F459314

General Info

Members Datasets Scaffolds Average Seq Length
525 284 1050 368

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0114969|Ga0466963_0114969_600_1832
Length 410
Sequence MQRSHPQENAGAFTRGDRRGVVRPAEHGTKVPPGPGVDTLARVTDIEIGRAKRGRRAYSFDDIAIVPSRRTRDPEEVSVAWQIDAYRFELPIVAAPMDSVMSPETAIALGQYGGLGVLNLEGLWTRYDDPSEVLAEIAELDQGTAVRRMQEMYAEPVKPELITARLRQMREAGVTVAGSLSPQRTKEFAKTVVDAGVDMFVIRGTTVSAEHVSAQAEPLNLKEFIYELDVPVIVGGCATYQAALHLMRTGAAGVLVGFGGGAAHTTRTVLGVSVPMASAVADVAGARRDYLDESGGRYVHVIADGSIGSSGDIAKAIACGADAVMIGSPFARASDAPGQGFHWGAEAHHAELPRGERVQIGTVGTLQEILFGPSRVADGTMNLIGALRRAMATTGYTEIKEFQRIEVVVS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
244 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
245 2643221561 Nocardioides sp. Root151 Isolate Unclassified
246 2643221572 Leifsonia sp. Root60 Isolate Unclassified
247 2643221576 Nocardioides sp. Root614 Isolate Unclassified
248 2643221590 Nocardioides sp. Root682 Isolate Unclassified
249 2643221615 Nocardioides sp. Root224 Isolate Unclassified
250 2643221616 Leifsonia sp. Root227 Isolate Unclassified
251 2643221620 Nocardioides sp. Root240 Isolate Unclassified
252 2643221641 Nocardioides sp. Root122 Isolate Unclassified
253 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
254 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
255 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
256 2643221696 Nocardioides sp. Root140 Isolate Unclassified
257 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
258 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
259 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
260 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
261 2738541305 Nocardioides sp. CF167 Isolate Unclassified
262 2739367898 Nocardioides sp. CF479 Isolate Unclassified
263 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
264 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
265 2808606372 Agromyces sp. 23-23 Isolate Unclassified
266 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
267 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
268 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
269 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
270 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
271 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
272 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
273 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
274 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
275 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
276 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
277 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
278 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
279 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
280 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
281 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
282 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
283 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
284 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.81
Metatranscriptomes 0.19
Isolates 8

