F458769

General Info

Members Datasets Scaffolds Average Seq Length
521 378 381 367

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0007042|Ga0500573_0007042_592_1872
Length 426
Sequence MKRVIAVAPSCHAALTPRQNRKFPQCTFLLLWLREILSSLAENKGIFCPQAQARETGTGETMRSHFLRVATMLATSVFTLSLAQAQEKVVNVYNWSDYIDPAIIEEFTKETGIKVVYDVYDNNEMLETKLLAGGSGYDVVVPTAPFLMRQIAAGVYQKLDKAKLPNLKNMWPEINARLATYDPGNDYAVNYMWGTTGIGYNVAKVKAALGDVPVDSWDILFKPENAKKLKTCGINILDASDETFAIGMNYIGKNPDSKVTADLEAGGKVYKTIRPNVKTFNSSAYIDELANGDSCITIGWSGDVLQAKTRAEEAKNGVEIGYAIPKEGTYLWMDNFAIPADAKNVDSAHAFINFMMKPEMIAKASDYVQYANGNLASQPLIDKAVFENPQVYPDAATLKKLFTISPYAPKEQRVLNRVWTQIKTGK

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
9 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
10 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
11 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
12 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
13 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
14 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
15 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
16 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
17 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
18 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
19 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
20 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
21 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
22 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
23 2643221558 Rhizobium sp. Root149 Isolate Unclassified
24 2643221568 Rhizobium sp. Root564 Isolate Unclassified
25 2643221582 Rhizobium sp. Root651 Isolate Unclassified
26 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
27 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
28 2643221693 Rhizobium sp. Root491 Isolate Unclassified
29 2643221719 Rhizobium sp. Root274 Isolate Unclassified
30 2643221733 Bosea sp. Root381 Isolate Unclassified
31 2643221734 Bosea sp. Root670 Isolate Unclassified
32 2643221736 Bosea sp. Root483D1 Isolate Unclassified
33 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
34 2738541293 Rhizobium sp. GV031 Isolate Unclassified
35 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
36 2773857925 Microvirga vignae BR3299 Isolate Unclassified
37 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
38 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
39 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
40 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
41 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
42 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
43 2818991467 Bosea vestrisii 3192 Isolate Unclassified
44 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
45 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
46 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
47 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
48 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
49 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
50 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
51 2841760612 Bosea sp. Tri-49 Isolate Nodule
52 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
53 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
54 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
55 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
56 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
57 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
58 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
59 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
60 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
61 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
62 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
63 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
64 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
65 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
66 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
67 2844104063 Bosea sp. Tri-39 Isolate Nodule
68 2851182111 Bosea sp. Tri-44 Isolate Nodule
69 2851246043 Bosea sp. Tri-54 Isolate Nodule
70 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
71 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
72 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
73 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
74 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
75 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
76 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
77 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
78 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
79 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
80 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
81 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
82 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
83 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
84 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
85 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
86 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
87 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
88 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
89 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
90 2902330777 Methylobacterium sp. 2A Isolate Unclassified
91 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
92 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
93 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
94 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
95 2909042592 Labrys sp. LIt4 Isolate Nodule
96 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
97 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
98 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
99 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
100 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
101 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
102 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
103 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
104 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
105 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
106 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
107 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
108 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
109 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
110 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
111 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
112 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
113 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
114 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
115 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
116 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
117 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
118 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
119 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
120 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
121 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
122 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
123 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
124 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
125 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
126 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
127 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
128 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
129 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
130 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
131 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
132 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
133 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
134 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
135 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
