F458695

General Info

Members Datasets Scaffolds Average Seq Length
521 300 1032 252

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10407319|Ga0157374_104073192
Length 285
Sequence MQAAILIVYTPFDIPQLMNEYETTNRRIMQPLKGKVALVTGAGSGIGQAIAVRFAQEGAHIAIDMHPGGKHTGAEAVAPIAKFDPEALAIPASVDNRAEVENLVQQIVKKFGRLDICVNNAGIEFKKPFLDVTDDEWNKVLSVNLYGSFLVSQIAARQMVKQGQGGKLIFVSSIHEDVPFPQYAPYCASKGGVRMLMRNLAMELAEHKINVNNIAPGAIATPINQKVLDDPVESKKAIEPIPLARFGKPEEVASVALFLASSESEYVTGSTYYIDGGLTQNVTKY

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
294 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
295 2808606372 Agromyces sp. 23-23 Isolate Unclassified
296 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
297 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
298 2922554459 Rhodococcus sp. 66b Isolate Unclassified
299 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
300 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0.58
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 3.45
Rhizosphere 88.87
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10407319 3300013296 Bacteria 1357
2 MBSR1b_contig_1256741 2162886012 Bacteria 1823
3 JGI24742J22300_10008459 3300002244 Unclassified 1698
4 JGI26128J50194_1000405 3300003347 Bacteria 2328
5 JGI26145J50221_1005610 3300003371 Bacteria 1035
6 Ga0070658_10013920 3300005327 Bacteria 6458
7 Ga0070683_100185539 3300005329 Bacteria 1975
8 Ga0070683_100484807 3300005329 Unclassified 1181
9 Ga0070683_100563144 3300005329 Bacteria 1090
10 Ga0070690_100175671 3300005330 Bacteria 1477
11 Ga0070690_100398988 3300005330 Bacteria 1010
12 Ga0070670_100091039 3300005331 Bacteria 2622
13 Ga0070670_100126599 3300005331 Bacteria 2205
14 Ga0068869_100037014 3300005334 Bacteria 3468
15 Ga0070666_10019519 3300005335 Bacteria 4377
16 Ga0070680_100250074 3300005336 Bacteria 1499
17 Ga0068868_100043887 3300005338 Bacteria 3493
18 Ga0068868_100305522 3300005338 Bacteria 1352
19 Ga0070660_100183456 3300005339 Bacteria 1694
20 Ga0070691_10047056 3300005341 Bacteria 2050
21 Ga0070691_10136523 3300005341 Bacteria 1247
22 Ga0070692_10057299 3300005345 Bacteria 2042
23 Ga0070668_100002330 3300005347 Bacteria 13974
24 Ga0070668_100415324 3300005347 Bacteria 1151
25 Ga0070669_100033768 3300005353 Bacteria 3702
26 Ga0070675_100062502 3300005354 Bacteria 3077
27 Ga0070675_100888811 3300005354 Bacteria 816
28 Ga0070671_100007257 3300005355 Bacteria 8857
29 Ga0070671_100159957 3300005355 Unclassified 1904
30 Ga0070671_100286270 3300005355 Bacteria 1402
31 Ga0070673_100596085 3300005364 Bacteria 1007
32 Ga0070688_100114764 3300005365 Unclassified 1796
33 Ga0070667_100252809 3300005367 Bacteria 1576
34 Ga0070667_100653635 3300005367 Bacteria 971
35 Ga0070714_100001104 3300005435 Bacteria 19321
36 Ga0070714_100011057 3300005435 Bacteria 7150
37 Ga0070714_100325269 3300005435 Bacteria 1439
38 Ga0070714_100744558 3300005435 Unclassified 947
39 Ga0070711_100054125 3300005439 Bacteria 2769
40 Ga0070705_100137543 3300005440 Bacteria 1603
41 Ga0070694_100025833 3300005444 Bacteria 3802
42 Ga0070694_100058175 3300005444 Bacteria 2629
43 Ga0070694_100135390 3300005444 Bacteria 1785
44 Ga0070708_100008219 3300005445 Bacteria 8374
45 Ga0070663_100156067 3300005455 Bacteria 1753
46 Ga0070678_100060150 3300005456 Bacteria 2795
47 Ga0070662_100075331 3300005457 Bacteria 2499
48 Ga0070662_100470859 3300005457 Bacteria 1045
49 Ga0070681_10089582 3300005458 Bacteria 3028
50 Ga0070681_10091251 3300005458 Bacteria 2997
51 Ga0070681_10397377 3300005458 Bacteria 1290
52 Ga0070707_100021469 3300005468 Bacteria 6103
53 Ga0070698_100004610 3300005471 Bacteria 15139
54 Ga0070698_100060481 3300005471 Bacteria 3823
55 Ga0070699_100440851 3300005518 Bacteria 1180
56 Ga0070679_100180326 3300005530 Bacteria 2084
57 Ga0070679_100218170 3300005530 Bacteria 1869
58 Ga0070679_100671696 3300005530 Bacteria 979
59 Ga0070697_100388587 3300005536 Bacteria 1209
60 Ga0068853_100041857 3300005539 Bacteria 3915
61 Ga0068853_100152019 3300005539 Bacteria 2084
62 Ga0068853_100170750 3300005539 Bacteria 1967
63 Ga0070695_100001860 3300005545 Bacteria 11920
64 Ga0070695_100005523 3300005545 Bacteria 7447
65 Ga0070696_100012266 3300005546 Bacteria 5744
66 Ga0070665_100001421 3300005548 Bacteria 28056
67 Ga0070704_100129891 3300005549 Unclassified 1951
68 Ga0070704_100244825 3300005549 Bacteria 1469
69 Ga0068855_100004317 3300005563 Bacteria 17383
70 Ga0068855_100044826 3300005563 Bacteria 5233
71 Ga0068855_100045101 3300005563 Bacteria 5215
72 Ga0068855_100103930 3300005563 Bacteria 3267
73 Ga0068855_100121744 3300005563 Bacteria 2986
74 Ga0068855_100188223 3300005563 Unclassified 2330
75 Ga0068855_100220322 3300005563 Unclassified 2128
76 Ga0068855_100280392 3300005563 Unclassified 1851
77 Ga0068855_100281084 3300005563 Bacteria 1848
78 Ga0068855_100431910 3300005563 Bacteria 1439
79 Ga0068855_100618168 3300005563 Bacteria 1167