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 9.14
Nodule 0.19
Rhizoplane 6.1
Rhizosphere 76.76
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0114969 3300044694 Bacteria 1849
2 JGI24740J21852_10010365 3300001979 Bacteria 3597
3 JGI25164J39214_1001647 3300002772 Bacteria 4619
4 JGI25406J46586_10011538 3300003203 Bacteria 3873
5 JGI25165J46597_1000061 3300003214 Bacteria 208362
6 Ga0070658_10006075 3300005327 Bacteria 9791
7 Ga0070658_10153672 3300005327 Bacteria 1928
8 Ga0070683_100002149 3300005329 Bacteria 15577
9 Ga0070683_100041708 3300005329 Bacteria 4224
10 Ga0070680_100131048 3300005336 Bacteria 2098
11 Ga0070682_100007299 3300005337 Bacteria 6231
12 Ga0070682_100030231 3300005337 Bacteria 3268
13 Ga0070682_100083790 3300005337 Bacteria 2070
14 Ga0068868_100036515 3300005338 Bacteria 3804
15 Ga0070692_10013169 3300005345 Bacteria 3850
16 Ga0070668_100033454 3300005347 Bacteria 3915
17 Ga0070675_100247269 3300005354 Bacteria 1560
18 Ga0070674_100052635 3300005356 Bacteria 2809
19 Ga0070659_100016752 3300005366 Bacteria 5505
20 Ga0070667_100118852 3300005367 Bacteria 2298
21 Ga0070714_100019587 3300005435 Bacteria 5517
22 Ga0070714_100055540 3300005435 Bacteria 3385
23 Ga0070700_100000290 3300005441 Bacteria 26415
24 Ga0070663_100007483 3300005455 Bacteria 6649
25 Ga0070685_10160901 3300005466 Bacteria 1431
26 Ga0070706_100001972 3300005467 Bacteria 21152
27 Ga0070707_100078607 3300005468 Bacteria 3183
28 Ga0070698_100001704 3300005471 Bacteria 24513
29 Ga0070679_100002823 3300005530 Bacteria 15800
30 Ga0070684_100005348 3300005535 Bacteria 9839
31 Ga0070684_100050277 3300005535 Bacteria 3620
32 Ga0068853_100045488 3300005539 Bacteria 3759
33 Ga0068853_100282264 3300005539 Bacteria 1531
34 Ga0070672_100007465 3300005543 Bacteria 7420
35 Ga0070665_100000450 3300005548 Bacteria 59867
36 Ga0070665_100171656 3300005548 Bacteria 2169
37 Ga0068855_100131782 3300005563 Bacteria 2854
38 Ga0070664_100006095 3300005564 Bacteria 9749
39 Ga0068857_100021760 3300005577 Bacteria 5643
40 Ga0068854_100001458 3300005578 Bacteria 14325
41 Ga0068856_100031541 3300005614 Bacteria 5185
42 Ga0068856_100032891 3300005614 Bacteria 5079
43 Ga0068856_100279570 3300005614 Bacteria 1686
44 Ga0070702_100014725 3300005615 Bacteria 3974
45 Ga0068852_100020712 3300005616 Bacteria 5232
46 Ga0068852_100023597 3300005616 Bacteria 4954
47 Ga0068852_100146422 3300005616 Bacteria 2191
48 Ga0068861_100037759 3300005719 Bacteria 3591
49 Ga0068861_100068489 3300005719 Bacteria 2743
50 Ga0068861_100224053 3300005719 Bacteria 1591
51 Ga0068870_10005145 3300005840 Bacteria 5690
52 Ga0068860_100001548 3300005843 Bacteria 24782
53 Ga0068862_100100973 3300005844 Bacteria 2523
54 Ga0081455_10000106 3300005937 Bacteria 93286
55 Ga0081455_10009817 3300005937 Bacteria 9802
56 Ga0081455_10013452 3300005937 Bacteria 8085
57 Ga0081538_10000264 3300005981 Bacteria 59881
58 Ga0081538_10000860 3300005981 Bacteria 32748
59 Ga0081538_10021271 3300005981 Bacteria 4742
60 Ga0081539_10000238 3300005985 Bacteria 129119
61 Ga0081539_10078393 3300005985 Bacteria 1744
62 Ga0075365_10036206 3300006038 Bacteria 3197
63 Ga0075365_10039867 3300006038 Bacteria 3060
64 Ga0075365_10046971 3300006038 Bacteria 2837
65 Ga0075365_10071659 3300006038 Bacteria 2333
66 Ga0075365_10088623 3300006038 Bacteria 2105
67 Ga0075365_10099274 3300006038 Bacteria 1992
68 Ga0075365_10124797 3300006038 Bacteria 1778
69 Ga0075368_10007610 3300006042 Bacteria 3825
70 Ga0075363_100001581 3300006048 Bacteria 8754
71 Ga0075363_100035313 3300006048 Bacteria 2615
72 Ga0075363_100082595 3300006048 Bacteria 1759
73 Ga0075364_10012721 3300006051 Bacteria 5159
74 Ga0075364_10016867 3300006051 Bacteria 4550
75 Ga0075364_10103547 3300006051 Bacteria 1896
76 Ga0075364_10105946 3300006051 Bacteria 1873
77 Ga0075367_10007520 3300006178 Bacteria 5585
78 Ga0075367_10043559 3300006178 Bacteria 2628
79 Ga0075367_10063100 3300006178 Bacteria 2214
80 Ga0075428_100001401 3300006844 Bacteria 25642
81 Ga0075428_100004919 3300006844 Bacteria 14844
82 Ga0075428_100015550 3300006844 Bacteria 8435
83 Ga0075430_100031930 3300006846 Bacteria 4469
84 Ga0075430_100163301 3300006846 Bacteria 1854
85 Ga0075431_100004352 3300006847 Bacteria 13890
86 Ga0075431_100047545 3300006847 Bacteria 4423
87 Ga0075429_100001477 3300006880 Bacteria 19337
88 Ga0075429_100026537 3300006880 Bacteria 5031
89 Ga0068865_100020897 3300006881 Bacteria 4251
90 Ga0068865_100042400 3300006881 Bacteria 3103
91 Ga0105240_10219727 3300009093 Bacteria 2214
92 Ga0111539_10240375 3300009094 Bacteria 2108
93 Ga0111539_10413905 3300009094 Bacteria 1570
94 Ga0105245_10077162 3300009098 Bacteria 3036
95 Ga0105245_10091622 3300009098 Bacteria 2798
96 Ga0114129_10001245 3300009147 Bacteria 33926
97 Ga0114129_10161772 3300009147 Bacteria 3057
98 Ga0105243_10002771 3300009148 Bacteria 14575
99 Ga0105243_10211630 3300009148 Bacteria 1707
100 Ga0105241_10006434 3300009174 Bacteria 8656
101 Ga0105242_10136859 3300009176 Bacteria 2121
102 Ga0105248_10170852 3300009177 Bacteria 2450
103 Ga0105237_10058714 3300009545 Bacteria 3850
104 Ga0105237_10123710 3300009545 Bacteria 2581
105 Ga0105237_10256172 3300009545 Bacteria 1752
106 Ga0105237_10278384 3300009545 Bacteria 1675
107 Ga0105238_10005192 3300009551 Bacteria 12868
108 Ga0105249_10009259 3300009553 Bacteria 8611
109 Ga0105249_10091976 3300009553 Bacteria 2839
110 Ga0105249_10298666 3300009553 Bacteria 1614
111 Ga0105239_10003153 3300010375 Bacteria 20449
112 Ga0105239_10008340 3300010375 Bacteria 11808
