F459189

General Info

Members Datasets Scaffolds Average Seq Length
524 269 1048 346

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000011|Ga0496104_0000011_351872_353065
Length 397
Sequence VGRSNLVRNPGVAADRRITDRDEGLSVHWFLHPITSLHDLLLGWGTAGVVLWLVACILVIAVPVILSVAMYVWWERKVLGWMHVRMGPNSVGPFGLAQTFADVFKLLFKETLIPAKSSNALFVIAPLISLAPAFAAWAVIPFDDKLVLANVNAGLLYLLAMTSMGVYGIILAGWSSNSKYAFLGAMRSAAQVVSYEIAMGMALVGVLICAGSLNMSDIVLAQAGRFGPFSWFWVPLFPLFIIYFVSGVAETNRAPFDVAEGESEIVAGFHVEYSGAPFAVFFLTEYANMILISFLAAVLFLGGWLSPLHGLVTAQVSPWVDWIWTGSWXXXFVKAFGFAFFYLWFRAAFPRYRYDQIMRLGWKVYIPIAIVWIFVAGLMVYFGVVGPGTAVAAEIAQ

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
174 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
175 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
178 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
254 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
258 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
259 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
260 2643221580 Devosia sp. Root635 Isolate Unclassified
261 2643221591 Devosia sp. Root685 Isolate Unclassified
262 2643221674 Devosia sp. Root436 Isolate Unclassified
263 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
264 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
265 2884411467 Dyella sp. AD56 Isolate Rhizosphere
266 2919085039 Luteibacter sp. 1214 Isolate Unclassified
267 2919404418 Luteibacter sp. 3190 Isolate Unclassified
268 2932401849 Devosia sp. 2618 Isolate Rhizosphere
269 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.38
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.4
Nodule 0
Rhizoplane 2.86
Rhizosphere 70.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000011 3300048907 Bacteria 459358
2 JGI24736J21556_1000838 3300001904 Bacteria 5675
3 JGI24740J21852_10000470 3300001979 Bacteria 17336
4 JGI24739J22299_10000039 3300001989 Bacteria 36051
5 JGI24737J22298_10000773 3300001990 Bacteria 11314
6 JGI24737J22298_10007009 3300001990 Bacteria 3821
7 JGI24735J21928_10036346 3300002067 Bacteria 1445
8 JGI25156J39149_1001275 3300002705 Bacteria 10926
9 JGI25162J39368_1003269 3300002737 Bacteria 4932
10 JGI25154J39366_1003368 3300002738 Bacteria 3386
11 JGI25157J39369_1000792 3300002741 Bacteria 16143
12 JGI25157J39369_1001513 3300002741 Bacteria 8468
13 JGI25157J39369_1002022 3300002741 Bacteria 5868
14 JGI25163J39215_1000172 3300002771 Bacteria 25403
15 JGI25164J39214_1000243 3300002772 Bacteria 41571
16 JGI25152J39213_1000106 3300002773 Bacteria 58139
17 JGI25150J39212_1000114 3300002774 Bacteria 45745
18 JGI25151J46595_10001018 3300003187 Bacteria 21057
19 JGI25165J46597_1000058 3300003214 Bacteria 212833
20 JGI25153J46596_10000089 3300003215 Bacteria 106651
21 Ga0006562J51391_1026821 3300003578 Bacteria 13803
22 Ga0055539_1000434 3300003752 Bacteria 14786
23 Ga0055533_1000734 3300003756 Bacteria 10594
24 Ga0055533_1001197 3300003756 Bacteria 7268
25 Ga0055525_1000097 3300003759 Bacteria 137371
26 Ga0055527_1000198 3300003760 Bacteria 39703
27 Ga0055527_1000581 3300003760 Bacteria 11933
28 Ga0055535_1000034 3300003761 Bacteria 181954
29 Ga0055535_1001535 3300003761 Bacteria 11334
30 Ga0055535_1001554 3300003761 Bacteria 11198
31 Ga0055542_1000441 3300003762 Bacteria 39703
32 Ga0055542_1001429 3300003762 Bacteria 11933
33 Ga0055542_1002988 3300003762 Bacteria 4932
34 Ga0055529_1000206 3300003763 Bacteria 78192
35 Ga0055529_1001132 3300003763 Bacteria 11360
36 Ga0055529_1001145 3300003763 Bacteria 11198
37 Ga0065165_1006432 3300005262 Bacteria 6162
38 Ga0070658_10003054 3300005327 Bacteria 13838
39 Ga0070676_10096014 3300005328 Bacteria 1824
40 Ga0070683_100297778 3300005329 Bacteria 1534
41 Ga0070690_100083674 3300005330 Bacteria 2091
42 Ga0070690_100132022 3300005330 Bacteria 1688
43 Ga0070670_100067325 3300005331 Bacteria 3073
44 Ga0070666_10000003 3300005335 Bacteria 463666
45 Ga0070666_10001186 3300005335 Bacteria 15774
46 Ga0070666_10031415 3300005335 Bacteria 3505
47 Ga0070680_100340233 3300005336 Bacteria 1275
48 Ga0070682_100016342 3300005337 Bacteria 4313
49 Ga0068868_100035150 3300005338 Bacteria 3872
50 Ga0068868_100210238 3300005338 Bacteria 1626
51 Ga0070661_100151083 3300005344 Bacteria 1755
52 Ga0070661_100250527 3300005344 Bacteria 1366
53 Ga0070668_100027029 3300005347 Bacteria 4355
54 Ga0070659_100166183 3300005366 Bacteria 1806
55 Ga0070659_100206994 3300005366 Bacteria 1616
56 Ga0070667_100000084 3300005367 Bacteria 118027
57 Ga0070667_100014298 3300005367 Bacteria 6557
58 Ga0070667_100016481 3300005367 Bacteria 6115
59 Ga0070667_100111150 3300005367 Bacteria 2376
60 Ga0070708_100317262 3300005445 Bacteria 1468
61 Ga0070663_100000327 3300005455 Bacteria 24677
62 Ga0070663_100016458 3300005455 Bacteria 4804
63 Ga0070663_100081032 3300005455 Bacteria 2385
64 Ga0070663_100094284 3300005455 Bacteria 2222
65 Ga0070678_100223357 3300005456 Bacteria 1566
66 Ga0070681_10099015 3300005458 Bacteria 2862
67 Ga0070685_10005887 3300005466 Bacteria 6239
68 Ga0070684_100117554 3300005535 Bacteria 2389