80 Ga0070664_100262970 3300005564 Bacteria 1553
81 Ga0068857_100009270 3300005577 Bacteria 8540
82 Ga0068857_100309989 3300005577 Bacteria 1456
83 Ga0068854_100005132 3300005578 Bacteria 8254
84 Ga0068856_100034635 3300005614 Bacteria 4945
85 Ga0068856_100168318 3300005614 Bacteria 2203
86 Ga0070702_100154571 3300005615 Bacteria 1476
87 Ga0068852_100001738 3300005616 Bacteria 14832
88 Ga0068859_100044908 3300005617 Bacteria 4439
89 Ga0068859_100064063 3300005617 Bacteria 3708
90 Ga0068859_100068542 3300005617 Bacteria 3582
91 Ga0068859_100270803 3300005617 Bacteria 1790
92 Ga0068866_10000523 3300005718 Bacteria 17666
93 Ga0068866_10038666 3300005718 Bacteria 2351
94 Ga0068861_100012177 3300005719 Bacteria 5996
95 Ga0068861_100029187 3300005719 Bacteria 4033
96 Ga0068863_100044915 3300005841 Bacteria 4193
97 Ga0068858_100016584 3300005842 Bacteria 6919
98 Ga0068858_100105426 3300005842 Bacteria 2630
99 Ga0068858_100464259 3300005842 Bacteria 1221
100 Ga0068860_100042881 3300005843 Bacteria 4318
101 Ga0068860_100053836 3300005843 Bacteria 3825
102 Ga0068860_100128513 3300005843 Bacteria 2430
103 Ga0068862_100028912 3300005844 Bacteria 4669
104 Ga0068862_100147597 3300005844 Bacteria 2091
105 Ga0068862_100354635 3300005844 Bacteria 1362
106 Ga0081455_10000275 3300005937 Bacteria 68073
107 Ga0070717_10361410 3300006028 Bacteria 1299
108 Ga0075365_10011603 3300006038 Bacteria 5190
109 Ga0075363_100017791 3300006048 Bacteria 3531
110 Ga0070715_10013196 3300006163 Bacteria 3028
111 Ga0075366_10140696 3300006195 Bacteria 1459
112 Ga0097621_100012228 3300006237 Bacteria 6353
113 Ga0075370_10008543 3300006353 Bacteria 5275
114 Ga0075433_10716536 3300006852 Bacteria 876
115 Ga0068865_100005935 3300006881 Bacteria 7435
116 Ga0097620_100044908 3300006931 Bacteria 4439
117 Ga0097620_100064062 3300006931 Bacteria 3708
118 Ga0097620_100068535 3300006931 Bacteria 3582
119 Ga0097620_100270801 3300006931 Bacteria 1790
120 Ga0105240_10028884 3300009093 Bacteria 7234
121 Ga0105240_10071069 3300009093 Bacteria 4305
122 Ga0105240_10149529 3300009093 Bacteria 2783
123 Ga0105240_10161077 3300009093 Unclassified 2665
124 Ga0105240_10297706 3300009093 Bacteria 1847
125 Ga0105240_10466906 3300009093 Bacteria 1409
126 Ga0111539_10359659 3300009094 Bacteria 1694
127 Ga0105245_10440718 3300009098 Bacteria 1309
128 Ga0105247_10051564 3300009101 Bacteria 2534
129 Ga0105247_10125486 3300009101 Bacteria 1668
130 Ga0105243_10004127 3300009148 Bacteria 11551
131 Ga0105241_10000024 3300009174 Bacteria 140808
132 Ga0105241_10032489 3300009174 Bacteria 3913
133 Ga0105241_10363018 3300009174 Bacteria 1261
134 Ga0105242_10002900 3300009176 Bacteria 13411
135 Ga0105248_10020039 3300009177 Bacteria 7406
136 Ga0105248_10118203 3300009177 Bacteria 2990
137 Ga0105248_10168670 3300009177 Unclassified 2467
138 Ga0105238_10008988 3300009551 Bacteria 9999
139 Ga0105238_10039553 3300009551 Bacteria 4782
140 Ga0105238_10586834 3300009551 Bacteria 1121
141 Ga0105249_10001859 3300009553 Bacteria 18327
142 Ga0105249_10040890 3300009553 Bacteria 4212
143 Ga0105249_10130220 3300009553 Bacteria 2401
144 Ga0105249_10174186 3300009553 Bacteria 2089
145 Ga0105249_10590828 3300009553 Bacteria 1164
146 Ga0099796_10024732 3300010159 Bacteria 1888
147 Ga0105246_10020442 3300011119 Bacteria 4246
148 Ga0157373_10398166 3300013100 Unclassified 987
149 Ga0157371_10206013 3300013102 Bacteria 1411
150 Ga0157371_10531169 3300013102 Bacteria 871
151 Ga0157370_10012036 3300013104 Bacteria 9008
152 Ga0157370_10062461 3300013104 Bacteria 3532
153 Ga0157370_10355798 3300013104 Bacteria 1349
154 Ga0157369_10007134 3300013105 Bacteria 12882
155 Ga0157369_10016146 3300013105 Bacteria 8405
156 Ga0157369_10051996 3300013105 Bacteria 4433
157 Ga0157374_10415362 3300013296 Bacteria 1344
158 Ga0157378_10001747 3300013297 Bacteria 19479
159 Ga0163162_10057728 3300013306 Bacteria 3909
160 Ga0157372_10007102 3300013307 Bacteria 11936
161 Ga0157372_10043336 3300013307 Bacteria 4981
162 Ga0157375_10031648 3300013308 Bacteria 5006
163 Ga0157375_10080218 3300013308 Bacteria 3301
164 Ga0157375_10569861 3300013308 Bacteria 1293
165 Ga0163163_10138282 3300014325 Bacteria 2477
166 Ga0157380_10160350 3300014326 Bacteria 1954
167 Ga0157380_10229643 3300014326 Bacteria 1666
168 Ga0157377_10149138 3300014745 Bacteria 1444
169 Ga0157376_10390275 3300014969 Unclassified 1343
170 Ga0163161_10008828 3300017792 Bacteria 6968
171 Ga0163161_10036125 3300017792 Bacteria 3538
172 Ga0163161_10114887 3300017792 Bacteria 2017
173 Ga0206351_10605879 3300020077 Bacteria 861
174 Ga0206351_10623219 3300020077 Bacteria 1107
175 Ga0206353_11439115 3300020082 Bacteria 2923
176 Ga0213876_10024421 3300021384 Bacteria 3191
177 Ga0213876_10131861 3300021384 Bacteria 1328
178 Ga0213875_10000058 3300021388 Bacteria 135597
179 Ga0213875_10000299 3300021388 Bacteria 47637