136 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
139 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
140 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
141 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
142 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
143 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
144 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
145 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
146 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
147 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
148 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
149 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
152 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
153 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
154 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
155 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
156 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
157 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
158 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
159 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
160 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
163 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
164 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
165 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
166 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
168 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
169 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
175 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
176 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
177 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
178 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
179 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
180 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
182 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
183 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
184 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
185 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
186 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
188 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
189 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
190 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
191 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
192 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
193 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
194 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
195 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
196 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
197 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
198 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
199 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
200 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
201 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
202 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
203 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
205 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
208 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
210 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
212 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
243 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
257 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
258 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
261 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
262 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
326 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
344 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
345 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
346 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
347 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
348 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
349 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
350 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
351 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
355 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
356 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
360 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
367 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
368 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
369 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
370 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
371 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
372 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
373 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
374 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
375 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
376 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
377 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
378 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.17
Metatranscriptomes 0.96
Isolates 26.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 19
Nodule 12.48
Rhizoplane 2.69
Rhizosphere 43.38
Stem 0
Stem Tuber 0
Unclassified 21.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4947 2010549000 Bacteria 1602
2 SwRhRL2b_contig_953756 2162886007 Bacteria 6740
3 JGI25150J39212_1000012 3300002774 Bacteria 182468
4 JGI25159J45721_1003038 3300002987 Bacteria 6071
5 JGI25151J46595_10000025 3300003187 Bacteria 213302
6 JGI25151J46595_10000040 3300003187 Bacteria 176750
7 JGI25151J46595_10000135 3300003187 Bacteria 98528
8 JGI25151J46595_10030696 3300003187 Bacteria 2110
9 JGI25153J46596_10001387 3300003215 Bacteria 14504
10 JGI25153J46596_10013643 3300003215 Bacteria 3422
11 Ga0006562J51391_1012983 3300003578 Bacteria 2860
12 Ga0006562J51391_1018538 3300003578 Bacteria 1300
13 Ga0055542_1001197 3300003762 Bacteria 14763
14 Ga0055526_1000123 3300003771 Bacteria 68503
15 Ga0055526_1002165 3300003771 Bacteria 13469
16 Ga0055526_1014229 3300003771 Bacteria 3288
17 Ga0055524_1000023 3300003775 Bacteria 221408
18 Ga0055524_1011038 3300003775 Bacteria 3556
19 Ga0055524_1015799 3300003775 Bacteria 2736
20 Ga0055536_1003136 3300003781 Bacteria 8976
21 Ga0055540_1002341 3300003792 Bacteria 10137
22 Ga0055531_10002423 3300003794 Bacteria 12481
23 Ga0058692_1012451 3300003856 Bacteria 2013
24 Ga0065165_1000139 3300005262 Bacteria 126209
25 Ga0065165_1003754 3300005262 Bacteria 10207
26 Ga0070658_10225102 3300005327 Bacteria 1587
27 Ga0070676_10024385 3300005328 Bacteria 3407
28 Ga0070670_100005820 3300005331 Bacteria 10427
29 Ga0070677_10063649 3300005333 Unclassified 1530
30 Ga0070680_100036188 3300005336 Bacteria 3987
31 Ga0070680_100098342 3300005336 Bacteria 2427
32 Ga0070660_100050845 3300005339 Bacteria 3189
33 Ga0070668_100198473 3300005347 Bacteria 1646
34 Ga0070674_100043405 3300005356 Bacteria 3059
35 Ga0070674_100092005 3300005356 Bacteria 2191
36 Ga0070678_100026333 3300005456 Bacteria 3930
37 Ga0070681_10004942 3300005458 Bacteria 12818
38 Ga0068867_100070663 3300005459 Bacteria 2610
39 Ga0070679_100127243 3300005530 Bacteria 2529
40 Ga0070697_100007366 3300005536 Bacteria 8563
41 Ga0070672_100009488 3300005543 Bacteria 6710
42 Ga0070672_100106136 3300005543 Bacteria 2285
43 Ga0070672_100160649 3300005543 Bacteria 1864
44 Ga0070695_100000088 3300005545 Bacteria 38984
45 Ga0070665_100004421 3300005548 Bacteria 14769
46 Ga0070665_100026572 3300005548 Bacteria 5829
47 Ga0068855_100045755 3300005563 Bacteria 5175
48 Ga0068855_100314190 3300005563 Bacteria 1733
49 Ga0068859_100160831 3300005617 Bacteria 2325
50 Ga0068861_100061252 3300005719 Bacteria 2887
51 Ga0068870_10042323 3300005840 Bacteria 2371
52 Ga0068863_100311126 3300005841 Bacteria 1529
53 Ga0068862_100205119 3300005844 Bacteria 1779
54 Ga0068862_100218730 3300005844 Bacteria 1724
55 Ga0081539_10098881 3300005985 Bacteria 1491