69 Ga0068853_100003047 3300005539 Bacteria 12799
70 Ga0068853_100129147 3300005539 Bacteria 2260
71 Ga0070672_100085065 3300005543 Bacteria 2541
72 Ga0070696_100175760 3300005546 Bacteria 1586
73 Ga0070693_100021733 3300005547 Bacteria 3402
74 Ga0070693_100123341 3300005547 Bacteria 1610
75 Ga0070665_100000249 3300005548 Bacteria 89011
76 Ga0070665_100011121 3300005548 Bacteria 9095
77 Ga0070665_100012690 3300005548 Bacteria 8486
78 Ga0070665_100053157 3300005548 Bacteria 4062
79 Ga0070665_100054564 3300005548 Bacteria 4008
80 Ga0068855_100085755 3300005563 Bacteria 3643
81 Ga0068855_100145041 3300005563 Bacteria 2703
82 Ga0068857_100000551 3300005577 Bacteria 27318
83 Ga0068857_100210403 3300005577 Bacteria 1774
84 Ga0068854_100148962 3300005578 Bacteria 1803
85 Ga0068856_100015179 3300005614 Bacteria 7440
86 Ga0068856_100299220 3300005614 Bacteria 1626
87 Ga0068852_100075140 3300005616 Bacteria 2979
88 Ga0068852_100091697 3300005616 Bacteria 2720
89 Ga0068852_100098261 3300005616 Bacteria 2636
90 Ga0068859_100001367 3300005617 Bacteria 24845
91 Ga0068864_100199902 3300005618 Bacteria 1835
92 Ga0068864_100214956 3300005618 Bacteria 1772
93 Ga0068861_100039454 3300005719 Bacteria 3524
94 Ga0068851_10002343 3300005834 Bacteria 8336
95 Ga0068851_10059120 3300005834 Bacteria 1961
96 Ga0068870_10036373 3300005840 Bacteria 2533
97 Ga0068863_100005779 3300005841 Bacteria 12127
98 Ga0068863_100015026 3300005841 Bacteria 7437
99 Ga0068863_100078808 3300005841 Bacteria 3120
100 Ga0068858_100002098 3300005842 Bacteria 20252
101 Ga0068860_100002623 3300005843 Bacteria 18693
102 Ga0068862_100000941 3300005844 Bacteria 28057
103 Ga0081540_1001118 3300005983 Bacteria 23746
104 Ga0075369_10026204 3300006186 Bacteria 2429
105 Ga0075369_10047664 3300006186 Bacteria 1848
106 Ga0097621_100020716 3300006237 Bacteria 5071
107 Ga0097621_100192597 3300006237 Bacteria 1766
108 Ga0097621_100444829 3300006237 Bacteria 1167
109 Ga0068871_100038080 3300006358 Bacteria 3837
110 Ga0068865_100003492 3300006881 Bacteria 9421
111 Ga0068865_100018704 3300006881 Bacteria 4475
112 Ga0068865_100097302 3300006881 Bacteria 2148
113 Ga0097620_100001367 3300006931 Bacteria 24845
114 Ga0105240_10000627 3300009093 Bacteria 65150
115 Ga0105240_10026234 3300009093 Bacteria 7644
116 Ga0105240_10092205 3300009093 Bacteria 3700
117 Ga0105245_10244900 3300009098 Bacteria 1740
118 Ga0105241_10179952 3300009174 Bacteria 1753
119 Ga0105241_10223312 3300009174 Bacteria 1584
120 Ga0105248_10000418 3300009177 Bacteria 48728
121 Ga0105248_10076122 3300009177 Bacteria 3772
122 Ga0105248_10104060 3300009177 Bacteria 3200
123 Ga0105237_10000272 3300009545 Bacteria 72718
124 Ga0105237_10006138 3300009545 Bacteria 13433
125 Ga0105237_10031065 3300009545 Bacteria 5418
126 Ga0105237_10058061 3300009545 Bacteria 3872
127 Ga0105237_10136412 3300009545 Bacteria 2448
128 Ga0105238_10000920 3300009551 Bacteria 30091
129 Ga0105238_10002036 3300009551 Bacteria 20417
130 Ga0105238_10013284 3300009551 Bacteria 8310
131 Ga0105238_10043470 3300009551 Bacteria 4546
132 Ga0105238_10088699 3300009551 Bacteria 3079
133 Ga0105238_10098213 3300009551 Bacteria 2912
134 Ga0105249_10000195 3300009553 Bacteria 69709
135 Ga0105249_10027675 3300009553 Bacteria 5116
136 Ga0105239_10000044 3300010375 Bacteria 187680
137 Ga0105239_10006627 3300010375 Bacteria 13407
138 Ga0105239_10032059 3300010375 Bacteria 5775
139 Ga0105239_10103766 3300010375 Bacteria 3147
140 Ga0105239_10104427 3300010375 Bacteria 3137
141 Ga0105239_10124009 3300010375 Bacteria 2870
142 Ga0105239_10150279 3300010375 Bacteria 2599
143 Ga0105246_10052503 3300011119 Bacteria 2803
144 Ga0105246_10083077 3300011119 Bacteria 2287
145 Ga0157373_10081056 3300013100 Bacteria 2288
146 Ga0157370_10027470 3300013104 Bacteria 5611
147 Ga0157370_10030429 3300013104 Bacteria 5289
148 Ga0157370_10056246 3300013104 Bacteria 3744
149 Ga0157370_10146669 3300013104 Bacteria 2197
150 Ga0157369_10000329 3300013105 Bacteria 63484
151 Ga0157369_10000604 3300013105 Bacteria 46765
152 Ga0157369_10010381 3300013105 Bacteria 10617
153 Ga0157369_10090522 3300013105 Bacteria 3266
154 Ga0157369_10254177 3300013105 Bacteria 1834
155 Ga0157374_10308218 3300013296 Bacteria 1567
156 Ga0157378_10001163 3300013297 Bacteria 23938
157 Ga0163162_10000003 3300013306 Bacteria 698280
158 Ga0163162_10002333 3300013306 Bacteria 17809
159 Ga0163162_10022472 3300013306 Bacteria 6214
160 Ga0163162_10039066 3300013306 Bacteria 4739
161 Ga0157372_10023320 3300013307 Bacteria 6708
162 Ga0157372_10116946 3300013307 Bacteria 3057
163 Ga0157372_10233081 3300013307 Bacteria 2135
164 Ga0157375_10013024 3300013308 Bacteria 7390
165 Ga0157375_10064653 3300013308 Bacteria 3643
166 Ga0157375_10109026 3300013308 Bacteria 2864
167 Ga0163163_10000754 3300014325 Bacteria 27527
168 Ga0163163_10112048 3300014325 Bacteria 2757
169 Ga0163163_10312151 3300014325 Bacteria 1625
170 Ga0157379_10037092 3300014968 Bacteria 4346
171 Ga0157376_10002106 3300014969 Bacteria 13384
172 Ga0183369_1008 3300015685 Bacteria 346514