113 Ga0105239_10083608 3300010375 Bacteria 3515
114 Ga0157369_10000230 3300013105 Bacteria 77399
115 Ga0157369_10262440 3300013105 Bacteria 1801
116 Ga0157374_10166511 3300013296 Bacteria 2148
117 Ga0163162_10010480 3300013306 Bacteria 9012
118 Ga0157372_10005912 3300013307 Bacteria 13028
119 Ga0157372_10241036 3300013307 Bacteria 2098
120 Ga0157375_10041301 3300013308 Bacteria 4453
121 Ga0157375_10128038 3300013308 Bacteria 2656
122 Ga0157375_10206227 3300013308 Bacteria 2122
123 Ga0163163_10069205 3300014325 Bacteria 3514
124 Ga0157380_10016580 3300014326 Bacteria 5436
125 Ga0157380_10068539 3300014326 Bacteria 2860
126 Ga0157380_10223935 3300014326 Bacteria 1685
127 Ga0157377_10036522 3300014745 Bacteria 2703
128 Ga0163161_10160810 3300017792 Bacteria 1712
129 Ga0213875_10009520 3300021388 Bacteria 4920
130 Ga0207427_100042 3300025231 Bacteria 254170
131 Ga0209437_100369 3300025233 Bacteria 47150
132 Ga0209233_1000001 3300025261 Bacteria 2992747
133 Ga0207647_10001834 3300025904 Bacteria 16299
134 Ga0207647_10003693 3300025904 Bacteria 11440
135 Ga0207647_10008627 3300025904 Bacteria 7291
136 Ga0207643_10010228 3300025908 Bacteria 5046
137 Ga0207684_10057102 3300025910 Bacteria 3311
138 Ga0207654_10061771 3300025911 Bacteria 2193
139 Ga0207695_10014077 3300025913 Bacteria 9500
140 Ga0207671_10001332 3300025914 Bacteria 28856
141 Ga0207660_10057992 3300025917 Bacteria 2775
142 Ga0207662_10195561 3300025918 Bacteria 1307
143 Ga0207657_10158160 3300025919 Bacteria 1841
144 Ga0207646_10031791 3300025922 Bacteria 4777
145 Ga0207646_10062440 3300025922 Bacteria 3326
146 Ga0207694_10001646 3300025924 Bacteria 18806
147 Ga0207687_10016384 3300025927 Bacteria 4868
148 Ga0207687_10069492 3300025927 Bacteria 2512
149 Ga0207664_10017088 3300025929 Bacteria 5307
150 Ga0207664_10071239 3300025929 Bacteria 2800
151 Ga0207690_10031247 3300025932 Bacteria 3406
152 Ga0207690_10177500 3300025932 Bacteria 1601
153 Ga0207706_10049671 3300025933 Bacteria 3706
154 Ga0207709_10017470 3300025935 Bacteria 4004
155 Ga0207709_10021634 3300025935 Bacteria 3642
156 Ga0207709_10172359 3300025935 Bacteria 1520
157 Ga0207670_10119640 3300025936 Bacteria 1912
158 Ga0207669_10022453 3300025937 Bacteria 3353
159 Ga0207669_10099016 3300025937 Bacteria 1922
160 Ga0207691_10016456 3300025940 Bacteria 7021
161 Ga0207689_10142428 3300025942 Bacteria 1975
162 Ga0207661_10025386 3300025944 Bacteria 4503
163 Ga0207661_10032041 3300025944 Bacteria 4068
164 Ga0207661_10060620 3300025944 Bacteria 3054
165 Ga0207661_10436266 3300025944 Bacteria 1191
166 Ga0207679_10027233 3300025945 Bacteria 3952
167 Ga0207679_10136781 3300025945 Bacteria 1974
168 Ga0207667_10013138 3300025949 Bacteria 9498
169 Ga0207712_10053524 3300025961 Bacteria 2832
170 Ga0207712_10146215 3300025961 Bacteria 1820
171 Ga0207712_10239069 3300025961 Bacteria 1462
172 Ga0207668_10016396 3300025972 Bacteria 4623
173 Ga0207668_10040351 3300025972 Bacteria 3149
174 Ga0207640_10001609 3300025981 Bacteria 12119
175 Ga0207677_10232874 3300026023 Bacteria 1485
176 Ga0207639_10171564 3300026041 Bacteria 1837
177 Ga0207639_10197214 3300026041 Bacteria 1724
178 Ga0207639_10317268 3300026041 Bacteria 1383
179 Ga0207678_10249089 3300026067 Bacteria 1521
180 Ga0207708_10000344 3300026075 Bacteria 36621
181 Ga0207708_10020798 3300026075 Bacteria 4950
182 Ga0207708_10124956 3300026075 Bacteria 2007
183 Ga0207702_10209930 3300026078 Bacteria 1810
184 Ga0207648_10011927 3300026089 Bacteria 8161
185 Ga0207648_10065947 3300026089 Bacteria 3157
186 Ga0207674_10049344 3300026116 Bacteria 4305
187 Ga0207674_10085673 3300026116 Bacteria 3145
188 Ga0207675_100000374 3300026118 Bacteria 42984
189 Ga0207675_100077649 3300026118 Bacteria 3111
190 Ga0207698_10024526 3300026142 Bacteria 4235
191 Ga0207698_10050589 3300026142 Bacteria 3171
192 Ga0207698_10050897 3300026142 Bacteria 3164
193 Ga0209813_10002005 3300027866 Bacteria 4612
194 Ga0209974_10003176 3300027876 Bacteria 5942
195 Ga0207428_10050346 3300027907 Bacteria 3333
196 Ga0207428_10050927 3300027907 Bacteria 3310
197 Ga0268266_10002498 3300028379 Bacteria 19619
198 Ga0268266_10027269 3300028379 Bacteria 4858
199 Ga0268266_10187071 3300028379 Bacteria 1889
200 Ga0268265_10156531 3300028380 Bacteria 1929
201 Ga0268264_10009341 3300028381 Bacteria 8119
202 Ga0307512_10107638 3300030522 Bacteria 1854
203 Ga0316181_1293815 3300030744 Bacteria 3233
204 Ga0316182_1028538 3300030745 Bacteria 9787
205 Ga0307513_10268231 3300031456 Bacteria 1492
206 Ga0307408_100028106 3300031548 Bacteria 3883
207 Ga0307408_100041042 3300031548 Bacteria 3279
208 Ga0307405_10008559 3300031731 Bacteria 5197
209 Ga0307405_10104731 3300031731 Bacteria 1904
210 Ga0307410_10009751 3300031852 Bacteria 5403
211 Ga0307406_10000318 3300031901 Bacteria 28084
212 Ga0307406_10006570 3300031901 Bacteria 6426
213 Ga0307407_10086867 3300031903 Bacteria 1906
214 Ga0307407_10138516 3300031903 Bacteria 1567
215 Ga0307407_10218479 3300031903 Bacteria 1287
216 Ga0307412_10033073 3300031911 Bacteria 3283
217 Ga0307409_100019124 3300031995 Bacteria 4628
218 Ga0307409_100061402 3300031995 Bacteria 2937
219 Ga0307409_100158204 3300031995 Bacteria 1978
220 Ga0307409_100320821 3300031995 Bacteria 1450
221 Ga0307416_100000046 3300032002 Bacteria 120916
222 Ga0307416_100003618 3300032002 Bacteria 9126
223 Ga0307414_10000798 3300032004 Bacteria 16137
224 Ga0307414_10074695 3300032004 Bacteria 2457
225 Ga0307414_10204323 3300032004 Bacteria 1609