56 Ga0075365_10003001 3300006038 Bacteria 8551
57 Ga0075365_10039181 3300006038 Bacteria 3085
58 Ga0075368_10016125 3300006042 Bacteria 2781
59 Ga0075364_10030272 3300006051 Bacteria 3474
60 Ga0075364_10127330 3300006051 Bacteria 1708
61 Ga0075362_10007527 3300006177 Bacteria 4128
62 Ga0075367_10009311 3300006178 Bacteria 5129
63 Ga0075369_10016085 3300006186 Bacteria 3012
64 Ga0075366_10003531 3300006195 Bacteria 8261
65 Ga0075366_10005906 3300006195 Bacteria 6657
66 Ga0075428_100007105 3300006844 Bacteria 12399
67 Ga0075428_100065800 3300006844 Bacteria 3969
68 Ga0075428_100084689 3300006844 Bacteria 3459
69 Ga0075428_100159425 3300006844 Bacteria 2449
70 Ga0075430_100311487 3300006846 Bacteria 1302
71 Ga0075431_100211027 3300006847 Bacteria 1983
72 Ga0075429_100021811 3300006880 Bacteria 5552
73 Ga0075429_100198009 3300006880 Bacteria 1760
74 Ga0068865_100034322 3300006881 Bacteria 3403
75 Ga0068865_100081932 3300006881 Bacteria 2319
76 Ga0075436_100007352 3300006914 Bacteria 7527
77 Ga0097620_100160826 3300006931 Bacteria 2325
78 Ga0079104_1000069 3300006946 Bacteria 153993
79 Ga0099826_10000423 3300006948 Bacteria 20100
80 Ga0099826_10006813 3300006948 Bacteria 8363
81 Ga0075435_100005765 3300007076 Bacteria 8698
82 Ga0099795_10000154 3300007788 Bacteria 11507
83 Ga0111539_10193769 3300009094 Bacteria 2371
84 Ga0114129_10218146 3300009147 Bacteria 2575
85 Ga0105243_10030835 3300009148 Bacteria 4131
86 Ga0105248_10159878 3300009177 Bacteria 2541
87 Ga0105237_10131222 3300009545 Bacteria 2500
88 Ga0105238_10421620 3300009551 Bacteria 1329
89 Ga0157373_10001801 3300013100 Bacteria 16297
90 Ga0157373_10071580 3300013100 Bacteria 2449
91 Ga0157371_10000058 3300013102 Bacteria 171756
92 Ga0157370_10000792 3300013104 Bacteria 39754
93 Ga0157369_10029085 3300013105 Bacteria 6109
94 Ga0171462_1026 3300013250 Bacteria 114045
95 Ga0157378_10429732 3300013297 Bacteria 1307
96 Ga0157372_10014940 3300013307 Bacteria 8313
97 Ga0157380_10000110 3300014326 Bacteria 44612
98 Ga0157380_10039942 3300014326 Bacteria 3652
99 Ga0157380_10170724 3300014326 Bacteria 1900
100 Ga0182008_10113221 3300014497 Bacteria 1345
101 Ga0157379_10164004 3300014968 Bacteria 2006
102 Ga0182005_1008128 3300015265 Bacteria 3108
103 Ga0207425_1000012 3300025245 Bacteria 528324
104 Ga0209148_1000302 3300025254 Bacteria 70861
105 Ga0209129_1000081 3300025258 Bacteria 183694
106 Ga0209455_1000284 3300025272 Bacteria 54580
107 Ga0209673_1009294 3300025273 Bacteria 4279
108 Ga0209130_1000148 3300025284 Bacteria 109763
109 Ga0209676_1012606 3300025292 Bacteria 3306
110 Ga0209025_1000016 3300025294 Bacteria 770739
111 Ga0209025_1000024 3300025294 Bacteria 528324
112 Ga0209025_1000441 3300025294 Bacteria 81951
113 Ga0209025_1001717 3300025294 Bacteria 26581
114 Ga0209025_1004992 3300025294 Bacteria 11099
115 Ga0209025_1021294 3300025294 Bacteria 3498
116 Ga0209025_1028587 3300025294 Bacteria 2726
117 Ga0209564_1000075 3300025295 Bacteria 285760
118 Ga0209564_1000076 3300025295 Bacteria 283602
119 Ga0209758_1000046 3300025297 Bacteria 364931
120 Ga0209758_1000349 3300025297 Bacteria 84164
121 Ga0209050_1003851 3300025298 Bacteria 10683
122 Ga0209256_1000083 3300025299 Bacteria 221460
123 Ga0209256_1000359 3300025299 Bacteria 74498
124 Ga0207426_1015657 3300025302 Bacteria 2745
125 Ga0209051_1007051 3300025303 Bacteria 6217
126 Ga0209257_1002432 3300025304 Bacteria 18537
127 Ga0207688_10125529 3300025901 Bacteria 1500
128 Ga0207647_10015408 3300025904 Bacteria 5241
129 Ga0207645_10093714 3300025907 Bacteria 1932
130 Ga0207643_10095393 3300025908 Bacteria 1738
131 Ga0207707_10003784 3300025912 Bacteria 13409
132 Ga0207671_10105069 3300025914 Bacteria 2142
133 Ga0207671_10267502 3300025914 Bacteria 1346
134 Ga0207660_10185827 3300025917 Bacteria 1616
135 Ga0207681_10108565 3300025923 Bacteria 2014
136 Ga0207650_10003493 3300025925 Bacteria 10794
137 Ga0207706_10175504 3300025933 Bacteria 1882
138 Ga0207669_10040294 3300025937 Bacteria 2708
139 Ga0207704_10022453 3300025938 Bacteria 3381
140 Ga0207704_10155195 3300025938 Bacteria 1621
141 Ga0207691_10061799 3300025940 Bacteria 3402
142 Ga0207711_10034576 3300025941 Bacteria 4280
143 Ga0207667_10058371 3300025949 Bacteria 4048
144 Ga0207667_10247126 3300025949 Bacteria 1825
145 Ga0207668_10038913 3300025972 Bacteria 3196
146 Ga0207641_10393758 3300026088 Bacteria 1329
147 Ga0207648_10009205 3300026089 Bacteria 9485
148 Ga0207648_10039295 3300026089 Bacteria 4161
149 Ga0207683_10051825 3300026121 Bacteria 3595
150 Ga0209281_1000192 3300027111 Bacteria 140252
151 Ga0209371_1000009 3300027312 Bacteria 963030
152 Ga0209282_1000224 3300027666 Bacteria 29523
153 Ga0209282_1003866 3300027666 Bacteria 8997
154 Ga0209813_10005058 3300027866 Bacteria 3188
155 Ga0268266_10006291 3300028379 Bacteria 10886
156 Ga0268266_10166817 3300028379 Bacteria 1996
157 Ga0268266_10233500 3300028379 Bacteria 1695
158 Ga0307515_10000121 3300028794 Bacteria 188657
159 Ga0307515_10022158 3300028794 Bacteria 11212
160 Ga0268256_1000010 3300030500 Bacteria 963034
161 Ga0316181_1105601 3300030744 Bacteria 2235
162 Ga0265325_10002771 3300031241 Bacteria 11703
163 Ga0265316_10086042 3300031344 Bacteria 2404
164 Ga0307513_10239213 3300031456 Bacteria 1622
165 Ga0307405_10000503 3300031731 Bacteria 14736
166 Ga0307405_10153174 3300031731 Bacteria 1624
167 Ga0307406_10008743 3300031901 Bacteria 5660
168 Ga0307412_10074931 3300031911 Bacteria 2320
169 Ga0316593_10021436 3300032168 Bacteria 2020
170 Ga0307510_10058172 3300033180 Bacteria 4006
171 Ga0316582_0029156 3300036647 Bacteria 3350
172 Ga0395900_0232635 3300037418 Bacteria 1853
173 Ga0395898_0020760 3300037466 Bacteria 6668
174 Ga0395898_0138342 3300037466 Bacteria 2332
175 Ga0395905_0009097 3300037471 Bacteria 9734
176 Ga0395905_0010526 3300037471 Bacteria 8985
177 Ga0395905_0030943 3300037471 Bacteria 5040
178 Ga0237819_09965 3300038705 Bacteria 1255
179 Ga0400490_46941 3300038726 Bacteria 26888
180 Ga0400483_007838 3300039062 Bacteria 10822
181 Ga0400483_226258 3300039062 Bacteria 3927
182 Ga0436365_1043801 3300039437 Bacteria 1955
183 Ga0439465_0029797 3300041413 Bacteria 1734
184 Ga0451787_563814 3300041441 Bacteria 2257
185 Ga0451843_1173116 3300041509 Bacteria 1266
186 Ga0466972_0052312 3300044658 Bacteria 1969
187 Ga0466957_0085990 3300044842 Bacteria 1965
188 Ga0451576_0000265 3300045051 Bacteria 128030
189 Ga0451576_0079861 3300045051 Bacteria 3404
190 Ga0495638_0139146 3300046460 Bacteria 1418
191 Ga0495650_0018692 3300046471 Bacteria 3438
192 Ga0495650_0056941 3300046471 Bacteria 1584
193 Ga0495585_0014521 3300046492 Bacteria 4586
194 Ga0495610_0001297 3300046512 Bacteria 22270
195 Ga0495620_0030266 3300046515 Bacteria 2495
196 Ga0495632_0001866 3300046519 Bacteria 16907
197 Ga0495643_0044599 3300046522 Bacteria 2409
198 Ga0495643_0063350 3300046522 Bacteria 1956
199 Ga0495633_0025826 3300046558 Bacteria 2889
200 Ga0495633_0044065 3300046558 Bacteria 2115
201 Ga0495668_0038611 3300046616 Bacteria 2667
202 Ga0495625_0043273 3300046660 Bacteria 3267
203 Ga0495625_0096461 3300046660 Bacteria 2037
204 Ga0495588_0007526 3300046674 Bacteria 4960
205 Ga0495670_0020639 3300046691 Bacteria 3249
206 Ga0495649_0071464 3300046694 Bacteria 1860
207 Ga0495681_0039225 3300047470 Bacteria 2315
208 Ga0495686_0033087 3300047472 Bacteria 3341
209 Ga0496100_0067789 3300048903 Bacteria 2371
210 Ga0496104_0037235 3300048907 Bacteria 4550
211 Ga0496104_0082636 3300048907 Bacteria 3063
212 Ga0496110_0049612 3300048913 Bacteria 3683
213 Ga0496111_0000317 3300048914 Bacteria 23872
214 Ga0496114_0015966 3300048917 Bacteria 6043
215 Ga0496114_0051062 3300048917 Bacteria 3442
216 Ga0496116_0000080 3300048919 Bacteria 224530
217 Ga0496116_0002283 3300048919 Bacteria 20327
218 Ga0496116_0018419 3300048919 Bacteria 5385
219 Ga0496116_0037880 3300048919 Bacteria 3356
220 Ga0496117_0000002 3300048920 Bacteria 2483758
221 Ga0496117_0004761 3300048920 Bacteria 14728