173 Ga0209435_104643 3300025206 Bacteria 1547
174 Ga0209760_100371 3300025207 Bacteria 11904
175 Ga0209784_100016 3300025224 Bacteria 481036
176 Ga0209674_100347 3300025226 Bacteria 26865
177 Ga0209672_100007 3300025228 Bacteria 959482
178 Ga0209672_100078 3300025228 Bacteria 156926
179 Ga0209563_100079 3300025230 Bacteria 203017
180 Ga0207427_100188 3300025231 Bacteria 63213
181 Ga0209437_100012 3300025233 Bacteria 792625
182 Ga0209258_100012 3300025242 Bacteria 825544
183 Ga0209258_100046 3300025242 Bacteria 369794
184 Ga0209258_101311 3300025242 Bacteria 9204
185 Ga0207425_1000030 3300025245 Bacteria 268200
186 Ga0209646_1001514 3300025246 Bacteria 6161
187 Ga0209646_1001986 3300025246 Bacteria 4915
188 Ga0209026_1000012 3300025250 Bacteria 480426
189 Ga0209026_1000285 3300025250 Bacteria 58221
190 Ga0209026_1000335 3300025250 Bacteria 45678
191 Ga0209677_103018 3300025253 Bacteria 5800
192 Ga0209148_1000001 3300025254 Bacteria 2545271
193 Ga0209148_1000014 3300025254 Bacteria 925277
194 Ga0209148_1000098 3300025254 Bacteria 233172
195 Ga0209759_1000356 3300025256 Bacteria 59211
196 Ga0209759_1000460 3300025256 Bacteria 46256
197 Ga0209759_1000912 3300025256 Bacteria 21915
198 Ga0209129_1000063 3300025258 Bacteria 240205
199 Ga0209129_1003433 3300025258 Bacteria 6893
200 Ga0209129_1008955 3300025258 Bacteria 2705
201 Ga0209233_1000002 3300025261 Bacteria 2501366
202 Ga0209233_1008756 3300025261 Bacteria 3110
203 Ga0209455_1000010 3300025272 Bacteria 959482
204 Ga0209455_1000039 3300025272 Bacteria 437734
205 Ga0209455_1000126 3300025272 Bacteria 165771
206 Ga0209025_1000013 3300025294 Bacteria 871757
207 Ga0209758_1000014 3300025297 Bacteria 871757
208 Ga0209758_1000535 3300025297 Bacteria 60513
209 Ga0209758_1009118 3300025297 Bacteria 6254
210 Ga0209256_1012094 3300025299 Bacteria 3357
211 Ga0207697_10085893 3300025315 Bacteria 1329
212 Ga0207656_10023650 3300025321 Bacteria 2476
213 Ga0207680_10000006 3300025903 Bacteria 635950
214 Ga0207680_10044156 3300025903 Bacteria 2619
215 Ga0207680_10208081 3300025903 Bacteria 1336
216 Ga0207647_10000111 3300025904 Bacteria 62900
217 Ga0207647_10000138 3300025904 Bacteria 57656
218 Ga0207647_10000859 3300025904 Bacteria 23543
219 Ga0207647_10023006 3300025904 Bacteria 4131
220 Ga0207645_10038319 3300025907 Bacteria 3074
221 Ga0207654_10004940 3300025911 Bacteria 6748
222 Ga0207695_10000033 3300025913 Bacteria 507477
223 Ga0207695_10000811 3300025913 Bacteria 58170
224 Ga0207695_10002522 3300025913 Bacteria 26898
225 Ga0207695_10009508 3300025913 Bacteria 12022
226 Ga0207695_10015564 3300025913 Bacteria 8948
227 Ga0207695_10021690 3300025913 Bacteria 7321
228 Ga0207695_10075292 3300025913 Bacteria 3435
229 Ga0207671_10000020 3300025914 Bacteria 309636
230 Ga0207671_10001713 3300025914 Bacteria 24767
231 Ga0207671_10012021 3300025914 Bacteria 6992
232 Ga0207671_10012358 3300025914 Bacteria 6869
233 Ga0207671_10049921 3300025914 Bacteria 3098
234 Ga0207657_10029261 3300025919 Bacteria 5016
235 Ga0207657_10181363 3300025919 Bacteria 1702
236 Ga0207649_10007346 3300025920 Bacteria 5996
237 Ga0207694_10000613 3300025924 Bacteria 32386
238 Ga0207694_10002589 3300025924 Bacteria 14673
239 Ga0207694_10017252 3300025924 Bacteria 5456
240 Ga0207694_10019900 3300025924 Bacteria 5078
241 Ga0207694_10052522 3300025924 Bacteria 3159
242 Ga0207650_10083058 3300025925 Bacteria 2433
243 Ga0207644_10016173 3300025931 Bacteria 5019
244 Ga0207644_10102697 3300025931 Bacteria 2151
245 Ga0207690_10204346 3300025932 Bacteria 1502
246 Ga0207706_10002270 3300025933 Bacteria 18770
247 Ga0207686_10010245 3300025934 Bacteria 5100
248 Ga0207686_10067404 3300025934 Bacteria 2289
249 Ga0207704_10014095 3300025938 Bacteria 4027
250 Ga0207704_10033924 3300025938 Bacteria 2908
251 Ga0207704_10054923 3300025938 Bacteria 2431
252 Ga0207704_10150126 3300025938 Bacteria 1643
253 Ga0207691_10024143 3300025940 Bacteria 5718
254 Ga0207711_10000503 3300025941 Bacteria 40349
255 Ga0207689_10114316 3300025942 Bacteria 2219
256 Ga0207661_10116788 3300025944 Bacteria 2266
257 Ga0207679_10065611 3300025945 Bacteria 2717
258 Ga0207679_10167198 3300025945 Bacteria 1807
259 Ga0207667_10026092 3300025949 Bacteria 6389
260 Ga0207712_10000277 3300025961 Bacteria 48990
261 Ga0207712_10000477 3300025961 Bacteria 33669
262 Ga0207640_10004401 3300025981 Bacteria 7636
263 Ga0207658_10000286 3300025986 Bacteria 52832
264 Ga0207658_10007375 3300025986 Bacteria 7498
265 Ga0207658_10027651 3300025986 Bacteria 3987
266 Ga0207658_10053046 3300025986 Bacteria 2994
267 Ga0207658_10306156 3300025986 Bacteria 1371
268 Ga0207703_10002250 3300026035 Bacteria 16865
269 Ga0207703_10054397 3300026035 Bacteria 3255
270 Ga0207639_10006532 3300026041 Bacteria 7931
271 Ga0207639_10009050 3300026041 Bacteria 6861
272 Ga0207639_10082184 3300026041 Bacteria 2553
273 Ga0207678_10001305 3300026067 Bacteria 23111
274 Ga0207678_10010903 3300026067 Bacteria 7985
275 Ga0207678_10114997 3300026067 Bacteria 2295
276 Ga0207702_10010360 3300026078 Bacteria 7808
277 Ga0207702_10015281 3300026078 Bacteria 6364