180 Ga0213875_10002855 3300021388 Bacteria 10121
181 Ga0213875_10015281 3300021388 Bacteria 3735
182 Ga0213875_10031552 3300021388 Bacteria 2506
183 Ga0213875_10040918 3300021388 Bacteria 2181
184 Ga0213871_10014640 3300021441 Bacteria 1864
185 Ga0207655_1003319 3300025728 Bacteria 12057
186 Ga0207692_10236312 3300025898 Bacteria 1090
187 Ga0207642_10006559 3300025899 Unclassified 3879
188 Ga0207642_10115356 3300025899 Bacteria 1375
189 Ga0207710_10028182 3300025900 Bacteria 2437
190 Ga0207680_10038346 3300025903 Bacteria 2773
191 Ga0207680_10114720 3300025903 Unclassified 1753
192 Ga0207647_10169078 3300025904 Bacteria 1273
193 Ga0207685_10060875 3300025905 Bacteria 1495
194 Ga0207699_10008228 3300025906 Bacteria 5135
195 Ga0207645_10211526 3300025907 Bacteria 1277
196 Ga0207705_10114823 3300025909 Bacteria 1992
197 Ga0207684_10003352 3300025910 Bacteria 15705
198 Ga0207707_10049903 3300025912 Bacteria 3646
199 Ga0207707_10060106 3300025912 Bacteria 3306
200 Ga0207707_10444369 3300025912 Bacteria 1110
201 Ga0207707_10568929 3300025912 Bacteria 962
202 Ga0207695_10000160 3300025913 Bacteria 200410
203 Ga0207695_10022389 3300025913 Bacteria 7173
204 Ga0207695_10425980 3300025913 Bacteria 1211
205 Ga0207693_10049141 3300025915 Bacteria 3312
206 Ga0207663_10083308 3300025916 Bacteria 2100
207 Ga0207660_10344909 3300025917 Bacteria 1193
208 Ga0207660_10380145 3300025917 Bacteria 1135
209 Ga0207652_10048367 3300025921 Bacteria 3635
210 Ga0207652_10060164 3300025921 Bacteria 3277
211 Ga0207652_10079304 3300025921 Bacteria 2868
212 Ga0207652_10173675 3300025921 Bacteria 1934
213 Ga0207652_10385791 3300025921 Bacteria 1264
214 Ga0207646_10002263 3300025922 Bacteria 22899
215 Ga0207646_10008072 3300025922 Bacteria 10612
216 Ga0207681_10354673 3300025923 Bacteria 1175
217 Ga0207694_10027281 3300025924 Bacteria 4348
218 Ga0207694_10045567 3300025924 Bacteria 3387
219 Ga0207694_10195286 3300025924 Bacteria 1645
220 Ga0207650_10139974 3300025925 Bacteria 1901
221 Ga0207659_10088697 3300025926 Bacteria 2305
222 Ga0207659_10130847 3300025926 Unclassified 1936
223 Ga0207659_10757925 3300025926 Bacteria 833
224 Ga0207687_10106163 3300025927 Bacteria 2076
225 Ga0207687_10203101 3300025927 Bacteria 1550
226 Ga0207700_10468045 3300025928 Bacteria 1113
227 Ga0207664_10159410 3300025929 Bacteria 1923
228 Ga0207664_10171598 3300025929 Bacteria 1857
229 Ga0207644_10036023 3300025931 Bacteria 3471
230 Ga0207706_10029695 3300025933 Bacteria 4879
231 Ga0207706_10102398 3300025933 Bacteria 2519
232 Ga0207709_10006958 3300025935 Bacteria 6323
233 Ga0207709_10040504 3300025935 Bacteria 2790
234 Ga0207670_10054565 3300025936 Bacteria 2697
235 Ga0207669_10070345 3300025937 Bacteria 2193
236 Ga0207669_10447323 3300025937 Bacteria 1023
237 Ga0207704_10009628 3300025938 Bacteria 4671
238 Ga0207665_10054117 3300025939 Bacteria 2706
239 Ga0207711_10072338 3300025941 Bacteria 2995
240 Ga0207679_10167567 3300025945 Bacteria 1805
241 Ga0207667_10007857 3300025949 Bacteria 12739
242 Ga0207667_10036454 3300025949 Bacteria 5272
243 Ga0207667_10129964 3300025949 Bacteria 2594
244 Ga0207667_10147370 3300025949 Bacteria 2423
245 Ga0207667_10342545 3300025949 Bacteria 1525
246 Ga0207667_10837161 3300025949 Bacteria 915
247 Ga0207651_10172616 3300025960 Bacteria 1707
248 Ga0207712_10071616 3300025961 Bacteria 2493
249 Ga0207712_10381558 3300025961 Bacteria 1180
250 Ga0207668_10329790 3300025972 Bacteria 1269
251 Ga0207658_10610322 3300025986 Bacteria 981
252 Ga0207677_10177179 3300026023 Bacteria 1674
253 Ga0207703_10254051 3300026035 Bacteria 1586
254 Ga0207703_10603550 3300026035 Bacteria 1038
255 Ga0207639_10016729 3300026041 Bacteria 5195
256 Ga0207702_10022904 3300026078 Bacteria 5183
257 Ga0207702_10083963 3300026078 Bacteria 2772
258 Ga0207641_10237376 3300026088 Bacteria 1697
259 Ga0207641_10569652 3300026088 Bacteria 1106
260 Ga0207676_10468616 3300026095 Bacteria 1191
261 Ga0207674_10012454 3300026116 Bacteria 9504
262 Ga0207674_10013692 3300026116 Bacteria 8983
263 Ga0207675_100015471 3300026118 Bacteria 7116
264 Ga0207675_100044226 3300026118 Bacteria 4161
265 Ga0207675_100165215 3300026118 Bacteria 2113
266 Ga0207683_10000483 3300026121 Bacteria 36749
267 Ga0207683_10002361 3300026121 Bacteria 16490
268 Ga0207683_10282225 3300026121 Bacteria 1518
269 Ga0207698_10029426 3300026142 Bacteria 3934
270 Ga0207698_10138968 3300026142 Bacteria 2089
271 Ga0209969_1007465 3300027360 Bacteria 1545
272 Ga0209981_1004495 3300027378 Bacteria 1832
273 Ga0209984_1011007 3300027424 Bacteria 1168
274 Ga0210000_1017163 3300027462 Bacteria 1096
275 Ga0209995_1000385 3300027471 Bacteria 6884
276 Ga0209970_1000610 3300027614 Bacteria 6208
277 Ga0209971_1000023 3300027682 Bacteria 56858
278 Ga0209966_1000403 3300027695 Bacteria 12684
279 Ga0209998_10000214 3300027717 Bacteria 20068
280 Ga0209974_10004429 3300027876 Bacteria 4997