226 Ga0307414_10294487 3300032004 Bacteria 1370
227 Ga0307411_10022409 3300032005 Bacteria 3718
228 Ga0307415_100002758 3300032126 Bacteria 8787
229 Ga0307415_100010149 3300032126 Bacteria 5319
230 Ga0395900_0075701 3300037418 Bacteria 3460
231 Ga0395898_0121604 3300037466 Bacteria 2501
232 Ga0436364_0087141 3300037853 Bacteria 7184
233 Ga0395901_0155046 3300038443 Bacteria 2406
234 Ga0395901_0202861 3300038443 Bacteria 2078
235 Ga0436365_0287335 3300039437 Bacteria 3063
236 Ga0451833_0174759 3300041491 Bacteria 7454
237 Ga0451837_0429473 3300041494 Bacteria 3121
238 Ga0451853_0312407 3300041512 Bacteria 12767
239 Ga0439448_0003280 3300042005 Bacteria 4468
240 Ga0439463_000424 3300042016 Bacteria 11772
241 Ga0439435_0019065 3300042436 Bacteria 1753
242 Ga0439464_0015854 3300042439 Bacteria 2037
243 Ga0466965_0015387 3300044683 Bacteria 3635
244 Ga0466965_0030578 3300044683 Bacteria 2624
245 Ga0466965_0043043 3300044683 Bacteria 2229
246 Ga0466966_0022165 3300044684 Bacteria 4170
247 Ga0466966_0066381 3300044684 Bacteria 2267
248 Ga0466961_0003846 3300044693 Bacteria 9386
249 Ga0466961_0039555 3300044693 Bacteria 3023
250 Ga0466963_0034929 3300044694 Bacteria 3274
251 Ga0466964_0023818 3300044706 Bacteria 2382
252 Ga0466970_0002435 3300044765 Bacteria 8991
253 Ga0466970_0009948 3300044765 Bacteria 4815
254 Ga0466970_0052117 3300044765 Bacteria 2184
255 Ga0466957_0050944 3300044842 Bacteria 2520
256 Ga0466957_0107660 3300044842 Bacteria 1765
257 Ga0466957_0108925 3300044842 Bacteria 1755
258 Ga0466960_0002292 3300044901 Bacteria 7170
259 Ga0466960_0004971 3300044901 Bacteria 5237
260 Ga0466960_0008651 3300044901 Bacteria 4174
261 Ga0466960_0041946 3300044901 Bacteria 2170
262 Ga0466958_0229555 3300045836 Bacteria 1185
263 Ga0466967_0017968 3300045976 Bacteria 5636
264 Ga0466967_0032381 3300045976 Bacteria 4413
265 Ga0466967_0064353 3300045976 Bacteria 3261
266 Ga0466967_0085658 3300045976 Bacteria 2853
267 Ga0466967_0087189 3300045976 Bacteria 2829
268 Ga0466967_0125419 3300045976 Bacteria 2377
269 Ga0495651_0006310 3300046462 Bacteria 9069
270 Ga0495596_0094746 3300046500 Bacteria 1159
271 Ga0495628_0004033 3300046516 Bacteria 13077
272 Ga0495644_0053212 3300046523 Bacteria 1521
273 Ga0495652_0001529 3300046529 Bacteria 25377
274 Ga0495645_0019199 3300046543 Bacteria 4921
275 Ga0495633_0070777 3300046558 Bacteria 1628
276 Ga0495667_0203935 3300046559 Bacteria 1265
277 Ga0495656_0020654 3300046615 Bacteria 2556
278 Ga0495661_0102782 3300046665 Bacteria 1606
279 Ga0495657_0042306 3300046675 Bacteria 3112
280 Ga0495658_0062542 3300046683 Bacteria 2140
281 Ga0495670_0081306 3300046691 Bacteria 1651
282 Ga0495600_0005605 3300046809 Bacteria 7579
283 Ga0495604_0016701 3300047317 Bacteria 5870
284 Ga0495674_0214901 3300047319 Bacteria 1591
285 Ga0496102_0013847 3300048905 Bacteria 7000
286 Ga0496102_0048229 3300048905 Bacteria 3872
287 Ga0496102_0095031 3300048905 Bacteria 2762
288 Ga0496103_0146946 3300048906 Bacteria 1509
289 Ga0496105_0004182 3300048908 Bacteria 10841
290 Ga0496105_0127498 3300048908 Bacteria 2098
291 Ga0496106_0098332 3300048909 Bacteria 2267
292 Ga0496107_0019994 3300048910 Bacteria 4728
293 Ga0496107_0118724 3300048910 Bacteria 1947
294 Ga0496108_0042798 3300048911 Bacteria 3782
295 Ga0496108_0080243 3300048911 Bacteria 2764
296 Ga0496108_0273067 3300048911 Bacteria 1472
297 Ga0496109_0021274 3300048912 Bacteria 5735
298 Ga0496109_0061770 3300048912 Bacteria 3426
299 Ga0496109_0158773 3300048912 Bacteria 2118
300 Ga0496109_0330348 3300048912 Bacteria 1439
301 Ga0496110_0062772 3300048913 Bacteria 3282
302 Ga0496111_0002528 3300048914 Bacteria 11034
303 Ga0496111_0082060 3300048914 Bacteria 2354
304 Ga0496111_0141881 3300048914 Bacteria 1780
305 Ga0496111_0251133 3300048914 Bacteria 1313
306 Ga0496112_0148621 3300048915 Bacteria 2311
307 Ga0496112_0367127 3300048915 Bacteria 1381
308 Ga0496113_0049722 3300048916 Bacteria 3123
309 Ga0496114_0024630 3300048917 Bacteria 4912
310 Ga0496114_0041967 3300048917 Bacteria 3791
311 Ga0496114_0054515 3300048917 Bacteria 3334
312 Ga0496114_0101620 3300048917 Bacteria 2455
313 Ga0496114_0149184 3300048917 Bacteria 2028
314 Ga0496114_0177867 3300048917 Bacteria 1857
315 Ga0496114_0361565 3300048917 Bacteria 1284
316 Ga0496115_0011822 3300048918 Bacteria 6557
317 Ga0496117_0046151 3300048920 Bacteria 3136
318 Ga0496118_0023337 3300048921 Bacteria 5375
319 Ga0496122_0001463 3300048925 Bacteria 38046
320 Ga0496123_0040841 3300048926 Bacteria 3225
321 Ga0501310_000249 3300049130 Bacteria 5064
322 Ga0501031_0000118 3300049568 Bacteria 43029
323 Ga0501031_0016605 3300049568 Bacteria 4780
324 Ga0501031_0032786 3300049568 Bacteria 3388
325 Ga0501031_0033672 3300049568 Bacteria 3344
326 Ga0501031_0063891 3300049568 Bacteria 2398
327 Ga0501032_0003197 3300049569 Bacteria 12614
328 Ga0501032_0050311 3300049569 Bacteria 2810
329 Ga0501033_0003499 3300049570 Bacteria 12872
330 Ga0501033_0004496 3300049570 Bacteria 11159
331 Ga0501033_0194204 3300049570 Bacteria 1452
332 Ga0501034_0004581 3300049571 Bacteria 15313
333 Ga0501034_0006318 3300049571 Bacteria 12756
334 Ga0501034_0008961 3300049571 Bacteria 10517
335 Ga0501034_0182989 3300049571 Bacteria 2060
336 Ga0501034_0249800 3300049571 Bacteria 1718
337 Ga0501036_0006799 3300049572 Bacteria 9290
338 Ga0501036_0018931 3300049572 Bacteria 5776
339 Ga0501036_0025717 3300049572 Bacteria 4968
340 Ga0501036_0236611 3300049572 Bacteria 1532
341 Ga0501037_0002139 3300049573 Bacteria 14300
342 Ga0501037_0009659 3300049573 Bacteria 7081