278 Ga0207702_10072033 3300026078 Bacteria 2977
279 Ga0207641_10010609 3300026088 Bacteria 7559
280 Ga0207641_10020369 3300026088 Bacteria 5447
281 Ga0207641_10175269 3300026088 Bacteria 1960
282 Ga0207648_10012324 3300026089 Bacteria 8004
283 Ga0207676_10186212 3300026095 Bacteria 1822
284 Ga0207674_10000218 3300026116 Bacteria 71563
285 Ga0207674_10011044 3300026116 Bacteria 10156
286 Ga0207674_10086156 3300026116 Bacteria 3136
287 Ga0207675_100143307 3300026118 Bacteria 2271
288 Ga0207683_10012320 3300026121 Bacteria 7299
289 Ga0207698_10020428 3300026142 Bacteria 4558
290 Ga0207698_10027580 3300026142 Bacteria 4034
291 Ga0207698_10073418 3300026142 Bacteria 2724
292 Ga0207698_10176521 3300026142 Bacteria 1887
293 Ga0268266_10000001 3300028379 Bacteria 4040580
294 Ga0268266_10000006 3300028379 Bacteria 1410021
295 Ga0268266_10000021 3300028379 Bacteria 522453
296 Ga0268265_10000705 3300028380 Bacteria 32878
297 Ga0268264_10014826 3300028381 Bacteria 6402
298 Ga0268264_10059505 3300028381 Bacteria 3201
299 Ga0307408_100269681 3300031548 Bacteria 1412
300 Ga0307516_10089609 3300031730 Bacteria 2906
301 Ga0307405_10288563 3300031731 Bacteria 1239
302 Ga0307413_10188775 3300031824 Bacteria 1477
303 Ga0307409_100102693 3300031995 Bacteria 2376
304 Ga0307416_100079457 3300032002 Bacteria 2764
305 Ga0307411_10069864 3300032005 Bacteria 2374
306 Ga0316583_10021856 3300032133 Bacteria 2293
307 Ga0316585_10008898 3300032137 Bacteria 2917
308 Ga0316593_10025566 3300032168 Bacteria 1881
309 Ga0307507_10055922 3300033179 Bacteria 3735
310 Ga0307510_10005227 3300033180 Bacteria 15430
311 Ga0373944_0002961 3300035089 Bacteria 4367
312 Ga0373937_0006210 3300036401 Bacteria 10295
313 Ga0373937_0165132 3300036401 Bacteria 2076
314 Ga0316582_0002013 3300036647 Bacteria 9334
315 Ga0316584_0002192 3300036712 Bacteria 12239
316 Ga0395899_0000133 3300037312 Bacteria 114879
317 Ga0395900_0000061 3300037418 Bacteria 202483
318 Ga0395898_0000034 3300037466 Bacteria 356745
319 Ga0395898_0011319 3300037466 Bacteria 9274
320 Ga0395901_0003676 3300038443 Bacteria 15470
321 Ga0395901_0019598 3300038443 Bacteria 6914
322 Ga0395901_0173604 3300038443 Bacteria 2261
323 Ga0400484_14536 3300038725 Bacteria 3540
324 Ga0400484_31941 3300038725 Bacteria 6225
325 Ga0400490_07618 3300038726 Bacteria 12059
326 Ga0400490_48105 3300038726 Bacteria 5107
327 Ga0400490_48710 3300038726 Bacteria 3914
328 Ga0400488_17203 3300038741 Bacteria 4333
329 Ga0400488_44024 3300038741 Bacteria 2938
330 Ga0400483_016549 3300039062 Bacteria 1360
331 Ga0400483_020637 3300039062 Bacteria 5772
332 Ga0400483_063183 3300039062 Bacteria 3852
333 Ga0400483_175463 3300039062 Bacteria 9698
334 Ga0400483_180247 3300039062 Bacteria 5981
335 Ga0400489_39882 3300039093 Bacteria 2181
336 Ga0400489_61315 3300039093 Bacteria 1020
337 Ga0400487_15187 3300039110 Bacteria 5482
338 Ga0400487_19458 3300039110 Bacteria 1939
339 Ga0451793_0717941 3300041452 Bacteria 1916
340 Ga0451802_1955937 3300041460 Bacteria 1403
341 Ga0451853_1910263 3300041512 Bacteria 2586
342 Ga0439448_0012442 3300042005 Bacteria 2547
343 Ga0439459_0005334 3300042438 Bacteria 2108
344 Ga0451577_0000080 3300042876 Bacteria 218034
345 Ga0451577_0105591 3300042876 Bacteria 2517
346 Ga0466972_0000555 3300044658 Bacteria 18278
347 Ga0466972_0074074 3300044658 Bacteria 1622
348 Ga0466982_0000026 3300044672 Bacteria 64525
349 Ga0466982_0004003 3300044672 Bacteria 6560
350 Ga0453683_0000049 3300044673 Bacteria 206697
351 Ga0453683_0074520 3300044673 Bacteria 2125
352 Ga0466966_0005830 3300044684 Bacteria 8119
353 Ga0466966_0012407 3300044684 Bacteria 5645
354 Ga0466961_0007984 3300044693 Bacteria 6745
355 Ga0466961_0054906 3300044693 Bacteria 2540
356 Ga0466964_0032608 3300044706 Bacteria 2070
357 Ga0466964_0034396 3300044706 Bacteria 2022
358 Ga0453684_0000286 3300044712 Bacteria 218034
359 Ga0453684_0001089 3300044712 Bacteria 85906
360 Ga0453684_0002102 3300044712 Bacteria 50310
361 Ga0453684_0017994 3300044712 Bacteria 10883
362 Ga0466968_0003504 3300044735 Bacteria 5803
363 Ga0466970_0000637 3300044765 Bacteria 17240
364 Ga0466970_0037019 3300044765 Bacteria 2585
365 Ga0466959_0030193 3300045049 Bacteria 4014
366 Ga0466959_0104537 3300045049 Bacteria 2025
367 Ga0451576_0000102 3300045051 Bacteria 218034
368 Ga0451576_0000201 3300045051 Bacteria 150175
369 Ga0495603_0129326 3300046455 Bacteria 1471
370 Ga0495638_0001668 3300046460 Bacteria 19645
371 Ga0495650_0006285 3300046471 Bacteria 7435
372 Ga0495625_0054003 3300046660 Bacteria 2871
373 Ga0495647_0004669 3300046681 Bacteria 4464
374 Ga0495658_0004687 3300046683 Bacteria 6725
375 Ga0495686_0000017 3300047472 Bacteria 435554
376 Ga0495686_0002339 3300047472 Bacteria 18107
377 Ga0496103_0019356 3300048906 Bacteria 4088
378 Ga0496103_0134676 3300048906 Bacteria 1579
379 Ga0496104_0058290 3300048907 Bacteria 3655
380 Ga0496105_0000015 3300048908 Bacteria 218758
381 Ga0496105_0002678 3300048908 Bacteria 12978
382 Ga0496109_0213705 3300048912 Bacteria 1814
383 Ga0496109_0347998 3300048912 Bacteria 1400