281 Ga0268266_10105222 3300028379 Bacteria 2493
282 Ga0268266_10338352 3300028379 Bacteria 1412
283 Ga0268265_10115718 3300028380 Bacteria 2199
284 Ga0268265_10124488 3300028380 Unclassified 2130
285 Ga0268264_10033483 3300028381 Bacteria 4222
286 Ga0268264_10175785 3300028381 Bacteria 1940
287 Ga0268264_10957332 3300028381 Bacteria 861
288 Ga0265334_10020483 3300028573 Bacteria 2707
289 Ga0265338_10004177 3300028800 Bacteria 19715
290 Ga0265338_10024955 3300028800 Bacteria 6087
291 Ga0265338_10160375 3300028800 Bacteria 1737
292 Ga0265330_10000328 3300031235 Bacteria 34183
293 Ga0265325_10000134 3300031241 Bacteria 51550
294 Ga0265339_10000306 3300031249 Bacteria 40045
295 Ga0265339_10031439 3300031249 Bacteria 2999
296 Ga0265327_10178399 3300031251 Bacteria 973
297 Ga0265316_10001531 3300031344 Bacteria 24746
298 Ga0265313_10061125 3300031595 Unclassified 1764
299 Ga0316575_10002834 3300031665 Bacteria 5883
300 Ga0265314_10002017 3300031711 Bacteria 21557
301 Ga0265342_10001191 3300031712 Bacteria 24705
302 Ga0307405_10156519 3300031731 Bacteria 1609
303 Ga0307406_10407955 3300031901 Bacteria 1079
304 Ga0307406_10481084 3300031901 Bacteria 1003
305 Ga0307414_10008946 3300032004 Bacteria 5722
306 Ga0316583_10090024 3300032133 Bacteria 1070
307 Ga0373956_0113819 3300035119 Bacteria 1261
308 Ga0316574_0006184 3300035398 Bacteria 6448
309 Ga0373931_0295875 3300035691 Bacteria 998
310 Ga0373935_0010983 3300035692 Bacteria 5440
311 Ga0373935_0050772 3300035692 Bacteria 2633
312 Ga0373927_0063241 3300035695 Bacteria 2393
313 Ga0373947_0288796 3300035725 Unclassified 1092
314 Ga0373937_0085265 3300036401 Bacteria 2923
315 Ga0373937_0292950 3300036401 Bacteria 1538
316 Ga0373937_0414388 3300036401 Bacteria 1278
317 Ga0316584_0202497 3300036712 Bacteria 1464
318 Ga0316584_0229062 3300036712 Bacteria 1363
319 Ga0373925_0005094 3300037068 Bacteria 9839
320 Ga0395898_0009748 3300037466 Bacteria 10066
321 Ga0395905_0194842 3300037471 Bacteria 1900
322 Ga0436364_0440289 3300037853 Bacteria 49939
323 Ga0436364_0484557 3300037853 Bacteria 17767
324 Ga0436364_0615231 3300037853 Bacteria 1973
325 Ga0436364_0656092 3300037853 Bacteria 21926
326 Ga0436364_0788701 3300037853 Bacteria 9821
327 Ga0436364_0890518 3300037853 Bacteria 2016
328 Ga0436364_1213069 3300037853 Bacteria 19680
329 Ga0436364_1332997 3300037853 Bacteria 379560
330 Ga0436364_1458127 3300037853 Bacteria 2333
331 Ga0395901_0254521 3300038443 Bacteria 1829
332 Ga0436365_0746789 3300039437 Bacteria 1619
333 Ga0436365_0874056 3300039437 Bacteria 1769
334 Ga0436365_1529613 3300039437 Bacteria 11525
335 Ga0436365_1874113 3300039437 Bacteria 914
336 Ga0436360_0099632 3300039438 Bacteria 1925
337 Ga0436361_0057841 3300039447 Bacteria 2652
338 Ga0436362_0547721 3300039453 Bacteria 894
339 Ga0450911_000324 3300042115 Bacteria 17144
340 Ga0439464_0016683 3300042439 Bacteria 1988
341 Ga0466963_0409657 3300044694 Bacteria 956
342 Ga0453684_0034119 3300044712 Bacteria 7073
343 Ga0453684_0164420 3300044712 Bacteria 2621
344 Ga0466960_0009043 3300044901 Bacteria 4097
345 Ga0451576_0020995 3300045051 Bacteria 7105
346 Ga0451576_0158034 3300045051 Bacteria 2365
347 Ga0451576_0183376 3300045051 Unclassified 2185
348 Ga0451576_0212179 3300045051 Bacteria 2022
349 Ga0451576_0261252 3300045051 Bacteria 1810
350 Ga0466958_0018387 3300045836 Bacteria 4056
351 Ga0495627_007828 3300046453 Bacteria 4062
352 Ga0495603_0000242 3300046455 Bacteria 28437
353 Ga0495591_000196 3300046458 Bacteria 61706
354 Ga0495641_0043343 3300046461 Bacteria 2081
355 Ga0495639_0166757 3300046475 Bacteria 1068
356 Ga0495639_0221738 3300046475 Bacteria 930
357 Ga0495584_0019294 3300046491 Bacteria 3463
358 Ga0495594_0139885 3300046499 Bacteria 1373
359 Ga0495607_0058667 3300046501 Bacteria 2199
360 Ga0495607_0066518 3300046501 Bacteria 2028
361 Ga0495607_0083299 3300046501 Unclassified 1752
362 Ga0495607_0093225 3300046501 Bacteria 1627
363 Ga0495610_0001758 3300046512 Bacteria 18977
364 Ga0495616_0013358 3300046513 Bacteria 4633
365 Ga0495628_0186712 3300046516 Bacteria 1566
366 Ga0495628_0317880 3300046516 Unclassified 1149
367 Ga0495628_0357301 3300046516 Bacteria 1073
368 Ga0495630_0452890 3300046517 Bacteria 983
369 Ga0495632_0000199 3300046519 Bacteria 61019
370 Ga0495632_0000500 3300046519 Bacteria 36904
371 Ga0495643_0097091 3300046522 Bacteria 1514
372 Ga0495648_0072752 3300046524 Bacteria 1988
373 Ga0495642_0000252 3300046528 Bacteria 29943
374 Ga0495654_0004278 3300046530 Bacteria 8526
375 Ga0495654_0039343 3300046530 Bacteria 2361
376 Ga0495665_0057063 3300046531 Bacteria 2061
377 Ga0495586_0053005 3300046535 Bacteria 2197
378 Ga0495586_0061042 3300046535 Bacteria 2051
379 Ga0495645_0007742 3300046543 Bacteria 7473
380 Ga0495645_0045377 3300046543 Bacteria 3206
381 Ga0495668_0000442 3300046616 Bacteria 53094
382 Ga0495625_0001018 3300046660 Bacteria 36954
