F458540

General Info

Members Datasets Scaffolds Average Seq Length
520 262 1040 134

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10106621|Ga0213872_101066212
Length 154
Sequence MPAGALQAPLGCGRRRSEETSMTMVRLIEYAEASAEIRAVYDDIMKTRGTDWINNFWKALANHPPTLRRTWESIREVMAPGTLDPLTKELLYLAVSASNGCAYCIASHAAAAKRAGMTPEMLGEVMAIVGMANETNSLANGYRVPVDERFEKLF

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
192 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10106621 3300021361 Bacteria 1247
2 JGI24745J21846_1025672 3300002073 Bacteria 701
3 Ga0065715_10092167 3300005293 Bacteria 5285
4 Ga0065707_10049202 3300005295 Bacteria 959
5 Ga0070676_10000790 3300005328 Bacteria 15624
6 Ga0070683_100060567 3300005329 Bacteria 3518
7 Ga0070690_100029737 3300005330 Bacteria 3391
8 Ga0070670_100000289 3300005331 Bacteria 44312
9 Ga0068869_100000097 3300005334 Bacteria 40779
10 Ga0070680_100017224 3300005336 Bacteria 5694
11 Ga0070680_100211323 3300005336 Bacteria 1637
12 Ga0070682_100000470 3300005337 Bacteria 25396
13 Ga0068868_100094573 3300005338 Bacteria 2411
14 Ga0070660_100000344 3300005339 Bacteria 30977
15 Ga0070691_10021360 3300005341 Bacteria 2995
16 Ga0070687_100217514 3300005343 Bacteria 1168
17 Ga0070661_100000216 3300005344 Bacteria 47692
18 Ga0070692_10016505 3300005345 Bacteria 3512
19 Ga0070692_11339179 3300005345 Bacteria 515
20 Ga0070668_101841077 3300005347 Bacteria 557
21 Ga0070669_100388757 3300005353 Bacteria 1139
22 Ga0070669_100667198 3300005353 Bacteria 876
23 Ga0070675_100602006 3300005354 Bacteria 997
24 Ga0070671_100079895 3300005355 Bacteria 2734
25 Ga0070659_100000946 3300005366 Bacteria 21360
26 Ga0070667_102264361 3300005367 Bacteria 512
27 Ga0070703_10007423 3300005406 Bacteria 3078
28 Ga0070703_10009804 3300005406 Bacteria 2700
29 Ga0070709_10107659 3300005434 Bacteria 1868
30 Ga0070714_100202433 3300005435 Bacteria 1817
31 Ga0070714_100241201 3300005435 Bacteria 1668
32 Ga0070713_100014369 3300005436 Bacteria 5877
33 Ga0070710_10900443 3300005437 Bacteria 639
34 Ga0070701_10011108 3300005438 Bacteria 4010
35 Ga0070711_101844682 3300005439 Bacteria 531
36 Ga0070705_100032189 3300005440 Bacteria 2911
37 Ga0070705_100084109 3300005440 Bacteria 1963
38 Ga0070705_100094320 3300005440 Bacteria 1873
39 Ga0070705_100191797 3300005440 Unclassified 1393
40 Ga0070700_100073418 3300005441 Bacteria 2190
41 Ga0070700_100166639 3300005441 Bacteria 1522
42 Ga0070694_100000301 3300005444 Bacteria 26521
43 Ga0070694_100001633 3300005444 Bacteria 13167
44 Ga0070694_100027249 3300005444 Bacteria 3709
45 Ga0070694_100112221 3300005444 Bacteria 1944
46 Ga0070694_101244803 3300005444 Bacteria 625
47 Ga0070708_100021037 3300005445 Bacteria 5509
48 Ga0070708_100524123 3300005445 Bacteria 1118
49 Ga0070662_100021873 3300005457 Bacteria 4371
50 Ga0070681_10175883 3300005458 Bacteria 2062
51 Ga0070681_10685443 3300005458 Bacteria 940
52 Ga0068867_100000427 3300005459 Bacteria 28168
53 Ga0068867_100152943 3300005459 Bacteria 1814
54 Ga0068867_100350324 3300005459 Bacteria 1232
55 Ga0070706_100004251 3300005467 Bacteria 13895
56 Ga0070706_100048473 3300005467 Bacteria 3920
57 Ga0070707_100025451 3300005468 Bacteria 5614
58 Ga0070707_100272186 3300005468 Bacteria 1646