222 Ga0496117_0017116 3300048920 Bacteria 6068
223 Ga0496117_0091729 3300048920 Bacteria 1953
224 Ga0496117_0139606 3300048920 Bacteria 1454
225 Ga0496118_0000233 3300048921 Bacteria 97731
226 Ga0496118_0046191 3300048921 Bacteria 3391
227 Ga0496118_0054136 3300048921 Bacteria 3042
228 Ga0496118_0079014 3300048921 Bacteria 2324
229 Ga0496119_0015306 3300048922 Bacteria 5918
230 Ga0496119_0032785 3300048922 Bacteria 3457
231 Ga0496119_0037288 3300048922 Bacteria 3160
232 Ga0496120_0000021 3300048923 Bacteria 250966
233 Ga0496121_0000001 3300048924 Bacteria 1830318
234 Ga0496121_0000581 3300048924 Bacteria 68614
235 Ga0496121_0004125 3300048924 Bacteria 19907
236 Ga0496121_0011874 3300048924 Bacteria 9594
237 Ga0496121_0063745 3300048924 Bacteria 3009
238 Ga0496121_0148206 3300048924 Bacteria 1731
239 Ga0496122_0000001 3300048925 Bacteria 1827766
240 Ga0496122_0000009 3300048925 Bacteria 584024
241 Ga0496122_0002628 3300048925 Bacteria 25114
242 Ga0496122_0006691 3300048925 Bacteria 13123
243 Ga0496122_0012028 3300048925 Bacteria 8676
244 Ga0496122_0017355 3300048925 Bacteria 6736
245 Ga0496122_0029836 3300048925 Bacteria 4587
246 Ga0496122_0054862 3300048925 Bacteria 2988
247 Ga0496122_0090495 3300048925 Bacteria 2088
248 Ga0496122_0094282 3300048925 Bacteria 2027
249 Ga0496123_0000001 3300048926 Bacteria 1831497
250 Ga0496123_0000020 3300048926 Bacteria 388748
251 Ga0496123_0005206 3300048926 Bacteria 13210
252 Ga0496123_0022859 3300048926 Bacteria 4803
253 Ga0496123_0027286 3300048926 Bacteria 4256
254 Ga0496124_0000063 3300048927 Bacteria 229705
255 Ga0496124_0000743 3300048927 Bacteria 53428
256 Ga0496124_0003963 3300048927 Bacteria 17651
257 Ga0496124_0015389 3300048927 Bacteria 7332
258 Ga0496124_0027813 3300048927 Bacteria 5067
259 Ga0496125_0000001 3300048928 Bacteria 1766138
260 Ga0496125_0004913 3300048928 Bacteria 15135
261 Ga0496125_0021027 3300048928 Bacteria 6100
262 Ga0496126_0000094 3300048929 Bacteria 208184
263 Ga0496126_0049838 3300048929 Bacteria 3821
264 Ga0496126_0086462 3300048929 Bacteria 2763
265 Ga0496126_0160015 3300048929 Bacteria 1925
266 Ga0496126_0238710 3300048929 Bacteria 1520
267 Ga0495678_013526 3300049459 Bacteria 3829
268 Ga0501031_0007384 3300049568 Bacteria 7164
269 Ga0501031_0092411 3300049568 Bacteria 1974
270 Ga0501032_0000234 3300049569 Bacteria 46284
271 Ga0501032_0014287 3300049569 Bacteria 5623
272 Ga0501033_0000076 3300049570 Bacteria 93921
273 Ga0501033_0018824 3300049570 Bacteria 5221
274 Ga0501034_0004294 3300049571 Bacteria 15879
275 Ga0501036_0002844 3300049572 Bacteria 13723
276 Ga0501036_0008437 3300049572 Bacteria 8442
277 Ga0501036_0020961 3300049572 Bacteria 5489
278 Ga0501037_0000812 3300049573 Bacteria 23359
279 Ga0501037_0001768 3300049573 Bacteria 15692
280 Ga0501037_0039190 3300049573 Bacteria 3490
281 Ga0501038_0000241 3300049574 Bacteria 46177
282 Ga0501038_0146392 3300049574 Bacteria 1928
283 Ga0501039_0000196 3300049575 Bacteria 43498
284 Ga0501039_0018255 3300049575 Bacteria 5383
285 Ga0501041_0039082 3300049577 Bacteria 2879
286 Ga0501042_0106898 3300049578 Bacteria 2014
287 Ga0501043_0000043 3300049579 Bacteria 115410
288 Ga0501043_0021277 3300049579 Bacteria 5084
289 Ga0501046_0006343 3300049580 Bacteria 10483
290 Ga0501046_0007918 3300049580 Bacteria 9302
291 Ga0501046_0056089 3300049580 Bacteria 3094
292 Ga0501047_0038186 3300049581 Bacteria 4645
293 Ga0501047_0082925 3300049581 Bacteria 3081
294 Ga0501048_0038039 3300049582 Bacteria 3454
295 Ga0501067_0008342 3300049583 Bacteria 5753
296 Ga0501067_0023617 3300049583 Bacteria 3408
297 Ga0501069_0000738 3300049585 Bacteria 15248
298 Ga0501070_0037807 3300049586 Bacteria 4028
299 Ga0501071_0056455 3300049587 Bacteria 2836
300 Ga0501072_0021025 3300049588 Bacteria 5060
301 Ga0501074_0005455 3300049590 Bacteria 9150
302 Ga0501074_0015022 3300049590 Bacteria 5634
303 Ga0501074_0144388 3300049590 Bacteria 1702
304 Ga0501075_0006528 3300049591 Bacteria 8031
305 Ga0501076_0002461 3300049592 Bacteria 12726
306 Ga0501077_0078056 3300049593 Bacteria 2098
307 Ga0501079_0001340 3300049741 Bacteria 17314
308 Ga0501079_0089631 3300049741 Bacteria 2382
309 Ga0501080_0016261 3300049742 Bacteria 6869
310 Ga0501081_0002949 3300049743 Bacteria 10798
311 Ga0501083_0057246 3300049744 Bacteria 2610
312 Ga0501241_005129 3300049758 Bacteria 2447
313 Ga0501275_000624 3300049772 Bacteria 3888
314 Ga0501035_0000449 3300049822 Bacteria 46083
315 Ga0501035_0059566 3300049822 Bacteria 3400
316 Ga0501044_0000658 3300049823 Bacteria 41690
317 Ga0501044_0010150 3300049823 Bacteria 10235
318 Ga0501044_0063901 3300049823 Bacteria 3758
319 Ga0501044_0109940 3300049823 Bacteria 2765
320 Ga0501045_0004681 3300049824 Bacteria 9452
321 Ga0501045_0153924 3300049824 Bacteria 1711
322 nmdc:mga03683_14306_c1 3300050489 Bacteria 2934
323 nmdc:mga03683_26397_c1 3300050489 Bacteria 2291
324 nmdc:mga03n38_134747_c1 3300050490 Bacteria 1228
325 nmdc:mga00v17_101240_c1 3300050491 Bacteria 1819
326 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
327 nmdc:mga0yw44_1105_c1 3300050492 Bacteria 10386
328 nmdc:mga0yw44_12243_c1 3300050492 Bacteria 4464
329 nmdc:mga0yw44_168471_c1 3300050492 Bacteria 1437
330 nmdc:mga0yw44_23254_c1 3300050492 Bacteria 3489
331 nmdc:mga0yw44_25320_c1 3300050492 Bacteria 3372
332 nmdc:mga0k408_194992_c1 3300050493 Bacteria 1209
333 nmdc:mga0k408_85639_c1 3300050493 Bacteria 1850
334 nmdc:mga06z11_6468_c1 3300050494 Bacteria 4772
335 nmdc:mga07m45_58732_c1 3300050496 Bacteria 2176
336 nmdc:mga07m45_96174_c1 3300050496 Bacteria 1700
337 nmdc:mga05p37_272079_c1 3300050507 Bacteria 2023
338 nmdc:mga05p37_556546_c1 3300050507 Bacteria 1304
339 nmdc:mga09592_187748_c1 3300050508 Bacteria 1789
340 nmdc:mga09592_39756_c1 3300050508 Bacteria 3951
341 nmdc:mga06r32_191165_c1 3300050510 Bacteria 2035
342 nmdc:mga0rr50_13463_c1 3300050513 Bacteria 5326
343 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
344 nmdc:mga0sz30_113975_c1 3300050516 Bacteria 1186
345 nmdc:mga0sz30_609_c1 3300050516 Bacteria 13266
346 nmdc:mga0sz30_79034_c1 3300050516 Bacteria 1422
347 Ga0500641_0021466 3300053096 Bacteria 2462
348 Ga0500556_0000336 3300053104 Bacteria 35065
349 Ga0500560_004023 3300053107 Bacteria 3065
350 Ga0500572_009225 3300053111 Bacteria 2327
351 Ga0500593_006014 3300053117 Bacteria 4831
352 Ga0500595_013116 3300053119 Bacteria 3181
353 Ga0500608_013655 3300053122 Bacteria 3605
354 Ga0500618_001151 3300053125 Bacteria 12825
355 Ga0500618_015811 3300053125 Bacteria 1899
356 Ga0500652_000003 3300053131 Bacteria 221528
357 Ga0500658_0000230 3300053134 Bacteria 26381
358 Ga0500559_0023622 3300053136 Bacteria 2610
359 Ga0500561_0000219 3300053137 Bacteria 10441
360 Ga0500573_0007042 3300053140 Bacteria 6113
361 Ga0500606_016730 3300053152 Bacteria 2159
362 Ga0500616_0015407 3300053153 Bacteria 4373
363 Ga0500622_0002153 3300053156 Bacteria 14612
364 Ga0500622_0005723 3300053156 Bacteria 7386
365 Ga0500622_0014814 3300053156 Bacteria 4180
366 Ga0500624_000320 3300053157 Bacteria 16425
367 Ga0500634_0007578 3300053161 Bacteria 5368
368 Ga0500636_0000010 3300053177 Bacteria 145932
369 Ga0500636_0006532 3300053177 Bacteria 6697
370 Ga0500636_0009314 3300053177 Bacteria 5702
371 Ga0500636_0026397 3300053177 Bacteria 3432
372 Ga0501084_0003463 3300054114 Bacteria 12814
373 Ga0501084_0032189 3300054114 Bacteria 4386
374 Ga0501084_0247180 3300054114 Bacteria 1506
375 Ga0587080_013286 3300059503 Bacteria 1259
376 Ga0587079_011547 3300059647 Bacteria 1426
377 Ga0501082_0058178 3300060353 Bacteria 3330
378 Ga0501082_0069341 3300060353 Bacteria 3035
379 Ga0501082_0104223 3300060353 Bacteria 2454
380 Ga0530510_0014358 3300061734 Bacteria 5584
381 Ga0530510_0260046 3300061734 Bacteria 1294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026088 Ga0207641_10393758 Ga0207641_103937581 314
2 3300054114 Ga0501084_0032189 Ga0501084_0032189_17_1048 314