383 Ga0495661_0000043 3300046665 Bacteria 149067
384 Ga0495599_0029667 3300046678 Bacteria 3430
385 Ga0495647_0031660 3300046681 Bacteria 1968
386 Ga0495613_0036141 3300046689 Bacteria 3663
387 Ga0495613_0173168 3300046689 Unclassified 1531
388 Ga0495671_0000900 3300046692 Bacteria 21180
389 Ga0495671_0001466 3300046692 Bacteria 15831
390 Ga0495671_0007290 3300046692 Bacteria 6313
391 Ga0495671_0010316 3300046692 Bacteria 5184
392 Ga0495600_0207971 3300046809 Unclassified 1255
393 Ga0495660_0109536 3300046810 Bacteria 1411
394 Ga0495581_0116635 3300047315 Bacteria 1553
395 Ga0495672_0000962 3300047320 Bacteria 29943
396 Ga0495672_0059337 3300047320 Bacteria 2214
397 Ga0495672_0156043 3300047320 Bacteria 1179
398 Ga0495676_0358257 3300047321 Bacteria 974
399 Ga0495680_0037385 3300047322 Bacteria 3889
400 Ga0495680_0104007 3300047322 Bacteria 2113
401 Ga0495673_0000982 3300047469 Bacteria 25595
402 Ga0495681_0001266 3300047470 Bacteria 19181
403 Ga0495681_0001737 3300047470 Bacteria 16106
404 Ga0495681_0011990 3300047470 Bacteria 5119
405 Ga0495681_0033920 3300047470 Bacteria 2549
406 Ga0495684_0321655 3300047471 Bacteria 1106
407 Ga0495686_0023277 3300047472 Bacteria 4088
408 Ga0495686_0051379 3300047472 Bacteria 2587
409 Ga0495626_0000546 3300048091 Bacteria 37337
410 Ga0496100_0002239 3300048903 Bacteria 9773
411 Ga0496100_0025175 3300048903 Bacteria 3638
412 Ga0496100_0493850 3300048903 Bacteria 942
413 Ga0496101_0001654 3300048904 Bacteria 13369
414 Ga0496101_0228394 3300048904 Unclassified 1446
415 Ga0496102_0457036 3300048905 Bacteria 1198
416 Ga0496103_0045084 3300048906 Bacteria 2720
417 Ga0496106_0014833 3300048909 Bacteria 5762
418 Ga0496107_0056863 3300048910 Bacteria 2827
419 Ga0496107_0121406 3300048910 Bacteria 1925
420 Ga0496107_0122164 3300048910 Bacteria 1919
421 Ga0496114_0113468 3300048917 Bacteria 2323
422 Ga0496114_0241309 3300048917 Bacteria 1589
423 Ga0496115_0044417 3300048918 Bacteria 3544
424 Ga0496115_0121871 3300048918 Bacteria 2146
425 Ga0496115_0173432 3300048918 Bacteria 1783
426 Ga0496115_0195864 3300048918 Bacteria 1670
427 Ga0496115_0198249 3300048918 Bacteria 1658
428 Ga0496119_0013251 3300048922 Bacteria 6590
429 Ga0496121_0004223 3300048924 Bacteria 19584
430 Ga0496124_0051570 3300048927 Bacteria 3500
431 Ga0496125_0005806 3300048928 Bacteria 13555
432 Ga0496125_0022340 3300048928 Bacteria 5877
433 Ga0501031_0000022 3300049568 Bacteria 92471
434 Ga0501031_0192979 3300049568 Bacteria 1330
435 Ga0501032_0000063 3300049569 Bacteria 92497
436 Ga0501032_0023782 3300049569 Bacteria 4230
437 Ga0501033_0000073 3300049570 Bacteria 94880
438 Ga0501033_0036261 3300049570 Bacteria 3696
439 Ga0501033_0053844 3300049570 Bacteria 2979
440 Ga0501033_0060874 3300049570 Bacteria 2784
441 Ga0501034_0000276 3300049571 Bacteria 92497
442 Ga0501034_0000486 3300049571 Bacteria 64596
443 Ga0501034_0139274 3300049571 Bacteria 2407
444 Ga0501036_0000030 3300049572 Bacteria 92497
445 Ga0501036_0063834 3300049572 Bacteria 3118
446 Ga0501036_0193888 3300049572 Bacteria 1709
447 Ga0501037_0000075 3300049573 Bacteria 92499
448 Ga0501037_0003512 3300049573 Bacteria 11378
449 Ga0501037_0090710 3300049573 Bacteria 2210
450 Ga0501038_0000058 3300049574 Bacteria 92497
451 Ga0501038_0001306 3300049574 Bacteria 22712
452 Ga0501038_0034450 3300049574 Bacteria 4452
453 Ga0501039_0000054 3300049575 Bacteria 92497
454 Ga0501039_0008043 3300049575 Bacteria 8035
455 Ga0501039_0281222 3300049575 Bacteria 1308
456 Ga0501040_0004883 3300049576 Bacteria 8677
457 Ga0501040_0006460 3300049576 Bacteria 7611
458 Ga0501040_0312520 3300049576 Bacteria 1124
459 Ga0501041_0004325 3300049577 Bacteria 8210
460 Ga0501042_0002562 3300049578 Bacteria 11185
461 Ga0501043_0011647 3300049579 Bacteria 6883
462 Ga0501043_0013716 3300049579 Bacteria 6340
463 Ga0501043_0107049 3300049579 Bacteria 2196
464 Ga0501046_0008115 3300049580 Bacteria 9174
465 Ga0501046_0172613 3300049580 Bacteria 1621
466 Ga0501047_0007031 3300049581 Bacteria 10566
467 Ga0501047_0022256 3300049581 Bacteria 6089
468 Ga0501047_0022839 3300049581 Bacteria 6005
469 Ga0501048_0013923 3300049582 Bacteria 5963
470 Ga0501048_0120992 3300049582 Bacteria 1850
471 Ga0501067_0033245 3300049583 Bacteria 2862
472 Ga0501068_0138116 3300049584 Bacteria 1527
473 Ga0501069_0008342 3300049585 Bacteria 5441
474 Ga0501070_0042458 3300049586 Bacteria 3788
475 Ga0501070_0053856 3300049586 Bacteria 3336
476 Ga0501072_0023517 3300049588 Bacteria 4787
477 Ga0501072_0059169 3300049588 Bacteria 3021
478 Ga0501073_0000341 3300049589 Bacteria 31312
479 Ga0501074_0000731 3300049590 Bacteria 20618
480 Ga0501074_0005416 3300049590 Bacteria 9182
481 Ga0501075_0006148 3300049591 Bacteria 8252
482 Ga0501077_0067095 3300049593 Bacteria 2275
483 Ga0501079_0003821 3300049741 Bacteria 11131
484 Ga0501079_0013223 3300049741 Bacteria 6293
485 Ga0501080_0033550 3300049742 Bacteria 4791