343 Ga0501037_0036479 3300049573 Bacteria 3623
344 Ga0501038_0000090 3300049574 Bacteria 77766
345 Ga0501038_0009168 3300049574 Bacteria 9083
346 Ga0501038_0021025 3300049574 Bacteria 5864
347 Ga0501038_0055627 3300049574 Bacteria 3398
348 Ga0501038_0062287 3300049574 Bacteria 3187
349 Ga0501039_0000116 3300049575 Bacteria 54483
350 Ga0501039_0002881 3300049575 Bacteria 12871
351 Ga0501039_0049596 3300049575 Bacteria 3245
352 Ga0501039_0068056 3300049575 Bacteria 2765
353 Ga0501039_0082637 3300049575 Bacteria 2501
354 Ga0501039_0120110 3300049575 Bacteria 2059
355 Ga0501040_0045518 3300049576 Bacteria 2993
356 Ga0501040_0122798 3300049576 Bacteria 1823
357 Ga0501041_0015575 3300049577 Bacteria 4516
358 Ga0501041_0025302 3300049577 Bacteria 3567
359 Ga0501042_0002779 3300049578 Bacteria 10817
360 Ga0501042_0009397 3300049578 Bacteria 6515
361 Ga0501042_0014912 3300049578 Bacteria 5312
362 Ga0501042_0025395 3300049578 Bacteria 4161
363 Ga0501042_0213556 3300049578 Bacteria 1391
364 Ga0501043_0000644 3300049579 Bacteria 30800
365 Ga0501043_0014824 3300049579 Bacteria 6103
366 Ga0501046_0000325 3300049580 Bacteria 47845
367 Ga0501046_0002324 3300049580 Bacteria 17916
368 Ga0501046_0002624 3300049580 Bacteria 16790
369 Ga0501046_0083180 3300049580 Bacteria 2471
370 Ga0501047_0001030 3300049581 Bacteria 27949
371 Ga0501047_0023645 3300049581 Bacteria 5900
372 Ga0501047_0092052 3300049581 Bacteria 2910
373 Ga0501048_0000275 3300049582 Bacteria 34631
374 Ga0501048_0006394 3300049582 Bacteria 8956
375 Ga0501048_0016641 3300049582 Bacteria 5422
376 Ga0501048_0026605 3300049582 Bacteria 4211
377 Ga0501048_0130692 3300049582 Bacteria 1775
378 Ga0501067_0019191 3300049583 Bacteria 3785
379 Ga0501067_0022965 3300049583 Bacteria 3454
380 Ga0501067_0131437 3300049583 Bacteria 1393
381 Ga0501068_0016371 3300049584 Bacteria 4274
382 Ga0501068_0020649 3300049584 Bacteria 3840
383 Ga0501068_0037056 3300049584 Bacteria 2919
384 Ga0501068_0042602 3300049584 Bacteria 2730
385 Ga0501068_0104310 3300049584 Bacteria 1759
386 Ga0501069_0000408 3300049585 Bacteria 19456
387 Ga0501069_0064433 3300049585 Bacteria 2048
388 Ga0501070_0000495 3300049586 Bacteria 35841
389 Ga0501070_0061682 3300049586 Bacteria 3106
390 Ga0501071_0002145 3300049587 Bacteria 11856
391 Ga0501071_0013892 3300049587 Bacteria 5498
392 Ga0501071_0043736 3300049587 Bacteria 3212
393 Ga0501071_0076458 3300049587 Bacteria 2445
394 Ga0501072_0002833 3300049588 Bacteria 13016
395 Ga0501072_0035227 3300049588 Bacteria 3923
396 Ga0501072_0055720 3300049588 Bacteria 3115
397 Ga0501072_0055880 3300049588 Bacteria 3111
398 Ga0501072_0081550 3300049588 Bacteria 2564
399 Ga0501072_0191627 3300049588 Bacteria 1630
400 Ga0501073_0012096 3300049589 Bacteria 6301
401 Ga0501074_0000159 3300049590 Bacteria 35618
402 Ga0501074_0000665 3300049590 Bacteria 21423
403 Ga0501074_0013618 3300049590 Bacteria 5911
404 Ga0501074_0035658 3300049590 Bacteria 3604
405 Ga0501074_0036352 3300049590 Bacteria 3568
406 Ga0501075_0140736 3300049591 Bacteria 1838
407 Ga0501076_0009792 3300049592 Bacteria 7079
408 Ga0501076_0021673 3300049592 Bacteria 4931
409 Ga0501076_0036195 3300049592 Bacteria 3866
410 Ga0501076_0038711 3300049592 Bacteria 3744
411 Ga0501077_0005742 3300049593 Bacteria 7557
412 Ga0501077_0074128 3300049593 Bacteria 2156
413 Ga0501077_0206670 3300049593 Bacteria 1248
414 Ga0501079_0008204 3300049741 Bacteria 7917
415 Ga0501079_0016166 3300049741 Bacteria 5703
416 Ga0501079_0040130 3300049741 Bacteria 3611
417 Ga0501079_0138229 3300049741 Bacteria 1897
418 Ga0501080_0000487 3300049742 Bacteria 30941
419 Ga0501080_0037664 3300049742 Bacteria 4516
420 Ga0501080_0310195 3300049742 Bacteria 1430
421 Ga0501080_0356167 3300049742 Bacteria 1321
422 Ga0501081_0043475 3300049743 Bacteria 3082
423 Ga0501081_0276959 3300049743 Bacteria 1228
424 Ga0501083_0004994 3300049744 Bacteria 9398
425 Ga0501083_0005118 3300049744 Bacteria 9282
426 Ga0501035_0005289 3300049822 Bacteria 12218
427 Ga0501035_0018526 3300049822 Bacteria 6413
428 Ga0501035_0065350 3300049822 Bacteria 3231
429 Ga0501044_0012940 3300049823 Bacteria 9031
430 Ga0501044_0190381 3300049823 Bacteria 2014
431 Ga0501044_0266224 3300049823 Bacteria 1651
432 Ga0501044_0365146 3300049823 Bacteria 1361
433 Ga0501045_0002943 3300049824 Bacteria 11648
434 Ga0501045_0021819 3300049824 Bacteria 4582
435 Ga0501045_0060290 3300049824 Bacteria 2781
436 Ga0501045_0096740 3300049824 Bacteria 2184
437 nmdc:mga00v17_12736_c1 3300050491 Bacteria 4646
438 nmdc:mga00v17_157481_c1 3300050491 Bacteria 1461
439 nmdc:mga00v17_18921_c1 3300050491 Bacteria 3921
440 nmdc:mga00v17_202926_c1 3300050491 Bacteria 1282
441 nmdc:mga00v17_30544_c1 3300050491 Bacteria 3171
442 nmdc:mga00v17_36636_c1 3300050491 Bacteria 2925
443 nmdc:mga00v17_5576_c1 3300050491 Bacteria 6635
444 nmdc:mga00v17_69954_c1 3300050491 Bacteria 2173
445 nmdc:mga0yw44_20216_c1 3300050492 Bacteria 3690
446 nmdc:mga0yw44_34810_c1 3300050492 Bacteria 2954
447 nmdc:mga0yw44_5093_c1 3300050492 Bacteria 6146
448 nmdc:mga0yw44_6269_c1 3300050492 Bacteria 5729
449 nmdc:mga0yw44_86985_c1 3300050492 Bacteria 1969
450 nmdc:mga04h51_3372_c1 3300050495 Bacteria 3880
451 nmdc:mga05p37_13516_c1 3300050507 Bacteria 9785
452 nmdc:mga05p37_4665_c1 3300050507 Bacteria 16015
453 nmdc:mga09592_379978_c1 3300050508 Bacteria 1221
454 nmdc:mga09592_6027_c1 3300050508 Bacteria 9888
455 nmdc:mga0qj67_130610_c1 3300050509 Bacteria 2034
456 nmdc:mga0qj67_27354_c1 3300050509 Bacteria 4420