3 3300005543 Ga0070672_100106136 Ga0070672_1001061362 330
4 3300003856 Ga0058692_1012451 Ga0058692_10124512 332
5 3300046471 Ga0495650_0056941 Ga0495650_0056941_375_1406 332
6 3300046512 Ga0495610_0001297 Ga0495610_0001297_14779_15810 332
7 3300046515 Ga0495620_0030266 Ga0495620_0030266_1121_2152 332
8 3300046519 Ga0495632_0001866 Ga0495632_0001866_13912_14943 332
9 3300046522 Ga0495643_0044599 Ga0495643_0044599_418_1449 332
10 3300047472 Ga0495686_0033087 Ga0495686_0033087_24_1055 332
11 3300049459 Ga0495678_013526 Ga0495678_013526_645_1676 332
12 3300049574 Ga0501038_0146392 Ga0501038_0146392_865_1911 332
13 3300053125 Ga0500618_015811 Ga0500618_015811_625_1656 332
14 iso_pu_bacteria 2841911363 2841917143 332
15 iso_pu_bacteria 2841917233 2841922764 332
16 3300037418 Ga0395900_0232635 Ga0395900_0232635_734_1834 336
17 3300037466 Ga0395898_0138342 Ga0395898_0138342_1076_2176 336
18 3300049568 Ga0501031_0092411 Ga0501031_0092411_22_1101 336
19 3300014326 Ga0157380_10039942 Ga0157380_100399422 337
20 3300050507 nmdc:mga05p37_556546_c1 nmdc:mga05p37_556546_c1_162_1265 337
21 3300050508 nmdc:mga09592_187748_c1 nmdc:mga09592_187748_c1_245_1348 337
22 3300060353 Ga0501082_0104223 Ga0501082_0104223_1181_2329 337
23 3300048929 Ga0496126_0049838 Ga0496126_0049838_516_1574 338
24 3300050496 nmdc:mga07m45_58732_c1 nmdc:mga07m45_58732_c1_135_1271 338
25 3300006195 Ga0075366_10003531 Ga0075366_100035317 339
26 3300009094 Ga0111539_10193769 Ga0111539_101937691 339
27 3300049568 Ga0501031_0007384 Ga0501031_0007384_3701_4792 339
28 3300049569 Ga0501032_0000234 Ga0501032_0000234_18852_19943 339
29 3300049570 Ga0501033_0000076 Ga0501033_0000076_53721_54812 339
30 3300049572 Ga0501036_0002844 Ga0501036_0002844_3439_4530 339
31 3300049573 Ga0501037_0000812 Ga0501037_0000812_3452_4543 339
32 3300049574 Ga0501038_0000241 Ga0501038_0000241_26228_27319 339
33 3300049575 Ga0501039_0000196 Ga0501039_0000196_26376_27467 339
34 3300049579 Ga0501043_0000043 Ga0501043_0000043_58444_59535 339
35 3300049822 Ga0501035_0000449 Ga0501035_0000449_26261_27352 339
36 3300049823 Ga0501044_0010150 Ga0501044_0010150_9074_10165 339
37 3300049824 Ga0501045_0153924 Ga0501045_0153924_546_1637 339
38 3300037466 Ga0395898_0020760 Ga0395898_0020760_4886_5989 340
39 3300048919 Ga0496116_0037880 Ga0496116_0037880_2178_3233 340
40 3300049581 Ga0501047_0038186 Ga0501047_0038186_1816_2928 340
41 3300049583 Ga0501067_0008342 Ga0501067_0008342_3576_4688 340
42 3300050516 nmdc:mga0sz30_113975_c1 nmdc:mga0sz30_113975_c1_56_1135 340
43 3300003215 JGI25153J46596_10013643 JGI25153J46596_100136432 341
44 3300005563 Ga0068855_100314190 Ga0068855_1003141902 341
45 3300025297 Ga0209758_1000349 Ga0209758_100034963 341
46 3300025298 Ga0209050_1003851 Ga0209050_10038517 341
47 3300025303 Ga0209051_1007051 Ga0209051_10070512 341
48 3300025304 Ga0209257_1002432 Ga0209257_100243214 341
49 3300025949 Ga0207667_10247126 Ga0207667_102471262 341
50 3300049758 Ga0501241_005129 Ga0501241_005129_433_1530 341
51 3300041413 Ga0439465_0029797 Ga0439465_0029797_562_1659 342
52 3300046522 Ga0495643_0063350 Ga0495643_0063350_846_1913 342
53 3300048922 Ga0496119_0037288 Ga0496119_0037288_741_1811 342
54 3300048925 Ga0496122_0006691 Ga0496122_0006691_107_1177 342
55 3300044842 Ga0466957_0085990 Ga0466957_0085990_684_1811 343
56 3300041441 Ga0451787_563814 Ga0451787_563814_1018_2094 344
57 3300041509 Ga0451843_1173116 Ga0451843_1173116_40_1116 344
58 3300046471 Ga0495650_0018692 Ga0495650_0018692_1121_2197 344
59 3300046616 Ga0495668_0038611 Ga0495668_0038611_813_1889 344
60 3300046691 Ga0495670_0020639 Ga0495670_0020639_1638_2714 344
61 3300046694 Ga0495649_0071464 Ga0495649_0071464_602_1678 344
62 3300049573 Ga0501037_0001768 Ga0501037_0001768_14109_15230 344
63 3300049579 Ga0501043_0021277 Ga0501043_0021277_865_1986 344
64 3300049586 Ga0501070_0037807 Ga0501070_0037807_47_1168 344
65 3300049822 Ga0501035_0059566 Ga0501035_0059566_1817_2938 344
66 3300050489 nmdc:mga03683_26397_c1 nmdc:mga03683_26397_c1_672_1748 344
67 3300050490 nmdc:mga03n38_134747_c1 nmdc:mga03n38_134747_c1_12_1088 344
68 3300050492 nmdc:mga0yw44_23254_c1 nmdc:mga0yw44_23254_c1_469_1545 344
69 3300050493 nmdc:mga0k408_85639_c1 nmdc:mga0k408_85639_c1_590_1666 344
70 3300050516 nmdc:mga0sz30_79034_c1 nmdc:mga0sz30_79034_c1_335_1405 344
71 3300053134 Ga0500658_0000230 Ga0500658_0000230_6122_7198 344
72 3300053152 Ga0500606_016730 Ga0500606_016730_533_1609 344
73 3300053156 Ga0500622_0014814 Ga0500622_0014814_1326_2402 344
74 iso_pu_bacteria 2508501050 2508734466 344
75 iso_pu_bacteria 2508501114 2509075122 344
76 iso_pu_bacteria 2773857925 2774869535 344
77 iso_pu_bacteria 2775506901 2776257282 344
78 iso_pu_bacteria 2882456835 2882458786 344
79 iso_pu_bacteria 2894232714 2894241224 344
80 3300005336 Ga0070680_100098342 Ga0070680_1000983422 345
81 3300025901 Ga0207688_10125529 Ga0207688_101255292 345
82 3300025908 Ga0207643_10095393 Ga0207643_100953932 345
83 3300025912 Ga0207707_10003784 Ga0207707_100037842 345
84 iso_pu_bacteria 2894652903 2894655394 345
85 3300005347 Ga0070668_100198473 Ga0070668_1001984732 346
86 3300014326 Ga0157380_10170724 Ga0157380_101707242 346
87 3300014497 Ga0182008_10113221 Ga0182008_101132211 346
88 3300031911 Ga0307412_10074931 Ga0307412_100749312 346
89 3300044658 Ga0466972_0052312 Ga0466972_0052312_203_1288 346
90 3300049580 Ga0501046_0056089 Ga0501046_0056089_1331_2416 346
91 3300054114 Ga0501084_0247180 Ga0501084_0247180_237_1322 346
92 3300061734 Ga0530510_0260046 Ga0530510_0260046_191_1276 346
93 iso_pu_bacteria 2513237087 2513593692 346
94 iso_pu_bacteria 2828305725 2828306492 346
95 iso_pu_bacteria 2919450847 2919454477 346
96 iso_pu_bacteria 2939669807 2939672844 346
97 iso_pu_bacteria 8001845381 8001848310 346
98 3300005456 Ga0070678_100026333 Ga0070678_1000263334 347
99 3300005563 Ga0068855_100045755 Ga0068855_1000457555 347
100 3300013307 Ga0157372_10014940 Ga0157372_100149405 347
101 3300025949 Ga0207667_10058371 Ga0207667_100583712 347
102 3300026121 Ga0207683_10051825 Ga0207683_100518252 347
103 3300027312 Ga0209371_1000009 Ga0209371_1000009429 347
104 3300049571 Ga0501034_0004294 Ga0501034_0004294_1536_2618 347
105 iso_pu_bacteria 2513237085 2513580217 347
106 iso_pu_bacteria 2582581299 2585233192 347
107 iso_pu_bacteria 2585427594 2585844656 347
108 iso_pu_bacteria 2643221634 2644190584 347
109 iso_pu_bacteria 2738541293 2738801244 347
110 iso_pu_bacteria 3005409236 3005411228 347
111 2162886007 SwRhRL2b_contig_953756 SwRhRL2b_0708.00001090 348
112 3300005536 Ga0070697_100007366 Ga0070697_1000073665 348
113 3300005545 Ga0070695_100000088 Ga0070695_10000008826 348
114 3300006914 Ga0075436_100007352 Ga0075436_1000073527 348
115 3300007076 Ga0075435_100005765 Ga0075435_1000057657 348
116 3300048924 Ga0496121_0063745 Ga0496121_0063745_753_1841 348
117 3300049569 Ga0501032_0014287 Ga0501032_0014287_3048_4220 348
118 3300049570 Ga0501033_0018824 Ga0501033_0018824_3185_4357 348
119 3300049572 Ga0501036_0008437 Ga0501036_0008437_1824_2996 348
120 3300049580 Ga0501046_0007918 Ga0501046_0007918_5346_6518 348
121 3300049581 Ga0501047_0082925 Ga0501047_0082925_1817_2989 348
122 3300049585 Ga0501069_0000738 Ga0501069_0000738_3185_4357 348
123 3300049590 Ga0501074_0015022 Ga0501074_0015022_3185_4357 348
124 3300049772 Ga0501275_000624 Ga0501275_000624_623_1750 348
125 3300049823 Ga0501044_0063901 Ga0501044_0063901_2494_3666 348
126 3300050513 nmdc:mga0rr50_13463_c1 nmdc:mga0rr50_13463_c1_3747_4844 348
127 3300050514 nmdc:mga08x19_24_c1 nmdc:mga08x19_24_c1_55050_56147 348
128 3300060353 Ga0501082_0058178 Ga0501082_0058178_343_1515 348
129 iso_pu_bacteria 2599185236 2599719553 348
130 iso_pu_bacteria 2671180139 2671694876 348
131 iso_pu_bacteria 2821123053 2821123635 348
132 iso_pu_bacteria 2838736955 2838739331 348
133 iso_pu_bacteria 2841840854 2841843229 348
134 iso_pu_bacteria 2842140634 2842143011 348
135 iso_pu_bacteria 2857531043 2857531199 348