384 Ga0496111_0013619 3300048914 Bacteria 5540
385 Ga0496114_0153080 3300048917 Bacteria 2001
386 Ga0496115_0000065 3300048918 Bacteria 98148
387 Ga0496115_0063514 3300048918 Bacteria 2979
388 Ga0496115_0177041 3300048918 Bacteria 1764
389 Ga0496116_0059592 3300048919 Bacteria 2482
390 Ga0496117_0011886 3300048920 Bacteria 7744
391 Ga0496117_0028477 3300048920 Bacteria 4325
392 Ga0496117_0206628 3300048920 Bacteria 1104
393 Ga0496118_0001213 3300048921 Bacteria 39638
394 Ga0496118_0003656 3300048921 Bacteria 19100
395 Ga0496118_0008630 3300048921 Bacteria 10483
396 Ga0496118_0024061 3300048921 Bacteria 5268
397 Ga0496118_0033715 3300048921 Bacteria 4194
398 Ga0496118_0038877 3300048921 Bacteria 3806
399 Ga0496119_0001455 3300048922 Bacteria 28402
400 Ga0496120_0002097 3300048923 Bacteria 21371
401 Ga0496120_0017747 3300048923 Bacteria 4602
402 Ga0496121_0000045 3300048924 Bacteria 336130
403 Ga0496121_0011769 3300048924 Bacteria 9649
404 Ga0496121_0024451 3300048924 Bacteria 5775
405 Ga0496121_0048909 3300048924 Bacteria 3592
406 Ga0496122_0000440 3300048925 Bacteria 87364
407 Ga0496122_0094316 3300048925 Bacteria 2026
408 Ga0496123_0009708 3300048926 Bacteria 8625
409 Ga0496123_0048151 3300048926 Bacteria 2870
410 Ga0496125_0000149 3300048928 Bacteria 154223
411 Ga0496125_0003219 3300048928 Bacteria 20151
412 Ga0496125_0003559 3300048928 Bacteria 18765
413 Ga0496125_0049218 3300048928 Bacteria 3505
414 Ga0496126_0000185 3300048929 Bacteria 140051
415 Ga0496126_0007818 3300048929 Bacteria 11656
416 Ga0496126_0013267 3300048929 Bacteria 8396
417 Ga0496126_0052512 3300048929 Bacteria 3703
418 Ga0496126_0085853 3300048929 Bacteria 2774
419 Ga0496126_0241533 3300048929 Bacteria 1509
420 Ga0501031_0008968 3300049568 Bacteria 6505
421 Ga0501031_0058328 3300049568 Bacteria 2515
422 Ga0501032_0002397 3300049569 Bacteria 14606
423 Ga0501032_0023277 3300049569 Bacteria 4284
424 Ga0501033_0000632 3300049570 Bacteria 32512
425 Ga0501033_0001720 3300049570 Bacteria 19154
426 Ga0501033_0052577 3300049570 Bacteria 3018
427 Ga0501033_0094243 3300049570 Bacteria 2189
428 Ga0501034_0002437 3300049571 Bacteria 22445
429 Ga0501034_0014184 3300049571 Bacteria 8213
430 Ga0501034_0032522 3300049571 Bacteria 5295
431 Ga0501034_0037782 3300049571 Bacteria 4890
432 Ga0501034_0210496 3300049571 Bacteria 1899
433 Ga0501034_0237101 3300049571 Bacteria 1771
434 Ga0501036_0009385 3300049572 Bacteria 8049
435 Ga0501036_0012706 3300049572 Bacteria 6986
436 Ga0501036_0014672 3300049572 Bacteria 6530
437 Ga0501036_0156931 3300049572 Bacteria 1919
438 Ga0501037_0001300 3300049573 Bacteria 18362
439 Ga0501037_0051254 3300049573 Bacteria 3018
440 Ga0501037_0059844 3300049573 Bacteria 2778
441 Ga0501037_0103538 3300049573 Bacteria 2053
442 Ga0501037_0165993 3300049573 Bacteria 1572
443 Ga0501037_0189735 3300049573 Bacteria 1455
444 Ga0501038_0008099 3300049574 Bacteria 9671
445 Ga0501038_0024715 3300049574 Bacteria 5356
446 Ga0501038_0033953 3300049574 Bacteria 4488
447 Ga0501039_0012006 3300049575 Bacteria 6601
448 Ga0501039_0044659 3300049575 Bacteria 3424
449 Ga0501039_0108741 3300049575 Bacteria 2167
450 Ga0501042_0078705 3300049578 Bacteria 2361
451 Ga0501043_0001641 3300049579 Bacteria 19430
452 Ga0501043_0012916 3300049579 Bacteria 6526
453 Ga0501043_0108654 3300049579 Bacteria 2178
454 Ga0501046_0039684 3300049580 Bacteria 3768
455 Ga0501046_0081354 3300049580 Bacteria 2501
456 Ga0501047_0002573 3300049581 Bacteria 17317
457 Ga0501047_0018810 3300049581 Bacteria 6626
458 Ga0501047_0029549 3300049581 Bacteria 5284
459 Ga0501047_0122570 3300049581 Bacteria 2480
460 Ga0501047_0140220 3300049581 Bacteria 2296
461 Ga0501048_0092302 3300049582 Bacteria 2135
462 Ga0501067_0006199 3300049583 Bacteria 6629
463 Ga0501067_0009773 3300049583 Bacteria 5309
464 Ga0501068_0031550 3300049584 Bacteria 3147
465 Ga0501068_0048451 3300049584 Bacteria 2565
466 Ga0501069_0006685 3300049585 Bacteria 6038
467 Ga0501070_0002131 3300049586 Bacteria 17372
468 Ga0501070_0004879 3300049586 Bacteria 11462
469 Ga0501070_0013751 3300049586 Bacteria 6817
470 Ga0501070_0072077 3300049586 Bacteria 2859
471 Ga0501070_0115301 3300049586 Bacteria 2219
472 Ga0501072_0003391 3300049588 Bacteria 11986
473 Ga0501072_0045444 3300049588 Bacteria 3453
474 Ga0501073_0001213 3300049589 Bacteria 18787
475 Ga0501073_0002194 3300049589 Bacteria 14603
476 Ga0501073_0018077 3300049589 Bacteria 5098
477 Ga0501074_0033188 3300049590 Bacteria 3740
478 Ga0501074_0052277 3300049590 Bacteria 2949
479 Ga0501079_0020009 3300049741 Bacteria 5113
480 Ga0501079_0183451 3300049741 Bacteria 1633
481 Ga0501079_0187471 3300049741 Bacteria 1614
482 Ga0501080_0000791 3300049742 Bacteria 25821
483 Ga0501080_0001319 3300049742 Bacteria 20660
484 Ga0501080_0009707 3300049742 Bacteria 8789
485 Ga0501080_0069382 3300049742 Bacteria 3278
486 Ga0501080_0137298 3300049742 Bacteria 2262
487 Ga0501080_0216594 3300049742 Bacteria 1753
488 Ga0501080_0255524 3300049742 Bacteria 1597
489 Ga0501081_0284466 3300049743 Bacteria 1211