457 nmdc:mga06r32_13347_c1 3300050510 Bacteria 7441
458 nmdc:mga06r32_3907_c1 3300050510 Bacteria 13362
459 nmdc:mga06r32_40494_c1 3300050510 Bacteria 4424
460 nmdc:mga08y16_26841_c1 3300050511 Bacteria 6069
461 nmdc:mga08y16_332704_c1 3300050511 Bacteria 1562
462 nmdc:mga08y16_65780_c1 3300050511 Bacteria 3784
463 Ga0495655_0005345 3300053083 Bacteria 2265
464 Ga0495595_0024543 3300053084 Bacteria 2664
465 Ga0500644_0000549 3300053088 Bacteria 15230
466 Ga0500650_0064178 3300053098 Bacteria 1716
467 Ga0500556_0001293 3300053104 Bacteria 11303
468 Ga0500593_000889 3300053117 Bacteria 11097
469 Ga0500559_0000846 3300053136 Bacteria 19732
470 Ga0500573_0006314 3300053140 Bacteria 6399
471 Ga0500573_0007800 3300053140 Bacteria 5861
472 Ga0500573_0023551 3300053140 Bacteria 3537
473 Ga0500573_0072446 3300053140 Bacteria 1964
474 Ga0500616_0000115 3300053153 Bacteria 147212
475 Ga0501084_0005941 3300054114 Bacteria 10051
476 Ga0501084_0044768 3300054114 Bacteria 3705
477 Ga0501084_0062763 3300054114 Bacteria 3111
478 Ga0501082_0021366 3300060353 Bacteria 5583
479 Ga0501082_0024261 3300060353 Bacteria 5228
480 Ga0501082_0104995 3300060353 Bacteria 2444
481 Ga0501082_0318623 3300060353 Bacteria 1355
482 Ga0466962_0008529 3300061719 Bacteria 4913
483 Ga0530510_0008738 3300061734 Bacteria 7084
484 2515856592 2515154155 Bacteria 7985436
485 2587863715 2585428094 Bacteria 3604039
486 2643824154 2643221561 Bacteria 4984412
487 2643876390 2643221572 Bacteria 3614809
488 2643890153 2643221576 Bacteria 5214352
489 2643959209 2643221590 Bacteria 5214697
490 2644091591 2643221615 Bacteria 5487866
491 2644096455 2643221616 Bacteria 4066575
492 2644119139 2643221620 Bacteria 5134593
493 2644229245 2643221641 Bacteria 4490190
494 2644321394 2643221657 Bacteria 5490246
495 2644383445 2643221669 Bacteria 3611286
496 2644456008 2643221681 Bacteria 3707866
497 2644533460 2643221696 Bacteria 5431823
498 2644538437 2643221697 Bacteria 3575694
499 2645720747 2643221961 Bacteria 3919167
500 2645723761 2643221962 Bacteria 3874254
501 2676473616 2675903058 Bacteria 6822861
502 2738870103 2738541305 Bacteria 4910150
503 2740167185 2739367898 Bacteria 4367674
504 2774394563 2773857762 Bacteria 5971770
505 2799184923 2799112218 Bacteria 4315149
506 2808901087 2808606372 Bacteria 4649509
507 2809194580 2808606439 Bacteria 5952208
508 2812349330 2811994878 Bacteria 5992952
509 2816421072 2816332119 Bacteria 8120218
510 2827632129 2827628540 Bacteria 6858585
511 2837269120 2837268691 Bacteria 7850704
512 2852678628 2852677369 Bacteria 3768884
513 2855390046 2855386786 Bacteria 4752232
514 2857482950 2857481737 Bacteria 4761446
515 2884766349 2884763398 Bacteria 4091164
516 2891972966 2891968417 Bacteria 5821697
517 2895660564 2895660088 Bacteria 3782833
518 2897562471 2897561785 Bacteria 3256946
519 2939659400 2939657138 Bacteria 3740283
520 2966922625 2966921586 Bacteria 3092803
521 2984577363 2984576629 Bacteria 4248407
522 2984593619 2984592036 Bacteria 3670284
523 2990259524 2990256926 Bacteria 4252839
524 8046353760 8046352972 Bacteria 3613806
525 8054613832 8054609563 Bacteria 5170090
526 Ga0466963_0114969
527 JGI24740J21852_10010365
528 JGI25164J39214_1001647
529 JGI25406J46586_10011538
530 JGI25165J46597_1000061
531 Ga0070658_10006075
532 Ga0070658_10153672
533 Ga0070683_100002149
534 Ga0070683_100041708
535 Ga0070680_100131048
536 Ga0070682_100007299
537 Ga0070682_100030231
538 Ga0070682_100083790
539 Ga0068868_100036515
540 Ga0070692_10013169
541 Ga0070668_100033454
542 Ga0070675_100247269
543 Ga0070674_100052635
544 Ga0070659_100016752
545 Ga0070667_100118852
546 Ga0070714_100019587
547 Ga0070714_100055540
548 Ga0070700_100000290
549 Ga0070663_100007483
550 Ga0070685_10160901
551 Ga0070706_100001972
552 Ga0070707_100078607
553 Ga0070698_100001704
554 Ga0070679_100002823
555 Ga0070684_100005348
556 Ga0070684_100050277
557 Ga0068853_100045488
558 Ga0068853_100282264
559 Ga0070672_100007465
560 Ga0070665_100000450
561 Ga0070665_100171656
562 Ga0068855_100131782
563 Ga0070664_100006095
564 Ga0068857_100021760
565 Ga0068854_100001458
566 Ga0068856_100031541
567 Ga0068856_100032891
568 Ga0068856_100279570
569 Ga0070702_100014725
570 Ga0068852_100020712
571 Ga0068852_100023597
572 Ga0068852_100146422
573 Ga0068861_100037759
574 Ga0068861_100068489
575 Ga0068861_100224053
576 Ga0068870_10005145
577 Ga0068860_100001548
578 Ga0068862_100100973
579 Ga0081455_10000106
580 Ga0081455_10009817
581 Ga0081455_10013452
582 Ga0081538_10000264
583 Ga0081538_10000860
584 Ga0081538_10021271
585 Ga0081539_10000238
586 Ga0081539_10078393
587 Ga0075365_10036206
588 Ga0075365_10039867
589 Ga0075365_10046971
590 Ga0075365_10071659
591 Ga0075365_10088623
592 Ga0075365_10099274
593 Ga0075365_10124797
594 Ga0075368_10007610
595 Ga0075363_100001581
596 Ga0075363_100035313
597 Ga0075363_100082595
598 Ga0075364_10012721
599 Ga0075364_10016867
600 Ga0075364_10103547
601 Ga0075364_10105946
602 Ga0075367_10007520
603 Ga0075367_10043559
604 Ga0075367_10063100
605 Ga0075428_100001401
606 Ga0075428_100004919
607 Ga0075428_100015550
608 Ga0075430_100031930
609 Ga0075430_100163301
610 Ga0075431_100004352
611 Ga0075431_100047545
612 Ga0075429_100001477
613 Ga0075429_100026537
614 Ga0068865_100020897
615 Ga0068865_100042400
616 Ga0105240_10219727
617 Ga0111539_10240375
618 Ga0111539_10413905
619 Ga0105245_10077162
620 Ga0105245_10091622
621 Ga0114129_10001245
622 Ga0114129_10161772
623 Ga0105243_10002771
624 Ga0105243_10211630
625 Ga0105241_10006434