136 iso_pu_bacteria 2899803654 2899805270 348
137 iso_pu_bacteria 8018150411 8018153606 348
138 3300003578 Ga0006562J51391_1012983 Ga0006562J51391_10129831 349
139 3300003775 Ga0055524_1015799 Ga0055524_10157992 349
140 3300025294 Ga0209025_1028587 Ga0209025_10285873 349
141 3300038726 Ga0400490_46941 Ga0400490_46941_5575_6663 349
142 3300039062 Ga0400483_007838 Ga0400483_007838_4103_5191 349
143 3300039062 Ga0400483_226258 Ga0400483_226258_2500_3588 349
144 3300045051 Ga0451576_0079861 Ga0451576_0079861_654_1799 349
145 3300046660 Ga0495625_0096461 Ga0495625_0096461_555_1646 349
146 3300049583 Ga0501067_0023617 Ga0501067_0023617_1064_2236 349
147 3300049741 Ga0501079_0089631 Ga0501079_0089631_47_1219 349
148 iso_pu_bacteria 2510461069 2510839826 349
149 iso_pu_bacteria 2510917026 2511171324 349
150 iso_pu_bacteria 2537561587 2537872803 349
151 iso_pu_bacteria 2554235003 2554246640 349
152 iso_pu_bacteria 2558860242 2559293868 349
153 iso_pu_bacteria 2558860983 2561466892 349
154 iso_pu_bacteria 2585427633 2585994396 349
155 iso_pu_bacteria 2585427634 2585998855 349
156 iso_pu_bacteria 2599185210 2599605417 349
157 iso_pu_bacteria 2600254933 2600374697 349
158 iso_pu_bacteria 2600255279 2601609159 349
159 iso_pu_bacteria 2600255308 2601745934 349
160 iso_pu_bacteria 2643221568 2643856339 349
161 iso_pu_bacteria 2643221582 2643921144 349
162 iso_pu_bacteria 2643221653 2644297632 349
163 iso_pu_bacteria 2643221693 2644519218 349
164 iso_pu_bacteria 2643221719 2644655885 349
165 iso_pu_bacteria 2738541317 2738948223 349
166 iso_pu_bacteria 2775507049 2776912088 349
167 iso_pu_bacteria 2808606387 2808986356 349
168 iso_pu_bacteria 2818991272 2819243290 349
169 iso_pu_bacteria 2818991439 2819556487 349
170 iso_pu_bacteria 2818991461 2819686316 349
171 iso_pu_bacteria 2838675328 2838677216 349
172 iso_pu_bacteria 2838714209 2838716104 349
173 iso_pu_bacteria 2838719591 2838720096 349
174 iso_pu_bacteria 2838724970 2838726856 349
175 iso_pu_bacteria 2841846520 2841847029 349
176 iso_pu_bacteria 2841859092 2841860441 349
177 iso_pu_bacteria 2842124991 2842126942 349
178 iso_pu_bacteria 2842130223 2842132109 349
179 iso_pu_bacteria 2842152218 2842152722 349
180 iso_pu_bacteria 2842170452 2842172349 349
181 iso_pu_bacteria 2842175837 2842176341 349
182 iso_pu_bacteria 2842187318 2842189211 349
183 iso_pu_bacteria 2842211629 2842213525 349
184 iso_pu_bacteria 2842224351 2842224857 349
185 iso_pu_bacteria 2842515876 2842517226 349
186 iso_pu_bacteria 2854896431 2854898263 349
187 iso_pu_bacteria 2854916844 2854920039 349
188 iso_pu_bacteria 2871488783 2871491395 349
189 iso_pu_bacteria 2876392853 2876398230 349
190 iso_pu_bacteria 2878753008 2878759508 349
191 iso_pu_bacteria 2881161766 2881167233 349
192 iso_pu_bacteria 2881853255 2881853733 349
193 iso_pu_bacteria 2882912400 2882913077 349
194 iso_pu_bacteria 2885305155 2885306716 349
195 iso_pu_bacteria 2885326080 2885328675 349
196 iso_pu_bacteria 2885334103 2885338816 349
197 iso_pu_bacteria 2885350715 2885353002 349
198 iso_pu_bacteria 2899792073 2899792507 349
199 iso_pu_bacteria 2899845264 2899847903 349
200 iso_pu_bacteria 2903448605 2903453191 349
201 iso_pu_bacteria 2903492973 2903494540 349
202 iso_pu_bacteria 2904659560 2904664785 349
203 iso_pu_bacteria 2913308742 2913313436 349
204 iso_pu_bacteria 2919114240 2919116307 349
205 iso_pu_bacteria 2919166419 2919166894 349
206 iso_pu_bacteria 2919171160 2919172090 349
207 iso_pu_bacteria 2926754445 2926757261 349
208 iso_pu_bacteria 2926760298 2926761476 349
209 iso_pu_bacteria 2929138655 2929138986 349
210 iso_pu_bacteria 2933006813 2933007367 349
211 iso_pu_bacteria 2933011516 2933015040 349
212 iso_pu_bacteria 2933594066 2933594575 349
213 iso_pu_bacteria 2961114664 2961119784 349
214 iso_pu_bacteria 2961170736 2961170988 349
215 iso_pu_bacteria 2968003550 2968010283 349
216 iso_pu_bacteria 2968083720 2968086557 349
217 iso_pu_bacteria 2968110612 2968116141 349
218 iso_pu_bacteria 2970503327 2970503582 349
219 iso_pu_bacteria 2970524798 2970527913 349
220 iso_pu_bacteria 2977821940 2977828031 349
221 iso_pu_bacteria 2978969890 2978973311 349
222 iso_pu_bacteria 2979089926 2979093236 349
223 iso_pu_bacteria 2979095461 2979099379 349
224 iso_pu_bacteria 2979808191 2979808218 349
225 iso_pu_bacteria 2984509177 2984512937 349
226 iso_pu_bacteria 2984518228 2984520699 349
227 iso_pu_bacteria 2984537506 2984539991 349
228 iso_pu_bacteria 2984587000 2984591592 349
229 iso_pu_bacteria 2984601300 2984602182 349
230 iso_pu_bacteria 2989776772 2989777426 349
231 iso_pu_bacteria 3000135777 3000137280 349
232 iso_pu_bacteria 637000159 637078862 349
233 iso_pu_bacteria 650716007 650739059 349
234 iso_pu_bacteria 8003570095 8003572691 349
235 iso_pu_bacteria 8004374579 8004381011 349
236 iso_pu_bacteria 8005246636 8005247383 349
237 iso_pu_bacteria 8005658619 8005660393 349
238 iso_pu_bacteria 8054460903 8054461320 349
239 iso_pu_bacteria 8055431914 8055433417 349
240 iso_pu_bacteria 8056875544 8056879031 349
241 3300005327 Ga0070658_10225102 Ga0070658_102251022 350
242 3300005336 Ga0070680_100036188 Ga0070680_1000361882 350
243 3300005339 Ga0070660_100050845 Ga0070660_1000508453 350
244 3300005530 Ga0070679_100127243 Ga0070679_1001272431 350
245 3300005617 Ga0068859_100160831 Ga0068859_1001608312 350
246 3300005844 Ga0068862_100205119 Ga0068862_1002051192 350
247 3300006178 Ga0075367_10009311 Ga0075367_100093113 350
248 3300006844 Ga0075428_100007105 Ga0075428_1000071051 350
249 3300006931 Ga0097620_100160826 Ga0097620_1001608262 350
250 3300015265 Ga0182005_1008128 Ga0182005_10081282 350
251 3300028794 Ga0307515_10022158 Ga0307515_100221589 350
252 3300031344 Ga0265316_10086042 Ga0265316_100860422 350
253 3300032168 Ga0316593_10021436 Ga0316593_100214362 350
254 3300038705 Ga0237819_09965 Ga0237819_09965_32_1126 350
255 3300039437 Ga0436365_1043801 Ga0436365_1043801_394_1488 350
256 3300048907 Ga0496104_0037235 Ga0496104_0037235_2081_3184 350
257 3300048917 Ga0496114_0015966 Ga0496114_0015966_761_1864 350
258 3300048924 Ga0496121_0148206 Ga0496121_0148206_548_1654 350
259 3300048929 Ga0496126_0160015 Ga0496126_0160015_424_1566 350
260 3300053096 Ga0500641_0021466 Ga0500641_0021466_1350_2447 350
261 3300053119 Ga0500595_013116 Ga0500595_013116_374_1474 350
262 3300053131 Ga0500652_000003 Ga0500652_000003_55346_56446 350
263 3300053177 Ga0500636_0026397 Ga0500636_0026397_92_1192 350
264 iso_pu_bacteria 2917554339 2917555970 350
265 3300002774 JGI25150J39212_1000012 JGI25150J39212_100001285 351
266 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025125 351
267 3300003215 JGI25153J46596_10001387 JGI25153J46596_100013873 351
268 3300003578 Ga0006562J51391_1018538 Ga0006562J51391_10185381 351
269 3300003771 Ga0055526_1014229 Ga0055526_10142292 351
270 3300005331 Ga0070670_100005820 Ga0070670_1000058206 351
271 3300005458 Ga0070681_10004942 Ga0070681_100049427 351
272 3300005543 Ga0070672_100160649 Ga0070672_1001606492 351
273 3300005841 Ga0068863_100311126 Ga0068863_1003111261 351
274 3300005985 Ga0081539_10098881 Ga0081539_100988812 351
275 3300006846 Ga0075430_100311487 Ga0075430_1003114872 351
276 3300007788 Ga0099795_10000154 Ga0099795_100001546 351
277 3300009147 Ga0114129_10218146 Ga0114129_102181463 351
278 3300009177 Ga0105248_10159878 Ga0105248_101598783 351
279 3300014968 Ga0157379_10164004 Ga0157379_101640042 351
280 3300025245 Ga0207425_1000012 Ga0207425_1000012287 351
281 3300025258 Ga0209129_1000081 Ga0209129_100008174 351
282 3300025273 Ga0209673_1009294 Ga0209673_10092942 351
283 3300025294 Ga0209025_1000024 Ga0209025_1000024287 351
284 3300025297 Ga0209758_1000046 Ga0209758_1000046255 351
285 3300025914 Ga0207671_10105069 Ga0207671_101050692 351
286 3300025925 Ga0207650_10003493 Ga0207650_100034934 351
287 3300025941 Ga0207711_10034576 Ga0207711_100345763 351
288 3300028379 Ga0268266_10233500 Ga0268266_102335002 351
289 3300031241 Ga0265325_10002771 Ga0265325_100027713 351