490 Ga0501083_0001078 3300049744 Bacteria 18217
491 Ga0501083_0092940 3300049744 Bacteria 1991
492 Ga0501035_0027477 3300049822 Bacteria 5200
493 Ga0501035_0044558 3300049822 Bacteria 3994
494 Ga0501035_0114691 3300049822 Bacteria 2359
495 Ga0501044_0033968 3300049823 Bacteria 5354
496 Ga0501044_0056359 3300049823 Bacteria 4035
497 Ga0501044_0217288 3300049823 Bacteria 1863
498 Ga0501044_0515665 3300049823 Bacteria 1095
499 Ga0501045_0012626 3300049824 Bacteria 5947
500 nmdc:mga0sz30_54397_c1 3300050516 Bacteria 1702
501 Ga0500610_0004715 3300053079 Bacteria 5468
502 Ga0500643_003396 3300053087 Bacteria 7696
503 Ga0500651_0000291 3300053093 Bacteria 29128
504 Ga0500651_0007304 3300053093 Bacteria 6447
505 Ga0500597_002583 3300053120 Bacteria 5080
506 Ga0500568_0001907 3300053139 Bacteria 12824
507 Ga0500604_0001314 3300053151 Bacteria 6919
508 Ga0500634_0000044 3300053161 Bacteria 56580
509 Ga0500661_003140 3300055283 Bacteria 3106
510 Ga0501082_0001359 3300060353 Bacteria 21512
511 Ga0466962_0024931 3300061719 Bacteria 2871
512 2525556898 2524614729 Bacteria 3091755
513 2595451884 2593339239 Bacteria 4124669
514 2630648494 2627854209 Bacteria 3093011
515 2643912268 2643221580 Bacteria 3816678
516 2643963461 2643221591 Bacteria 4397626
517 2644410580 2643221674 Bacteria 3919126
518 2687582691 2687453130 Bacteria 4227172
519 2884341276 2884338543 Bacteria 4610696
520 2884414006 2884411467 Bacteria 5246714
521 2919087714 2919085039 Bacteria 4532964
522 2919404958 2919404418 Bacteria 4232372
523 2932403300 2932401849 Bacteria 4262978
524 2941472728 2941471342 Bacteria 5018624
525 Ga0496104_0000011
526 JGI24736J21556_1000838
527 JGI24740J21852_10000470
528 JGI24739J22299_10000039
529 JGI24737J22298_10000773
530 JGI24737J22298_10007009
531 JGI24735J21928_10036346
532 JGI25156J39149_1001275
533 JGI25162J39368_1003269
534 JGI25154J39366_1003368
535 JGI25157J39369_1000792
536 JGI25157J39369_1001513
537 JGI25157J39369_1002022
538 JGI25163J39215_1000172
539 JGI25164J39214_1000243
540 JGI25152J39213_1000106
541 JGI25150J39212_1000114
542 JGI25151J46595_10001018
543 JGI25165J46597_1000058
544 JGI25153J46596_10000089
545 Ga0006562J51391_1026821
546 Ga0055539_1000434
547 Ga0055533_1000734
548 Ga0055533_1001197
549 Ga0055525_1000097
550 Ga0055527_1000198
551 Ga0055527_1000581
552 Ga0055535_1000034
553 Ga0055535_1001535
554 Ga0055535_1001554
555 Ga0055542_1000441
556 Ga0055542_1001429
557 Ga0055542_1002988
558 Ga0055529_1000206
559 Ga0055529_1001132
560 Ga0055529_1001145
561 Ga0065165_1006432
562 Ga0070658_10003054
563 Ga0070676_10096014
564 Ga0070683_100297778
565 Ga0070690_100083674
566 Ga0070690_100132022
567 Ga0070670_100067325
568 Ga0070666_10000003
569 Ga0070666_10001186
570 Ga0070666_10031415
571 Ga0070680_100340233
572 Ga0070682_100016342
573 Ga0068868_100035150
574 Ga0068868_100210238
575 Ga0070661_100151083
576 Ga0070661_100250527
577 Ga0070668_100027029
578 Ga0070659_100166183
579 Ga0070659_100206994
580 Ga0070667_100000084
581 Ga0070667_100014298
582 Ga0070667_100016481
583 Ga0070667_100111150
584 Ga0070708_100317262
585 Ga0070663_100000327
586 Ga0070663_100016458
587 Ga0070663_100081032
588 Ga0070663_100094284
589 Ga0070678_100223357
590 Ga0070681_10099015
591 Ga0070685_10005887
592 Ga0070684_100117554
593 Ga0068853_100003047
594 Ga0068853_100129147
595 Ga0070672_100085065
596 Ga0070696_100175760
597 Ga0070693_100021733
598 Ga0070693_100123341
599 Ga0070665_100000249
600 Ga0070665_100011121
601 Ga0070665_100012690
602 Ga0070665_100053157
603 Ga0070665_100054564
604 Ga0068855_100085755
605 Ga0068855_100145041
606 Ga0068857_100000551
607 Ga0068857_100210403
608 Ga0068854_100148962
609 Ga0068856_100015179
610 Ga0068856_100299220
611 Ga0068852_100075140
612 Ga0068852_100091697
613 Ga0068852_100098261
614 Ga0068859_100001367
615 Ga0068864_100199902
616 Ga0068864_100214956
617 Ga0068861_100039454
618 Ga0068851_10002343
619 Ga0068851_10059120
620 Ga0068870_10036373
621 Ga0068863_100005779
622 Ga0068863_100015026
623 Ga0068863_100078808
624 Ga0068858_100002098
625 Ga0068860_100002623
626 Ga0068862_100000941
627 Ga0081540_1001118
628 Ga0075369_10026204
629 Ga0075369_10047664
630 Ga0097621_100020716
631 Ga0097621_100192597
632 Ga0097621_100444829
633 Ga0068871_100038080
634 Ga0068865_100003492
635 Ga0068865_100018704
636 Ga0068865_100097302
637 Ga0097620_100001367
638 Ga0105240_10000627
639 Ga0105240_10026234
640 Ga0105240_10092205
641 Ga0105245_10244900
642 Ga0105241_10179952
643 Ga0105241_10223312
644 Ga0105248_10000418
645 Ga0105248_10076122
646 Ga0105248_10104060
647 Ga0105237_10000272
648 Ga0105237_10006138
649 Ga0105237_10031065
650 Ga0105237_10058061
651 Ga0105237_10136412
652 Ga0105238_10000920
653 Ga0105238_10002036
654 Ga0105238_10013284
655 Ga0105238_10043470
656 Ga0105238_10088699
657 Ga0105238_10098213
658 Ga0105249_10000195
659 Ga0105249_10027675
660 Ga0105239_10000044
661 Ga0105239_10006627
662 Ga0105239_10032059
663 Ga0105239_10103766
664 Ga0105239_10104427
665 Ga0105239_10124009
666 Ga0105239_10150279
667 Ga0105246_10052503
668 Ga0105246_10083077