626 Ga0105242_10136859
627 Ga0105248_10170852
628 Ga0105237_10058714
629 Ga0105237_10123710
630 Ga0105237_10256172
631 Ga0105237_10278384
632 Ga0105238_10005192
633 Ga0105249_10009259
634 Ga0105249_10091976
635 Ga0105249_10298666
636 Ga0105239_10003153
637 Ga0105239_10008340
638 Ga0105239_10083608
639 Ga0157369_10000230
640 Ga0157369_10262440
641 Ga0157374_10166511
642 Ga0163162_10010480
643 Ga0157372_10005912
644 Ga0157372_10241036
645 Ga0157375_10041301
646 Ga0157375_10128038
647 Ga0157375_10206227
648 Ga0163163_10069205
649 Ga0157380_10016580
650 Ga0157380_10068539
651 Ga0157380_10223935
652 Ga0157377_10036522
653 Ga0163161_10160810
654 Ga0213875_10009520
655 Ga0207427_100042
656 Ga0209437_100369
657 Ga0209233_1000001
658 Ga0207647_10001834
659 Ga0207647_10003693
660 Ga0207647_10008627
661 Ga0207643_10010228
662 Ga0207684_10057102
663 Ga0207654_10061771
664 Ga0207695_10014077
665 Ga0207671_10001332
666 Ga0207660_10057992
667 Ga0207662_10195561
668 Ga0207657_10158160
669 Ga0207646_10031791
670 Ga0207646_10062440
671 Ga0207694_10001646
672 Ga0207687_10016384
673 Ga0207687_10069492
674 Ga0207664_10017088
675 Ga0207664_10071239
676 Ga0207690_10031247
677 Ga0207690_10177500
678 Ga0207706_10049671
679 Ga0207709_10017470
680 Ga0207709_10021634
681 Ga0207709_10172359
682 Ga0207670_10119640
683 Ga0207669_10022453
684 Ga0207669_10099016
685 Ga0207691_10016456
686 Ga0207689_10142428
687 Ga0207661_10025386
688 Ga0207661_10032041
689 Ga0207661_10060620
690 Ga0207661_10436266
691 Ga0207679_10027233
692 Ga0207679_10136781
693 Ga0207667_10013138
694 Ga0207712_10053524
695 Ga0207712_10146215
696 Ga0207712_10239069
697 Ga0207668_10016396
698 Ga0207668_10040351
699 Ga0207640_10001609
700 Ga0207677_10232874
701 Ga0207639_10171564
702 Ga0207639_10197214
703 Ga0207639_10317268
704 Ga0207678_10249089
705 Ga0207708_10000344
706 Ga0207708_10020798
707 Ga0207708_10124956
708 Ga0207702_10209930
709 Ga0207648_10011927
710 Ga0207648_10065947
711 Ga0207674_10049344
712 Ga0207674_10085673
713 Ga0207675_100000374
714 Ga0207675_100077649
715 Ga0207698_10024526
716 Ga0207698_10050589
717 Ga0207698_10050897
718 Ga0209813_10002005
719 Ga0209974_10003176
720 Ga0207428_10050346
721 Ga0207428_10050927
722 Ga0268266_10002498
723 Ga0268266_10027269
724 Ga0268266_10187071
725 Ga0268265_10156531
726 Ga0268264_10009341
727 Ga0307512_10107638
728 Ga0316181_1293815
729 Ga0316182_1028538
730 Ga0307513_10268231
731 Ga0307408_100028106
732 Ga0307408_100041042
733 Ga0307405_10008559
734 Ga0307405_10104731
735 Ga0307410_10009751
736 Ga0307406_10000318
737 Ga0307406_10006570
738 Ga0307407_10086867
739 Ga0307407_10138516
740 Ga0307407_10218479
741 Ga0307412_10033073
742 Ga0307409_100019124
743 Ga0307409_100061402
744 Ga0307409_100158204
745 Ga0307409_100320821
746 Ga0307416_100000046
747 Ga0307416_100003618
748 Ga0307414_10000798
749 Ga0307414_10074695
750 Ga0307414_10204323
751 Ga0307414_10294487
752 Ga0307411_10022409
753 Ga0307415_100002758
754 Ga0307415_100010149
755 Ga0395900_0075701
756 Ga0395898_0121604
757 Ga0436364_0087141
758 Ga0395901_0155046
759 Ga0395901_0202861
760 Ga0436365_0287335
761 Ga0451833_0174759
762 Ga0451837_0429473
763 Ga0451853_0312407
764 Ga0439448_0003280
765 Ga0439463_000424
766 Ga0439435_0019065
767 Ga0439464_0015854
768 Ga0466965_0015387
769 Ga0466965_0030578
770 Ga0466965_0043043
771 Ga0466966_0022165
772 Ga0466966_0066381
773 Ga0466961_0003846
774 Ga0466961_0039555
775 Ga0466963_0034929
776 Ga0466964_0023818
777 Ga0466970_0002435
778 Ga0466970_0009948
779 Ga0466970_0052117
780 Ga0466957_0050944
781 Ga0466957_0107660
782 Ga0466957_0108925
783 Ga0466960_0002292
784 Ga0466960_0004971
785 Ga0466960_0008651
786 Ga0466960_0041946
787 Ga0466958_0229555
788 Ga0466967_0017968
789 Ga0466967_0032381
790 Ga0466967_0064353
791 Ga0466967_0085658
792 Ga0466967_0087189
793 Ga0466967_0125419
794 Ga0495651_0006310
795 Ga0495596_0094746
796 Ga0495628_0004033
797 Ga0495644_0053212
798 Ga0495652_0001529
799 Ga0495645_0019199
800 Ga0495633_0070777
801 Ga0495667_0203935
802 Ga0495656_0020654
803 Ga0495661_0102782
804 Ga0495657_0042306
805 Ga0495658_0062542
806 Ga0495670_0081306
807 Ga0495600_0005605
808 Ga0495604_0016701
809 Ga0495674_0214901
810 Ga0496102_0013847
811 Ga0496102_0048229
812 Ga0496102_0095031
813 Ga0496103_0146946
814 Ga0496105_0004182
815 Ga0496105_0127498
816 Ga0496106_0098332
817 Ga0496107_0019994
818 Ga0496107_0118724
819 Ga0496108_0042798
820 Ga0496108_0080243
821 Ga0496108_0273067
822 Ga0496109_0021274
823 Ga0496109_0061770
824 Ga0496109_0158773
825 Ga0496109_0330348
826 Ga0496110_0062772
827 Ga0496111_0002528
828 Ga0496111_0082060
829 Ga0496111_0141881
830 Ga0496111_0251133
831 Ga0496112_0148621
832 Ga0496112_0367127
833 Ga0496113_0049722
834 Ga0496114_0024630
835 Ga0496114_0041967
836 Ga0496114_0054515
837 Ga0496114_0101620
838 Ga0496114_0149184
839 Ga0496114_0177867
840 Ga0496114_0361565
841 Ga0496115_0011822
842 Ga0496117_0046151
843 Ga0496118_0023337
844 Ga0496122_0001463
845 Ga0496123_0040841
846 Ga0501310_000249
847 Ga0501031_0000118
848 Ga0501031_0016605
849 Ga0501031_0032786
850 Ga0501031_0033672
851 Ga0501031_0063891
852 Ga0501032_0003197
853 Ga0501032_0050311
854 Ga0501033_0003499
855 Ga0501033_0004496
856 Ga0501033_0194204
857 Ga0501034_0004581
858 Ga0501034_0006318
859 Ga0501034_0008961
860 Ga0501034_0182989
861 Ga0501034_0249800
862 Ga0501036_0006799
863 Ga0501036_0018931
864 Ga0501036_0025717
865 Ga0501036_0236611
866 Ga0501037_0002139
867 Ga0501037_0009659
868 Ga0501037_0036479
869 Ga0501038_0000090