486 Ga0501080_0432834 3300049742 Bacteria 1181
487 Ga0501081_0010503 3300049743 Bacteria 6044
488 Ga0501081_0668088 3300049743 Bacteria 779
489 Ga0501083_0002305 3300049744 Bacteria 13065
490 Ga0501035_0000126 3300049822 Bacteria 92497
491 Ga0501035_0126421 3300049822 Bacteria 2232
492 Ga0501044_0000131 3300049823 Bacteria 92497
493 Ga0501044_0015112 3300049823 Bacteria 8319
494 Ga0501045_0000366 3300049824 Bacteria 27064
495 nmdc:mga0k408_82209_c1 3300050493 Bacteria 1887
496 nmdc:mga07m45_50675_c1 3300050496 Bacteria 2340
497 nmdc:mga05p37_1021833_c1 3300050507 Bacteria 875
498 nmdc:mga08y16_622413_c1 3300050511 Bacteria 1086
499 nmdc:mga08y16_9912_c1 3300050511 Bacteria 10001
500 nmdc:mga0n895_368207_c1 3300050512 Bacteria 1455
501 nmdc:mga0a205_679645_c1 3300050515 Bacteria 880
502 Ga0495601_0004791 3300053077 Bacteria 7845
503 Ga0500651_0008155 3300053093 Bacteria 6145
504 Ga0500620_081165 3300053155 Bacteria 1123
505 Ga0501084_0004564 3300054114 Bacteria 11318
506 Ga0501082_0000132 3300060353 Bacteria 61079
507 Ga0466962_0021736 3300061719 Bacteria 3079
508 Ga0530510_0005457 3300061734 Bacteria 8801
509 2511389451 2511231027 Bacteria 5013807
510 2566992079 2565956761 Bacteria 6601618
511 2808900085 2808606372 Bacteria 4649509
512 2842872735 2842871566 Bacteria 4827117
513 2904538518 2904535858 Bacteria 6308016
514 2922559249 2922554459 Bacteria 6683962
515 2984593849 2984592036 Bacteria 3670284
516 3007422155 3007419365 Bacteria 7026924
517 Ga0157374_10407319
518 MBSR1b_contig_1256741
519 JGI24742J22300_10008459
520 JGI26128J50194_1000405
521 JGI26145J50221_1005610
522 Ga0070658_10013920
523 Ga0070683_100185539
524 Ga0070683_100484807
525 Ga0070683_100563144
526 Ga0070690_100175671
527 Ga0070690_100398988
528 Ga0070670_100091039
529 Ga0070670_100126599
530 Ga0068869_100037014
531 Ga0070666_10019519
532 Ga0070680_100250074
533 Ga0068868_100043887
534 Ga0068868_100305522
535 Ga0070660_100183456
536 Ga0070691_10047056
537 Ga0070691_10136523
538 Ga0070692_10057299
539 Ga0070668_100002330
540 Ga0070668_100415324
541 Ga0070669_100033768
542 Ga0070675_100062502
543 Ga0070675_100888811
544 Ga0070671_100007257
545 Ga0070671_100159957
546 Ga0070671_100286270
547 Ga0070673_100596085
548 Ga0070688_100114764
549 Ga0070667_100252809
550 Ga0070667_100653635
551 Ga0070714_100001104
552 Ga0070714_100011057
553 Ga0070714_100325269
554 Ga0070714_100744558
555 Ga0070711_100054125
556 Ga0070705_100137543
557 Ga0070694_100025833
558 Ga0070694_100058175
559 Ga0070694_100135390
560 Ga0070708_100008219
561 Ga0070663_100156067
562 Ga0070678_100060150
563 Ga0070662_100075331
564 Ga0070662_100470859
565 Ga0070681_10089582
566 Ga0070681_10091251
567 Ga0070681_10397377
568 Ga0070707_100021469
569 Ga0070698_100004610
570 Ga0070698_100060481
571 Ga0070699_100440851
572 Ga0070679_100180326
573 Ga0070679_100218170
574 Ga0070679_100671696
575 Ga0070697_100388587
576 Ga0068853_100041857
577 Ga0068853_100152019
578 Ga0068853_100170750
579 Ga0070695_100001860
580 Ga0070695_100005523
581 Ga0070696_100012266
582 Ga0070665_100001421
583 Ga0070704_100129891
584 Ga0070704_100244825
585 Ga0068855_100004317
586 Ga0068855_100044826
587 Ga0068855_100045101
588 Ga0068855_100103930
589 Ga0068855_100121744
590 Ga0068855_100188223
591 Ga0068855_100220322
592 Ga0068855_100280392
593 Ga0068855_100281084
594 Ga0068855_100431910
595 Ga0068855_100618168
596 Ga0070664_100262970
597 Ga0068857_100009270
598 Ga0068857_100309989
599 Ga0068854_100005132
600 Ga0068856_100034635
601 Ga0068856_100168318
602 Ga0070702_100154571
603 Ga0068852_100001738
604 Ga0068859_100044908
605 Ga0068859_100064063
606 Ga0068859_100068542
607 Ga0068859_100270803
608 Ga0068866_10000523
609 Ga0068866_10038666
610 Ga0068861_100012177
611 Ga0068861_100029187
612 Ga0068863_100044915
613 Ga0068858_100016584
614 Ga0068858_100105426
615 Ga0068858_100464259
616 Ga0068860_100042881
617 Ga0068860_100053836
618 Ga0068860_100128513
619 Ga0068862_100028912
620 Ga0068862_100147597
621 Ga0068862_100354635
622 Ga0081455_10000275
623 Ga0070717_10361410
624 Ga0075365_10011603
625 Ga0075363_100017791
626 Ga0070715_10013196
627 Ga0075366_10140696
628 Ga0097621_100012228
629 Ga0075370_10008543
630 Ga0075433_10716536
631 Ga0068865_100005935
632 Ga0097620_100044908
633 Ga0097620_100064062
634 Ga0097620_100068535
635 Ga0097620_100270801
636 Ga0105240_10028884
637 Ga0105240_10071069
638 Ga0105240_10149529
639 Ga0105240_10161077
640 Ga0105240_10297706
641 Ga0105240_10466906
642 Ga0111539_10359659
643 Ga0105245_10440718
644 Ga0105247_10051564
645 Ga0105247_10125486
646 Ga0105243_10004127
647 Ga0105241_10000024
648 Ga0105241_10032489
649 Ga0105241_10363018
650 Ga0105242_10002900
651 Ga0105248_10020039
652 Ga0105248_10118203
653 Ga0105248_10168670
654 Ga0105238_10008988
655 Ga0105238_10039553
656 Ga0105238_10586834
657 Ga0105249_10001859
658 Ga0105249_10040890
659 Ga0105249_10130220