290 3300031731 Ga0307405_10000503 Ga0307405_100005033 351
291 3300031901 Ga0307406_10008743 Ga0307406_100087433 351
292 3300033180 Ga0307510_10058172 Ga0307510_100581724 351
293 3300046492 Ga0495585_0014521 Ga0495585_0014521_1622_2719 351
294 3300046558 Ga0495633_0025826 Ga0495633_0025826_340_1437 351
295 3300046660 Ga0495625_0043273 Ga0495625_0043273_1720_2817 351
296 3300048903 Ga0496100_0067789 Ga0496100_0067789_302_1414 351
297 3300048907 Ga0496104_0082636 Ga0496104_0082636_535_1647 351
298 3300048917 Ga0496114_0051062 Ga0496114_0051062_1707_2819 351
299 3300048919 Ga0496116_0002283 Ga0496116_0002283_10082_11179 351
300 3300048920 Ga0496117_0004761 Ga0496117_0004761_11557_12654 351
301 3300048920 Ga0496117_0017116 Ga0496117_0017116_1787_2884 351
302 3300048921 Ga0496118_0046191 Ga0496118_0046191_152_1249 351
303 3300048921 Ga0496118_0054136 Ga0496118_0054136_1794_2891 351
304 3300048924 Ga0496121_0004125 Ga0496121_0004125_9662_10759 351
305 3300048925 Ga0496122_0002628 Ga0496122_0002628_11934_13031 351
306 3300048925 Ga0496122_0054862 Ga0496122_0054862_67_1164 351
307 3300048926 Ga0496123_0005206 Ga0496123_0005206_180_1277 351
308 3300048927 Ga0496124_0000743 Ga0496124_0000743_37497_38594 351
309 3300048927 Ga0496124_0003963 Ga0496124_0003963_10119_11216 351
310 3300048928 Ga0496125_0004913 Ga0496125_0004913_11209_12306 351
311 3300049572 Ga0501036_0020961 Ga0501036_0020961_460_1632 351
312 3300049573 Ga0501037_0039190 Ga0501037_0039190_1242_2414 351
313 3300049575 Ga0501039_0018255 Ga0501039_0018255_1464_2636 351
314 3300049577 Ga0501041_0039082 Ga0501041_0039082_520_1692 351
315 3300049578 Ga0501042_0106898 Ga0501042_0106898_346_1518 351
316 3300049580 Ga0501046_0006343 Ga0501046_0006343_947_2119 351
317 3300049582 Ga0501048_0038039 Ga0501048_0038039_147_1319 351
318 3300049587 Ga0501071_0056455 Ga0501071_0056455_561_1733 351
319 3300049588 Ga0501072_0021025 Ga0501072_0021025_1845_3017 351
320 3300049590 Ga0501074_0144388 Ga0501074_0144388_127_1299 351
321 3300049591 Ga0501075_0006528 Ga0501075_0006528_4466_5638 351
322 3300049592 Ga0501076_0002461 Ga0501076_0002461_5380_6552 351
323 3300049593 Ga0501077_0078056 Ga0501077_0078056_811_1983 351
324 3300049741 Ga0501079_0001340 Ga0501079_0001340_10471_11643 351
325 3300049742 Ga0501080_0016261 Ga0501080_0016261_5035_6207 351
326 3300049743 Ga0501081_0002949 Ga0501081_0002949_6469_7641 351
327 3300049744 Ga0501083_0057246 Ga0501083_0057246_890_2062 351
328 3300049824 Ga0501045_0004681 Ga0501045_0004681_6787_7959 351
329 3300050492 nmdc:mga0yw44_168471_c1 nmdc:mga0yw44_168471_c1_139_1245 351
330 3300050492 nmdc:mga0yw44_25320_c1 nmdc:mga0yw44_25320_c1_1657_2760 351
331 3300050493 nmdc:mga0k408_194992_c1 nmdc:mga0k408_194992_c1_79_1188 351
332 3300050507 nmdc:mga05p37_272079_c1 nmdc:mga05p37_272079_c1_696_1817 351
333 3300053117 Ga0500593_006014 Ga0500593_006014_1167_2279 351
334 3300054114 Ga0501084_0003463 Ga0501084_0003463_3423_4595 351
335 3300060353 Ga0501082_0069341 Ga0501082_0069341_1045_2217 351
336 3300061734 Ga0530510_0014358 Ga0530510_0014358_4099_5271 351
337 3300005262 Ga0065165_1003754 Ga0065165_10037547 352
338 3300006051 Ga0075364_10127330 Ga0075364_101273302 352
339 3300006946 Ga0079104_1000069 Ga0079104_100006933 352
340 3300009545 Ga0105237_10131222 Ga0105237_101312222 352
341 3300009551 Ga0105238_10421620 Ga0105238_104216201 352
342 3300013297 Ga0157378_10429732 Ga0157378_104297321 352
343 3300027111 Ga0209281_1000192 Ga0209281_100019282 352
344 3300048913 Ga0496110_0049612 Ga0496110_0049612_859_1953 352
345 3300048914 Ga0496111_0000317 Ga0496111_0000317_1765_2859 352
346 3300048924 Ga0496121_0011874 Ga0496121_0011874_7627_8721 352
347 3300048925 Ga0496122_0029836 Ga0496122_0029836_2664_3758 352
348 3300048926 Ga0496123_0022859 Ga0496123_0022859_1091_2185 352
349 3300053125 Ga0500618_001151 Ga0500618_001151_4213_5361 352
350 3300059503 Ga0587080_013286 Ga0587080_013286_75_1169 352
351 iso_pu_bacteria 2643221558 2643812911 352
352 iso_pu_bacteria 2909042592 2909046886 352
353 3300003187 JGI25151J46595_10000040 JGI25151J46595_1000004027 353
354 3300003187 JGI25151J46595_10000135 JGI25151J46595_1000013535 353
355 3300003187 JGI25151J46595_10030696 JGI25151J46595_100306962 353
356 3300003762 Ga0055542_1001197 Ga0055542_100119716 353
357 3300003771 Ga0055526_1000123 Ga0055526_100012356 353
358 3300003775 Ga0055524_1000023 Ga0055524_100002364 353
359 3300003781 Ga0055536_1003136 Ga0055536_10031367 353
360 3300003792 Ga0055540_1002341 Ga0055540_10023418 353
361 3300003794 Ga0055531_10002423 Ga0055531_1000242310 353
362 3300005548 Ga0070665_100004421 Ga0070665_1000044212 353
363 3300005548 Ga0070665_100026572 Ga0070665_1000265725 353
364 3300006038 Ga0075365_10003001 Ga0075365_100030019 353
365 3300006038 Ga0075365_10039181 Ga0075365_100391812 353
366 3300006042 Ga0075368_10016125 Ga0075368_100161252 353
367 3300006051 Ga0075364_10030272 Ga0075364_100302724 353
368 3300006177 Ga0075362_10007527 Ga0075362_100075272 353
369 3300006195 Ga0075366_10005906 Ga0075366_100059064 353
370 3300006844 Ga0075428_100084689 Ga0075428_1000846894 353
371 3300006948 Ga0099826_10000423 Ga0099826_1000042310 353
372 3300006948 Ga0099826_10006813 Ga0099826_100068132 353
373 3300009148 Ga0105243_10030835 Ga0105243_100308354 353
374 3300013100 Ga0157373_10001801 Ga0157373_100018015 353
375 3300013100 Ga0157373_10071580 Ga0157373_100715802 353
376 3300013102 Ga0157371_10000058 Ga0157371_1000005813 353
377 3300013104 Ga0157370_10000792 Ga0157370_1000079225 353
378 3300013105 Ga0157369_10029085 Ga0157369_100290854 353
379 3300013250 Ga0171462_1026 Ga0171462_102644 353
380 3300014326 Ga0157380_10000110 Ga0157380_1000011028 353
381 3300025254 Ga0209148_1000302 Ga0209148_100030235 353
382 3300025272 Ga0209455_1000284 Ga0209455_100028437 353
383 3300025292 Ga0209676_1012606 Ga0209676_10126063 353
384 3300025294 Ga0209025_1000016 Ga0209025_1000016520 353
385 3300025294 Ga0209025_1000441 Ga0209025_100044151 353
386 3300025295 Ga0209564_1000076 Ga0209564_1000076153 353
387 3300025299 Ga0209256_1000083 Ga0209256_1000083153 353
388 3300025904 Ga0207647_10015408 Ga0207647_100154082 353
389 3300025914 Ga0207671_10267502 Ga0207671_102675021 353
390 3300027666 Ga0209282_1000224 Ga0209282_100022410 353
391 3300027666 Ga0209282_1003866 Ga0209282_10038666 353
392 3300027866 Ga0209813_10005058 Ga0209813_100050582 353
393 3300028379 Ga0268266_10006291 Ga0268266_100062916 353
394 3300028794 Ga0307515_10000121 Ga0307515_10000121160 353
395 3300030500 Ga0268256_1000010 Ga0268256_1000010428 353
396 3300030744 Ga0316181_1105601 Ga0316181_11056012 353
397 3300031456 Ga0307513_10239213 Ga0307513_102392131 353
398 3300031731 Ga0307405_10153174 Ga0307405_101531742 353
399 3300037471 Ga0395905_0009097 Ga0395905_0009097_4657_5754 353
400 3300037471 Ga0395905_0010526 Ga0395905_0010526_2090_3217 353
401 3300037471 Ga0395905_0030943 Ga0395905_0030943_2285_3382 353
402 3300045051 Ga0451576_0000265 Ga0451576_0000265_13978_15096 353
403 3300046460 Ga0495638_0139146 Ga0495638_0139146_158_1255 353
404 3300046558 Ga0495633_0044065 Ga0495633_0044065_459_1556 353
405 3300046674 Ga0495588_0007526 Ga0495588_0007526_1799_2896 353
406 3300047470 Ga0495681_0039225 Ga0495681_0039225_196_1293 353
407 3300048919 Ga0496116_0000080 Ga0496116_0000080_18074_19171 353
408 3300048919 Ga0496116_0018419 Ga0496116_0018419_757_1854 353
409 3300048920 Ga0496117_0000002 Ga0496117_0000002_1958775_1959872 353
410 3300048920 Ga0496117_0091729 Ga0496117_0091729_90_1187 353
411 3300048920 Ga0496117_0139606 Ga0496117_0139606_284_1384 353
412 3300048921 Ga0496118_0000233 Ga0496118_0000233_50232_51329 353
413 3300048921 Ga0496118_0079014 Ga0496118_0079014_276_1370 353
414 3300048922 Ga0496119_0015306 Ga0496119_0015306_4263_5396 353
415 3300048923 Ga0496120_0000021 Ga0496120_0000021_106703_107800 353
416 3300048924 Ga0496121_0000001 Ga0496121_0000001_438558_439691 353