870 Ga0501038_0009168
871 Ga0501038_0021025
872 Ga0501038_0055627
873 Ga0501038_0062287
874 Ga0501039_0000116
875 Ga0501039_0002881
876 Ga0501039_0049596
877 Ga0501039_0068056
878 Ga0501039_0082637
879 Ga0501039_0120110
880 Ga0501040_0045518
881 Ga0501040_0122798
882 Ga0501041_0015575
883 Ga0501041_0025302
884 Ga0501042_0002779
885 Ga0501042_0009397
886 Ga0501042_0014912
887 Ga0501042_0025395
888 Ga0501042_0213556
889 Ga0501043_0000644
890 Ga0501043_0014824
891 Ga0501046_0000325
892 Ga0501046_0002324
893 Ga0501046_0002624
894 Ga0501046_0083180
895 Ga0501047_0001030
896 Ga0501047_0023645
897 Ga0501047_0092052
898 Ga0501048_0000275
899 Ga0501048_0006394
900 Ga0501048_0016641
901 Ga0501048_0026605
902 Ga0501048_0130692
903 Ga0501067_0019191
904 Ga0501067_0022965
905 Ga0501067_0131437
906 Ga0501068_0016371
907 Ga0501068_0020649
908 Ga0501068_0037056
909 Ga0501068_0042602
910 Ga0501068_0104310
911 Ga0501069_0000408
912 Ga0501069_0064433
913 Ga0501070_0000495
914 Ga0501070_0061682
915 Ga0501071_0002145
916 Ga0501071_0013892
917 Ga0501071_0043736
918 Ga0501071_0076458
919 Ga0501072_0002833
920 Ga0501072_0035227
921 Ga0501072_0055720
922 Ga0501072_0055880
923 Ga0501072_0081550
924 Ga0501072_0191627
925 Ga0501073_0012096
926 Ga0501074_0000159
927 Ga0501074_0000665
928 Ga0501074_0013618
929 Ga0501074_0035658
930 Ga0501074_0036352
931 Ga0501075_0140736
932 Ga0501076_0009792
933 Ga0501076_0021673
934 Ga0501076_0036195
935 Ga0501076_0038711
936 Ga0501077_0005742
937 Ga0501077_0074128
938 Ga0501077_0206670
939 Ga0501079_0008204
940 Ga0501079_0016166
941 Ga0501079_0040130
942 Ga0501079_0138229
943 Ga0501080_0000487
944 Ga0501080_0037664
945 Ga0501080_0310195
946 Ga0501080_0356167
947 Ga0501081_0043475
948 Ga0501081_0276959
949 Ga0501083_0004994
950 Ga0501083_0005118
951 Ga0501035_0005289
952 Ga0501035_0018526
953 Ga0501035_0065350
954 Ga0501044_0012940
955 Ga0501044_0190381
956 Ga0501044_0266224
957 Ga0501044_0365146
958 Ga0501045_0002943
959 Ga0501045_0021819
960 Ga0501045_0060290
961 Ga0501045_0096740
962 nmdc:mga00v17_12736_c1
963 nmdc:mga00v17_157481_c1
964 nmdc:mga00v17_18921_c1
965 nmdc:mga00v17_202926_c1
966 nmdc:mga00v17_30544_c1
967 nmdc:mga00v17_36636_c1
968 nmdc:mga00v17_5576_c1
969 nmdc:mga00v17_69954_c1
970 nmdc:mga0yw44_20216_c1
971 nmdc:mga0yw44_34810_c1
972 nmdc:mga0yw44_5093_c1
973 nmdc:mga0yw44_6269_c1
974 nmdc:mga0yw44_86985_c1
975 nmdc:mga04h51_3372_c1
976 nmdc:mga05p37_13516_c1
977 nmdc:mga05p37_4665_c1
978 nmdc:mga09592_379978_c1
979 nmdc:mga09592_6027_c1
980 nmdc:mga0qj67_130610_c1
981 nmdc:mga0qj67_27354_c1
982 nmdc:mga06r32_13347_c1
983 nmdc:mga06r32_3907_c1
984 nmdc:mga06r32_40494_c1
985 nmdc:mga08y16_26841_c1
986 nmdc:mga08y16_332704_c1
987 nmdc:mga08y16_65780_c1
988 Ga0495655_0005345
989 Ga0495595_0024543
990 Ga0500644_0000549
991 Ga0500650_0064178
992 Ga0500556_0001293
993 Ga0500593_000889
994 Ga0500559_0000846
995 Ga0500573_0006314
996 Ga0500573_0007800
997 Ga0500573_0023551
998 Ga0500573_0072446
999 Ga0500616_0000115
1000 Ga0501084_0005941
1001 Ga0501084_0044768
1002 Ga0501084_0062763
1003 Ga0501082_0021366
1004 Ga0501082_0024261
1005 Ga0501082_0104995
1006 Ga0501082_0318623
1007 Ga0466962_0008529
1008 Ga0530510_0008738
1009 2515856592
1010 2587863715
1011 2643824154
1012 2643876390
1013 2643890153
1014 2643959209
1015 2644091591
1016 2644096455
1017 2644119139
1018 2644229245
1019 2644321394
1020 2644383445
1021 2644456008
1022 2644533460
1023 2644538437
1024 2645720747
1025 2645723761
1026 2676473616
1027 2738870103
1028 2740167185
1029 2774394563
1030 2799184923
1031 2808901087
1032 2809194580
1033 2812349330
1034 2816421072
1035 2827632129
1036 2837269120
1037 2852678628
1038 2855390046
1039 2857482950
1040 2884766349
1041 2891972966
1042 2895660564
1043 2897562471
1044 2939659400
1045 2966922625
1046 2984577363
1047 2984593619
1048 2990259524
1049 8046353760
1050 8054613832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

57

355

0.83

PF01207

Dus

Dihydrouridine synthase (Dus)

158

262

0.83

PF01645

Glu_synthase

Conserved region in glutamate synthase

219

333

0.76

PF01070

FMN_dh

FMN-dependent dehydrogenase

138

352

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.871 4 364
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.8437 4 364
3khj-assembly1.cif.gz_B c. parvum inosine monophosphate dehydrogenase bound by inhibitor c64 0.8224 32 357
5uuv-assembly1.cif.gz_A crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with a product imp and the inhibitor p182 0.8198 32 357
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8121 46 300
ID Description Score Start End Superfamily
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8962 16 364 3.20.20.70
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8811 16 364 3.20.20.70
1ypfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8071 31 357 3.20.20.70
af_Q0J4W4_4_271_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8039 46 296 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7907 46 293 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6B3FZ59-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9853 35 147
AF-A0A3D5I3P0-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9765 46 126
AF-A0A3B9VL97-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9738 61 212 GO:0003824
AF-X1NA48-F1-model_v4 Tetrapyrrole methylase domain-containing protein 0.9715 56 153 GO:0008168
AF-A0A349CSW4-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9713 43 294 GO:0003938
GO:0006183

Map