660 Ga0105249_10174186
661 Ga0105249_10590828
662 Ga0099796_10024732
663 Ga0105246_10020442
664 Ga0157373_10398166
665 Ga0157371_10206013
666 Ga0157371_10531169
667 Ga0157370_10012036
668 Ga0157370_10062461
669 Ga0157370_10355798
670 Ga0157369_10007134
671 Ga0157369_10016146
672 Ga0157369_10051996
673 Ga0157374_10415362
674 Ga0157378_10001747
675 Ga0163162_10057728
676 Ga0157372_10007102
677 Ga0157372_10043336
678 Ga0157375_10031648
679 Ga0157375_10080218
680 Ga0157375_10569861
681 Ga0163163_10138282
682 Ga0157380_10160350
683 Ga0157380_10229643
684 Ga0157377_10149138
685 Ga0157376_10390275
686 Ga0163161_10008828
687 Ga0163161_10036125
688 Ga0163161_10114887
689 Ga0206351_10605879
690 Ga0206351_10623219
691 Ga0206353_11439115
692 Ga0213876_10024421
693 Ga0213876_10131861
694 Ga0213875_10000058
695 Ga0213875_10000299
696 Ga0213875_10002855
697 Ga0213875_10015281
698 Ga0213875_10031552
699 Ga0213875_10040918
700 Ga0213871_10014640
701 Ga0207655_1003319
702 Ga0207692_10236312
703 Ga0207642_10006559
704 Ga0207642_10115356
705 Ga0207710_10028182
706 Ga0207680_10038346
707 Ga0207680_10114720
708 Ga0207647_10169078
709 Ga0207685_10060875
710 Ga0207699_10008228
711 Ga0207645_10211526
712 Ga0207705_10114823
713 Ga0207684_10003352
714 Ga0207707_10049903
715 Ga0207707_10060106
716 Ga0207707_10444369
717 Ga0207707_10568929
718 Ga0207695_10000160
719 Ga0207695_10022389
720 Ga0207695_10425980
721 Ga0207693_10049141
722 Ga0207663_10083308
723 Ga0207660_10344909
724 Ga0207660_10380145
725 Ga0207652_10048367
726 Ga0207652_10060164
727 Ga0207652_10079304
728 Ga0207652_10173675
729 Ga0207652_10385791
730 Ga0207646_10002263
731 Ga0207646_10008072
732 Ga0207681_10354673
733 Ga0207694_10027281
734 Ga0207694_10045567
735 Ga0207694_10195286
736 Ga0207650_10139974
737 Ga0207659_10088697
738 Ga0207659_10130847
739 Ga0207659_10757925
740 Ga0207687_10106163
741 Ga0207687_10203101
742 Ga0207700_10468045
743 Ga0207664_10159410
744 Ga0207664_10171598
745 Ga0207644_10036023
746 Ga0207706_10029695
747 Ga0207706_10102398
748 Ga0207709_10006958
749 Ga0207709_10040504
750 Ga0207670_10054565
751 Ga0207669_10070345
752 Ga0207669_10447323
753 Ga0207704_10009628
754 Ga0207665_10054117
755 Ga0207711_10072338
756 Ga0207679_10167567
757 Ga0207667_10007857
758 Ga0207667_10036454
759 Ga0207667_10129964
760 Ga0207667_10147370
761 Ga0207667_10342545
762 Ga0207667_10837161
763 Ga0207651_10172616
764 Ga0207712_10071616
765 Ga0207712_10381558
766 Ga0207668_10329790
767 Ga0207658_10610322
768 Ga0207677_10177179
769 Ga0207703_10254051
770 Ga0207703_10603550
771 Ga0207639_10016729
772 Ga0207702_10022904
773 Ga0207702_10083963
774 Ga0207641_10237376
775 Ga0207641_10569652
776 Ga0207676_10468616
777 Ga0207674_10012454
778 Ga0207674_10013692
779 Ga0207675_100015471
780 Ga0207675_100044226
781 Ga0207675_100165215
782 Ga0207683_10000483
783 Ga0207683_10002361
784 Ga0207683_10282225
785 Ga0207698_10029426
786 Ga0207698_10138968
787 Ga0209969_1007465
788 Ga0209981_1004495
789 Ga0209984_1011007
790 Ga0210000_1017163
791 Ga0209995_1000385
792 Ga0209970_1000610
793 Ga0209971_1000023
794 Ga0209966_1000403
795 Ga0209998_10000214
796 Ga0209974_10004429
797 Ga0268266_10105222
798 Ga0268266_10338352
799 Ga0268265_10115718
800 Ga0268265_10124488
801 Ga0268264_10033483
802 Ga0268264_10175785
803 Ga0268264_10957332
804 Ga0265334_10020483
805 Ga0265338_10004177
806 Ga0265338_10024955
807 Ga0265338_10160375
808 Ga0265330_10000328
809 Ga0265325_10000134
810 Ga0265339_10000306
811 Ga0265339_10031439
812 Ga0265327_10178399
813 Ga0265316_10001531
814 Ga0265313_10061125
815 Ga0316575_10002834
816 Ga0265314_10002017
817 Ga0265342_10001191
818 Ga0307405_10156519
819 Ga0307406_10407955
820 Ga0307406_10481084
821 Ga0307414_10008946
822 Ga0316583_10090024
823 Ga0373956_0113819
824 Ga0316574_0006184
825 Ga0373931_0295875
826 Ga0373935_0010983
827 Ga0373935_0050772
828 Ga0373927_0063241
829 Ga0373947_0288796
830 Ga0373937_0085265
831 Ga0373937_0292950
832 Ga0373937_0414388
833 Ga0316584_0202497
834 Ga0316584_0229062
835 Ga0373925_0005094
836 Ga0395898_0009748
837 Ga0395905_0194842
838 Ga0436364_0440289
839 Ga0436364_0484557
840 Ga0436364_0615231
841 Ga0436364_0656092
842 Ga0436364_0788701
843 Ga0436364_0890518
844 Ga0436364_1213069
845 Ga0436364_1332997
846 Ga0436364_1458127
847 Ga0395901_0254521
848 Ga0436365_0746789
849 Ga0436365_0874056
850 Ga0436365_1529613
851 Ga0436365_1874113
852 Ga0436360_0099632
853 Ga0436361_0057841
854 Ga0436362_0547721
855 Ga0450911_000324
856 Ga0439464_0016683
857 Ga0466963_0409657
858 Ga0453684_0034119
859 Ga0453684_0164420
860 Ga0466960_0009043
861 Ga0451576_0020995
862 Ga0451576_0158034
863 Ga0451576_0183376
864 Ga0451576_0212179
865 Ga0451576_0261252
866 Ga0466958_0018387
867 Ga0495627_007828
868 Ga0495603_0000242
869 Ga0495591_000196
870 Ga0495641_0043343
871 Ga0495639_0166757
872 Ga0495639_0221738
873 Ga0495584_0019294