417 3300048924 Ga0496121_0000581 Ga0496121_0000581_3605_4702 353
418 3300048925 Ga0496122_0000001 Ga0496122_0000001_1329565_1330662 353
419 3300048925 Ga0496122_0000009 Ga0496122_0000009_521680_522831 353
420 3300048925 Ga0496122_0017355 Ga0496122_0017355_2327_3424 353
421 3300048926 Ga0496123_0000001 Ga0496123_0000001_1333296_1334393 353
422 3300048926 Ga0496123_0000020 Ga0496123_0000020_326238_327389 353
423 3300048927 Ga0496124_0000063 Ga0496124_0000063_97952_99172 353
424 3300048927 Ga0496124_0015389 Ga0496124_0015389_1022_2119 353
425 3300048927 Ga0496124_0027813 Ga0496124_0027813_881_2032 353
426 3300048928 Ga0496125_0000001 Ga0496125_0000001_550580_551713 353
427 3300048928 Ga0496125_0021027 Ga0496125_0021027_3400_4497 353
428 3300048929 Ga0496126_0000094 Ga0496126_0000094_34347_35444 353
429 3300048929 Ga0496126_0086462 Ga0496126_0086462_356_1489 353
430 3300050489 nmdc:mga03683_14306_c1 nmdc:mga03683_14306_c1_1533_2630 353
431 3300050491 nmdc:mga00v17_101240_c1 nmdc:mga00v17_101240_c1_525_1619 353
432 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_24692_25789 353
433 3300050492 nmdc:mga0yw44_1105_c1 nmdc:mga0yw44_1105_c1_8958_10055 353
434 3300050492 nmdc:mga0yw44_12243_c1 nmdc:mga0yw44_12243_c1_1050_2147 353
435 3300050494 nmdc:mga06z11_6468_c1 nmdc:mga06z11_6468_c1_1520_2617 353
436 3300050496 nmdc:mga07m45_96174_c1 nmdc:mga07m45_96174_c1_66_1163 353
437 3300050516 nmdc:mga0sz30_609_c1 nmdc:mga0sz30_609_c1_6486_7583 353
438 3300053107 Ga0500560_004023 Ga0500560_004023_535_1632 353
439 3300053111 Ga0500572_009225 Ga0500572_009225_551_1648 353
440 3300053122 Ga0500608_013655 Ga0500608_013655_2287_3384 353
441 3300053136 Ga0500559_0023622 Ga0500559_0023622_1432_2529 353
442 3300053137 Ga0500561_0000219 Ga0500561_0000219_141_1238 353
443 3300053140 Ga0500573_0007042 Ga0500573_0007042_592_1872 353
444 3300053153 Ga0500616_0015407 Ga0500616_0015407_897_2003 353
445 3300053156 Ga0500622_0005723 Ga0500622_0005723_3079_4176 353
446 3300053157 Ga0500624_000320 Ga0500624_000320_8680_9777 353
447 3300053161 Ga0500634_0007578 Ga0500634_0007578_1437_2534 353
448 3300053177 Ga0500636_0000010 Ga0500636_0000010_91238_92335 353
449 3300053177 Ga0500636_0006532 Ga0500636_0006532_4461_5558 353
450 3300059647 Ga0587079_011547 Ga0587079_011547_86_1183 353
451 iso_pu_bacteria 2595698237 2596373470 353
452 iso_pu_bacteria 2643221733 2644727719 353
453 iso_pu_bacteria 2643221734 2644733528 353
454 iso_pu_bacteria 2643221736 2644744581 353
455 iso_pu_bacteria 2818991467 2819717214 353
456 iso_pu_bacteria 2841760612 2841763207 353
457 iso_pu_bacteria 2844104063 2844108923 353
458 iso_pu_bacteria 2851182111 2851182453 353
459 iso_pu_bacteria 2851246043 2851251030 353
460 iso_pu_bacteria 2881861095 2881863041 353
461 iso_pu_bacteria 2902330777 2902336519 353
462 iso_pu_bacteria 2902405164 2902411594 353
463 iso_pu_bacteria 2917699015 2917701300 353
464 iso_pu_bacteria 2924784321 2924786134 353
465 iso_pu_bacteria 8057529695 8057534868 353
466 3300002987 JGI25159J45721_1003038 JGI25159J45721_10030385 354
467 3300003771 Ga0055526_1002165 Ga0055526_10021656 354
468 3300003775 Ga0055524_1011038 Ga0055524_10110382 354
469 3300005262 Ga0065165_1000139 Ga0065165_100013987 354
470 3300005328 Ga0070676_10024385 Ga0070676_100243852 354
471 3300005333 Ga0070677_10063649 Ga0070677_100636492 354
472 3300005356 Ga0070674_100092005 Ga0070674_1000920052 354
473 3300005543 Ga0070672_100009488 Ga0070672_1000094884 354
474 3300005719 Ga0068861_100061252 Ga0068861_1000612522 354
475 3300005840 Ga0068870_10042323 Ga0068870_100423231 354
476 3300005844 Ga0068862_100218730 Ga0068862_1002187302 354
477 3300006186 Ga0075369_10016085 Ga0075369_100160852 354
478 3300006844 Ga0075428_100159425 Ga0075428_1001594252 354
479 3300006847 Ga0075431_100211027 Ga0075431_1002110272 354
480 3300006880 Ga0075429_100198009 Ga0075429_1001980092 354
481 3300006881 Ga0068865_100081932 Ga0068865_1000819322 354
482 3300025284 Ga0209130_1000148 Ga0209130_10001487 354
483 3300025294 Ga0209025_1001717 Ga0209025_100171718 354
484 3300025294 Ga0209025_1004992 Ga0209025_10049926 354
485 3300025294 Ga0209025_1021294 Ga0209025_10212942 354
486 3300025295 Ga0209564_1000075 Ga0209564_1000075216 354
487 3300025299 Ga0209256_1000359 Ga0209256_100035910 354
488 3300025302 Ga0207426_1015657 Ga0207426_10156572 354
489 3300025907 Ga0207645_10093714 Ga0207645_100937142 354
490 3300025923 Ga0207681_10108565 Ga0207681_101085652 354
491 3300025933 Ga0207706_10175504 Ga0207706_101755042 354
492 3300025937 Ga0207669_10040294 Ga0207669_100402942 354
493 3300025938 Ga0207704_10155195 Ga0207704_101551952 354
494 3300025940 Ga0207691_10061799 Ga0207691_100617992 354
495 3300025972 Ga0207668_10038913 Ga0207668_100389132 354
496 3300026089 Ga0207648_10039295 Ga0207648_100392953 354
497 3300028379 Ga0268266_10166817 Ga0268266_101668172 354
498 3300036647 Ga0316582_0029156 Ga0316582_0029156_1316_2515 354
499 3300048922 Ga0496119_0032785 Ga0496119_0032785_2144_3268 354
500 3300048925 Ga0496122_0012028 Ga0496122_0012028_7510_8634 354
501 3300048925 Ga0496122_0090495 Ga0496122_0090495_106_1344 354
502 3300048925 Ga0496122_0094282 Ga0496122_0094282_72_1184 354
503 3300048926 Ga0496123_0027286 Ga0496123_0027286_1210_2334 354
504 3300048929 Ga0496126_0238710 Ga0496126_0238710_154_1329 354
505 3300049590 Ga0501074_0005455 Ga0501074_0005455_6803_7990 354
506 3300049823 Ga0501044_0000658 Ga0501044_0000658_9387_10562 354
507 3300049823 Ga0501044_0109940 Ga0501044_0109940_1553_2740 354
508 3300053104 Ga0500556_0000336 Ga0500556_0000336_3244_4368 354
509 3300053156 Ga0500622_0002153 Ga0500622_0002153_8634_9746 354
510 3300053177 Ga0500636_0009314 Ga0500636_0009314_730_1842 354
511 3300050508 nmdc:mga09592_39756_c1 nmdc:mga09592_39756_c1_651_1808 359
512 3300050510 nmdc:mga06r32_191165_c1 nmdc:mga06r32_191165_c1_856_2013 359
513 3300005356 Ga0070674_100043405 Ga0070674_1000434052 363
514 3300005459 Ga0068867_100070663 Ga0068867_1000706632 363
515 3300006844 Ga0075428_100065800 Ga0075428_1000658002 363
516 3300006880 Ga0075429_100021811 Ga0075429_1000218114 363
517 3300006881 Ga0068865_100034322 Ga0068865_1000343222 363
518 3300025917 Ga0207660_10185827 Ga0207660_101858271 363
519 3300025938 Ga0207704_10022453 Ga0207704_100224532 363
520 3300026089 Ga0207648_10009205 Ga0207648_100092053 363
521 2010549000 RicEn_C4947 RicEn_88370 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

135

397

0.89

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

102

393

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

94

362

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.8626 27 366
6ikm-assembly13.cif.gz_M crystal structure of spue-spermidine in complex with scfv5 0.8564 29 366
6ye0-assembly1.cif.gz_B e.coli's putrescine receptor potf complexed with putrescine 0.852 27 367
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.8505 27 366
6ikm-assembly13.cif.gz_M crystal structure of spue-spermidine in complex with scfv5 0.8492 29 366
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9699 29 132 3.40.190.10
3ttnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9644 133 269 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9635 29 132 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.952 29 132 3.40.190.10
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9413 29 134 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6H9RLH3-F1-model_v4 Extracellular solute-binding protein 0.9827 162 271 GO:0015846
GO:0019808
GO:0042597
AF-A0A365VNX0-F1-model_v4 deleted 0.98 118 272
AF-A0A3B8TQX5-F1-model_v4 deleted 0.9795 156 268
AF-A0A359DCV5-F1-model_v4 Polyamine ABC transporter substrate-binding protein 0.9784 134 264 GO:0015846
GO:0019808
GO:0042597
AF-F3GGB2-F1-model_v4 Extracellular solute-binding protein 0.9748 128 272 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
72.34 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map