669 Ga0157373_10081056
670 Ga0157370_10027470
671 Ga0157370_10030429
672 Ga0157370_10056246
673 Ga0157370_10146669
674 Ga0157369_10000329
675 Ga0157369_10000604
676 Ga0157369_10010381
677 Ga0157369_10090522
678 Ga0157369_10254177
679 Ga0157374_10308218
680 Ga0157378_10001163
681 Ga0163162_10000003
682 Ga0163162_10002333
683 Ga0163162_10022472
684 Ga0163162_10039066
685 Ga0157372_10023320
686 Ga0157372_10116946
687 Ga0157372_10233081
688 Ga0157375_10013024
689 Ga0157375_10064653
690 Ga0157375_10109026
691 Ga0163163_10000754
692 Ga0163163_10112048
693 Ga0163163_10312151
694 Ga0157379_10037092
695 Ga0157376_10002106
696 Ga0183369_1008
697 Ga0209435_104643
698 Ga0209760_100371
699 Ga0209784_100016
700 Ga0209674_100347
701 Ga0209672_100007
702 Ga0209672_100078
703 Ga0209563_100079
704 Ga0207427_100188
705 Ga0209437_100012
706 Ga0209258_100012
707 Ga0209258_100046
708 Ga0209258_101311
709 Ga0207425_1000030
710 Ga0209646_1001514
711 Ga0209646_1001986
712 Ga0209026_1000012
713 Ga0209026_1000285
714 Ga0209026_1000335
715 Ga0209677_103018
716 Ga0209148_1000001
717 Ga0209148_1000014
718 Ga0209148_1000098
719 Ga0209759_1000356
720 Ga0209759_1000460
721 Ga0209759_1000912
722 Ga0209129_1000063
723 Ga0209129_1003433
724 Ga0209129_1008955
725 Ga0209233_1000002
726 Ga0209233_1008756
727 Ga0209455_1000010
728 Ga0209455_1000039
729 Ga0209455_1000126
730 Ga0209025_1000013
731 Ga0209758_1000014
732 Ga0209758_1000535
733 Ga0209758_1009118
734 Ga0209256_1012094
735 Ga0207697_10085893
736 Ga0207656_10023650
737 Ga0207680_10000006
738 Ga0207680_10044156
739 Ga0207680_10208081
740 Ga0207647_10000111
741 Ga0207647_10000138
742 Ga0207647_10000859
743 Ga0207647_10023006
744 Ga0207645_10038319
745 Ga0207654_10004940
746 Ga0207695_10000033
747 Ga0207695_10000811
748 Ga0207695_10002522
749 Ga0207695_10009508
750 Ga0207695_10015564
751 Ga0207695_10021690
752 Ga0207695_10075292
753 Ga0207671_10000020
754 Ga0207671_10001713
755 Ga0207671_10012021
756 Ga0207671_10012358
757 Ga0207671_10049921
758 Ga0207657_10029261
759 Ga0207657_10181363
760 Ga0207649_10007346
761 Ga0207694_10000613
762 Ga0207694_10002589
763 Ga0207694_10017252
764 Ga0207694_10019900
765 Ga0207694_10052522
766 Ga0207650_10083058
767 Ga0207644_10016173
768 Ga0207644_10102697
769 Ga0207690_10204346
770 Ga0207706_10002270
771 Ga0207686_10010245
772 Ga0207686_10067404
773 Ga0207704_10014095
774 Ga0207704_10033924
775 Ga0207704_10054923
776 Ga0207704_10150126
777 Ga0207691_10024143
778 Ga0207711_10000503
779 Ga0207689_10114316
780 Ga0207661_10116788
781 Ga0207679_10065611
782 Ga0207679_10167198
783 Ga0207667_10026092
784 Ga0207712_10000277
785 Ga0207712_10000477
786 Ga0207640_10004401
787 Ga0207658_10000286
788 Ga0207658_10007375
789 Ga0207658_10027651
790 Ga0207658_10053046
791 Ga0207658_10306156
792 Ga0207703_10002250
793 Ga0207703_10054397
794 Ga0207639_10006532
795 Ga0207639_10009050
796 Ga0207639_10082184
797 Ga0207678_10001305
798 Ga0207678_10010903
799 Ga0207678_10114997
800 Ga0207702_10010360
801 Ga0207702_10015281
802 Ga0207702_10072033
803 Ga0207641_10010609
804 Ga0207641_10020369
805 Ga0207641_10175269
806 Ga0207648_10012324
807 Ga0207676_10186212
808 Ga0207674_10000218
809 Ga0207674_10011044
810 Ga0207674_10086156
811 Ga0207675_100143307
812 Ga0207683_10012320
813 Ga0207698_10020428
814 Ga0207698_10027580
815 Ga0207698_10073418
816 Ga0207698_10176521
817 Ga0268266_10000001
818 Ga0268266_10000006
819 Ga0268266_10000021
820 Ga0268265_10000705
821 Ga0268264_10014826
822 Ga0268264_10059505
823 Ga0307408_100269681
824 Ga0307516_10089609
825 Ga0307405_10288563
826 Ga0307413_10188775
827 Ga0307409_100102693
828 Ga0307416_100079457
829 Ga0307411_10069864
830 Ga0316583_10021856
831 Ga0316585_10008898
832 Ga0316593_10025566
833 Ga0307507_10055922
834 Ga0307510_10005227
835 Ga0373944_0002961
836 Ga0373937_0006210
837 Ga0373937_0165132
838 Ga0316582_0002013
839 Ga0316584_0002192
840 Ga0395899_0000133
841 Ga0395900_0000061
842 Ga0395898_0000034
843 Ga0395898_0011319
844 Ga0395901_0003676
845 Ga0395901_0019598
846 Ga0395901_0173604
847 Ga0400484_14536
848 Ga0400484_31941
849 Ga0400490_07618
850 Ga0400490_48105
851 Ga0400490_48710
852 Ga0400488_17203
853 Ga0400488_44024
854 Ga0400483_016549
855 Ga0400483_020637
856 Ga0400483_063183
857 Ga0400483_175463
858 Ga0400483_180247
859 Ga0400489_39882
860 Ga0400489_61315
861 Ga0400487_15187
862 Ga0400487_19458
863 Ga0451793_0717941
864 Ga0451802_1955937
865 Ga0451853_1910263
866 Ga0439448_0012442
867 Ga0439459_0005334
868 Ga0451577_0000080
869 Ga0451577_0105591
870 Ga0466972_0000555
871 Ga0466972_0074074
872 Ga0466982_0000026
873 Ga0466982_0004003
874 Ga0453683_0000049
875 Ga0453683_0074520
876 Ga0466966_0005830
877 Ga0466966_0012407
878 Ga0466961_0007984
879 Ga0466961_0054906
880 Ga0466964_0032608
881 Ga0466964_0034396
882 Ga0453684_0000286
883 Ga0453684_0001089
884 Ga0453684_0002102
885 Ga0453684_0017994
886 Ga0466968_0003504
887 Ga0466970_0000637
888 Ga0466970_0037019
889 Ga0466959_0030193
890 Ga0466959_0104537
891 Ga0451576_0000102
892 Ga0451576_0000201
893 Ga0495603_0129326
