) 0.9945 91 265 GO:0000162
GO:0004425
GO:0004640

Map