874 Ga0495594_0139885
875 Ga0495607_0058667
876 Ga0495607_0066518
877 Ga0495607_0083299
878 Ga0495607_0093225
879 Ga0495610_0001758
880 Ga0495616_0013358
881 Ga0495628_0186712
882 Ga0495628_0317880
883 Ga0495628_0357301
884 Ga0495630_0452890
885 Ga0495632_0000199
886 Ga0495632_0000500
887 Ga0495643_0097091
888 Ga0495648_0072752
889 Ga0495642_0000252
890 Ga0495654_0004278
891 Ga0495654_0039343
892 Ga0495665_0057063
893 Ga0495586_0053005
894 Ga0495586_0061042
895 Ga0495645_0007742
896 Ga0495645_0045377
897 Ga0495668_0000442
898 Ga0495625_0001018
899 Ga0495661_0000043
900 Ga0495599_0029667
901 Ga0495647_0031660
902 Ga0495613_0036141
903 Ga0495613_0173168
904 Ga0495671_0000900
905 Ga0495671_0001466
906 Ga0495671_0007290
907 Ga0495671_0010316
908 Ga0495600_0207971
909 Ga0495660_0109536
910 Ga0495581_0116635
911 Ga0495672_0000962
912 Ga0495672_0059337
913 Ga0495672_0156043
914 Ga0495676_0358257
915 Ga0495680_0037385
916 Ga0495680_0104007
917 Ga0495673_0000982
918 Ga0495681_0001266
919 Ga0495681_0001737
920 Ga0495681_0011990
921 Ga0495681_0033920
922 Ga0495684_0321655
923 Ga0495686_0023277
924 Ga0495686_0051379
925 Ga0495626_0000546
926 Ga0496100_0002239
927 Ga0496100_0025175
928 Ga0496100_0493850
929 Ga0496101_0001654
930 Ga0496101_0228394
931 Ga0496102_0457036
932 Ga0496103_0045084
933 Ga0496106_0014833
934 Ga0496107_0056863
935 Ga0496107_0121406
936 Ga0496107_0122164
937 Ga0496114_0113468
938 Ga0496114_0241309
939 Ga0496115_0044417
940 Ga0496115_0121871
941 Ga0496115_0173432
942 Ga0496115_0195864
943 Ga0496115_0198249
944 Ga0496119_0013251
945 Ga0496121_0004223
946 Ga0496124_0051570
947 Ga0496125_0005806
948 Ga0496125_0022340
949 Ga0501031_0000022
950 Ga0501031_0192979
951 Ga0501032_0000063
952 Ga0501032_0023782
953 Ga0501033_0000073
954 Ga0501033_0036261
955 Ga0501033_0053844
956 Ga0501033_0060874
957 Ga0501034_0000276
958 Ga0501034_0000486
959 Ga0501034_0139274
960 Ga0501036_0000030
961 Ga0501036_0063834
962 Ga0501036_0193888
963 Ga0501037_0000075
964 Ga0501037_0003512
965 Ga0501037_0090710
966 Ga0501038_0000058
967 Ga0501038_0001306
968 Ga0501038_0034450
969 Ga0501039_0000054
970 Ga0501039_0008043
971 Ga0501039_0281222
972 Ga0501040_0004883
973 Ga0501040_0006460
974 Ga0501040_0312520
975 Ga0501041_0004325
976 Ga0501042_0002562
977 Ga0501043_0011647
978 Ga0501043_0013716
979 Ga0501043_0107049
980 Ga0501046_0008115
981 Ga0501046_0172613
982 Ga0501047_0007031
983 Ga0501047_0022256
984 Ga0501047_0022839
985 Ga0501048_0013923
986 Ga0501048_0120992
987 Ga0501067_0033245
988 Ga0501068_0138116
989 Ga0501069_0008342
990 Ga0501070_0042458
991 Ga0501070_0053856
992 Ga0501072_0023517
993 Ga0501072_0059169
994 Ga0501073_0000341
995 Ga0501074_0000731
996 Ga0501074_0005416
997 Ga0501075_0006148
998 Ga0501077_0067095
999 Ga0501079_0003821
1000 Ga0501079_0013223
1001 Ga0501080_0033550
1002 Ga0501080_0432834
1003 Ga0501081_0010503
1004 Ga0501081_0668088
1005 Ga0501083_0002305
1006 Ga0501035_0000126
1007 Ga0501035_0126421
1008 Ga0501044_0000131
1009 Ga0501044_0015112
1010 Ga0501045_0000366
1011 nmdc:mga0k408_82209_c1
1012 nmdc:mga07m45_50675_c1
1013 nmdc:mga05p37_1021833_c1
1014 nmdc:mga08y16_622413_c1
1015 nmdc:mga08y16_9912_c1
1016 nmdc:mga0n895_368207_c1
1017 nmdc:mga0a205_679645_c1
1018 Ga0495601_0004791
1019 Ga0500651_0008155
1020 Ga0500620_081165
1021 Ga0501084_0004564
1022 Ga0501082_0000132
1023 Ga0466962_0021736
1024 Ga0530510_0005457
1025 2511389451
1026 2566992079
1027 2808900085
1028 2842872735
1029 2904538518
1030 2922559249
1031 2984593849
1032 3007422155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

231

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

279

0.94

PF08659

KR

KR domain

35

214

0.88

PF23441

32

280

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tzk-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92a) from vibrio cholerae 0.9722 2 248
3tzh-assembly3.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(f187a) from vibrio cholerae 0.9718 2 248
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9708 3 248
3u09-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae 0.9703 2 248
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9699 2 248
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9766 83 248 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 3 248 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9699 2 248 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 63 180 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 5 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C6BQX5-F1-model_v4 SDR family oxidoreductase 0.9856 64 250 GO:0008202
GO:0016616
AF-A0A7Y8MFL0-F1-model_v4 SDR family oxidoreductase 0.9829 2 250 GO:0006633
GO:0016616
GO:0048038
AF-A0A4Y8QGT5-F1-model_v4 deleted 0.9813 3 250
AF-A0A7V8YSH7-F1-model_v4 SDR family oxidoreductase 0.9801 3 250 GO:0016616
AF-A0A2E3ZXT1-F1-model_v4 deleted 0.9793 1 250

Map