894 Ga0495638_0001668
895 Ga0495650_0006285
896 Ga0495625_0054003
897 Ga0495647_0004669
898 Ga0495658_0004687
899 Ga0495686_0000017
900 Ga0495686_0002339
901 Ga0496103_0019356
902 Ga0496103_0134676
903 Ga0496104_0058290
904 Ga0496105_0000015
905 Ga0496105_0002678
906 Ga0496109_0213705
907 Ga0496109_0347998
908 Ga0496111_0013619
909 Ga0496114_0153080
910 Ga0496115_0000065
911 Ga0496115_0063514
912 Ga0496115_0177041
913 Ga0496116_0059592
914 Ga0496117_0011886
915 Ga0496117_0028477
916 Ga0496117_0206628
917 Ga0496118_0001213
918 Ga0496118_0003656
919 Ga0496118_0008630
920 Ga0496118_0024061
921 Ga0496118_0033715
922 Ga0496118_0038877
923 Ga0496119_0001455
924 Ga0496120_0002097
925 Ga0496120_0017747
926 Ga0496121_0000045
927 Ga0496121_0011769
928 Ga0496121_0024451
929 Ga0496121_0048909
930 Ga0496122_0000440
931 Ga0496122_0094316
932 Ga0496123_0009708
933 Ga0496123_0048151
934 Ga0496125_0000149
935 Ga0496125_0003219
936 Ga0496125_0003559
937 Ga0496125_0049218
938 Ga0496126_0000185
939 Ga0496126_0007818
940 Ga0496126_0013267
941 Ga0496126_0052512
942 Ga0496126_0085853
943 Ga0496126_0241533
944 Ga0501031_0008968
945 Ga0501031_0058328
946 Ga0501032_0002397
947 Ga0501032_0023277
948 Ga0501033_0000632
949 Ga0501033_0001720
950 Ga0501033_0052577
951 Ga0501033_0094243
952 Ga0501034_0002437
953 Ga0501034_0014184
954 Ga0501034_0032522
955 Ga0501034_0037782
956 Ga0501034_0210496
957 Ga0501034_0237101
958 Ga0501036_0009385
959 Ga0501036_0012706
960 Ga0501036_0014672
961 Ga0501036_0156931
962 Ga0501037_0001300
963 Ga0501037_0051254
964 Ga0501037_0059844
965 Ga0501037_0103538
966 Ga0501037_0165993
967 Ga0501037_0189735
968 Ga0501038_0008099
969 Ga0501038_0024715
970 Ga0501038_0033953
971 Ga0501039_0012006
972 Ga0501039_0044659
973 Ga0501039_0108741
974 Ga0501042_0078705
975 Ga0501043_0001641
976 Ga0501043_0012916
977 Ga0501043_0108654
978 Ga0501046_0039684
979 Ga0501046_0081354
980 Ga0501047_0002573
981 Ga0501047_0018810
982 Ga0501047_0029549
983 Ga0501047_0122570
984 Ga0501047_0140220
985 Ga0501048_0092302
986 Ga0501067_0006199
987 Ga0501067_0009773
988 Ga0501068_0031550
989 Ga0501068_0048451
990 Ga0501069_0006685
991 Ga0501070_0002131
992 Ga0501070_0004879
993 Ga0501070_0013751
994 Ga0501070_0072077
995 Ga0501070_0115301
996 Ga0501072_0003391
997 Ga0501072_0045444
998 Ga0501073_0001213
999 Ga0501073_0002194
1000 Ga0501073_0018077
1001 Ga0501074_0033188
1002 Ga0501074_0052277
1003 Ga0501079_0020009
1004 Ga0501079_0183451
1005 Ga0501079_0187471
1006 Ga0501080_0000791
1007 Ga0501080_0001319
1008 Ga0501080_0009707
1009 Ga0501080_0069382
1010 Ga0501080_0137298
1011 Ga0501080_0216594
1012 Ga0501080_0255524
1013 Ga0501081_0284466
1014 Ga0501083_0001078
1015 Ga0501083_0092940
1016 Ga0501035_0027477
1017 Ga0501035_0044558
1018 Ga0501035_0114691
1019 Ga0501044_0033968
1020 Ga0501044_0056359
1021 Ga0501044_0217288
1022 Ga0501044_0515665
1023 Ga0501045_0012626
1024 nmdc:mga0sz30_54397_c1
1025 Ga0500610_0004715
1026 Ga0500643_003396
1027 Ga0500651_0000291
1028 Ga0500651_0007304
1029 Ga0500597_002583
1030 Ga0500568_0001907
1031 Ga0500604_0001314
1032 Ga0500634_0000044
1033 Ga0500661_003140
1034 Ga0501082_0001359
1035 Ga0466962_0024931
1036 2525556898
1037 2595451884
1038 2630648494
1039 2643912268
1040 2643963461
1041 2644410580
1042 2687582691
1043 2884341276
1044 2884414006
1045 2919087714
1046 2919404958
1047 2932403300
1048 2941472728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

55

377

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6khj-assembly1.cif.gz_A supercomplex for electron transfer 0.8259 9 328
7f9o-assembly1.cif.gz_G psi-ndh supercomplex of barley 0.8143 16 321
6l7o-assembly1.cif.gz_A cryo-em structure of cyanobacteria fd-ndh-1l complex 0.8131 8 321
8e73-assembly1.cif.gz_1M vigna radiata supercomplex i+iii2 (full bridge) 0.8102 15 325
7arb-assembly1.cif.gz_H cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.8099 16 325
ID Description Score Start End Superfamily
af_Q9EPN9_29_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3375 81 318 1.20.1070.10
af_J3KMV2_1_266_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3167 80 315 1.20.1070.10
af_Q9W0V7_212_462_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3125 79 323 1.20.1070.10
af_F4HWQ7_36_219_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3075 79 326 1.20.1070.10
af_Q7K0P4_61_310_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2971 68 248 1.20.1070.10
ID Description Score Start End GO Terms
AF-T2JZR6-F1-model_v4 NAD(P)H-quinone oxidoreductase chain 1 0.8867 14 199 GO:0003954
GO:0005886
GO:0009060
GO:0048038
AF-A0A831QKW5-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8865 12 205 GO:0003954
GO:0005886
GO:0009060
AF-A0A7Z9WU83-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8844 13 203 GO:0003954
GO:0005886
GO:0009060
AF-A0A381V6W5-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.8842 10 202 GO:0003954
GO:0009060
GO:0016020
AF-A0A7Y2I8A5-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 1.6.5.11) 0.8827 13 193 GO:0003954
GO:0005886
GO:0009060

Map