59 Ga0070707_100703295 3300005468 Bacteria 973
60 Ga0070707_101685160 3300005468 Bacteria 601
61 Ga0070698_100004064 3300005471 Bacteria 16096
62 Ga0070698_100007638 3300005471 Bacteria 11701
63 Ga0070698_100279914 3300005471 Bacteria 1600
64 Ga0070698_100329191 3300005471 Bacteria 1459
65 Ga0070699_100009798 3300005518 Bacteria 8290
66 Ga0070699_100033501 3300005518 Bacteria 4439
67 Ga0070699_100043321 3300005518 Bacteria 3896
68 Ga0070699_100049900 3300005518 Bacteria 3622
69 Ga0070699_100159587 3300005518 Bacteria 1995
70 Ga0070699_100224160 3300005518 Bacteria 1676
71 Ga0070699_101172483 3300005518 Bacteria 705
72 Ga0070679_100004642 3300005530 Bacteria 12682
73 Ga0070679_100149601 3300005530 Bacteria 2312
74 Ga0070679_100210215 3300005530 Bacteria 1910
75 Ga0070684_100008924 3300005535 Bacteria 7869
76 Ga0070697_100082923 3300005536 Bacteria 2644
77 Ga0070697_100188176 3300005536 Bacteria 1751
78 Ga0070697_100190064 3300005536 Bacteria 1742
79 Ga0070697_100397519 3300005536 Bacteria 1195
80 Ga0070697_100511739 3300005536 Bacteria 1050
81 Ga0070697_101158447 3300005536 Unclassified 689
82 Ga0068853_100000092 3300005539 Bacteria 61530
83 Ga0070672_100890256 3300005543 Bacteria 786
84 Ga0070695_100002567 3300005545 Bacteria 10482
85 Ga0070695_100009200 3300005545 Bacteria 5872
86 Ga0070695_100011701 3300005545 Bacteria 5251
87 Ga0070695_100024999 3300005545 Bacteria 3684
88 Ga0070695_100098564 3300005545 Bacteria 1964
89 Ga0070696_100001282 3300005546 Bacteria 16360
90 Ga0070696_100021346 3300005546 Bacteria 4390
91 Ga0070696_100061701 3300005546 Bacteria 2622
92 Ga0070696_101185625 3300005546 Bacteria 645
93 Ga0070696_101924018 3300005546 Bacteria 512
94 Ga0070693_100000157 3300005547 Bacteria 31116
95 Ga0070704_100000312 3300005549 Bacteria 21728
96 Ga0070704_100020972 3300005549 Bacteria 4226
97 Ga0070704_100041229 3300005549 Bacteria 3185
98 Ga0070704_100110194 3300005549 Unclassified 2093
99 Ga0068855_100000264 3300005563 Bacteria 65448
100 Ga0070664_100004423 3300005564 Bacteria 11291
101 Ga0068857_100014562 3300005577 Bacteria 6860
102 Ga0068857_100086610 3300005577 Bacteria 2801
103 Ga0068857_102300524 3300005577 Bacteria 529
104 Ga0068854_100001501 3300005578 Bacteria 14115
105 Ga0068856_100000198 3300005614 Bacteria 63839
106 Ga0068856_101887319 3300005614 Bacteria 608
107 Ga0070702_100018421 3300005615 Bacteria 3623
108 Ga0068859_100003817 3300005617 Bacteria 15384
109 Ga0068859_100366398 3300005617 Bacteria 1536
110 Ga0068859_100369012 3300005617 Bacteria 1531
111 Ga0068864_100016973 3300005618 Bacteria 6065
112 Ga0068861_100004041 3300005719 Bacteria 9828
113 Ga0068861_102187924 3300005719 Bacteria 554
114 Ga0068870_10000535 3300005840 Bacteria 14334
115 Ga0068870_10245473 3300005840 Bacteria 1107
116 Ga0068863_100227240 3300005841 Bacteria 1799
117 Ga0068858_100012773 3300005842 Bacteria 7915
118 Ga0068860_100011921 3300005843 Bacteria 8568
119 Ga0068860_100386746 3300005843 Bacteria 1382
120 Ga0068860_100394632 3300005843 Bacteria 1368
121 Ga0068862_100008493 3300005844 Bacteria 8495
122 Ga0068862_100080858 3300005844 Bacteria 2818
123 Ga0068862_101306983 3300005844 Bacteria 727
124 Ga0081455_10000851 3300005937 Bacteria 39316
125 Ga0081539_10298671 3300005985 Bacteria 693
126 Ga0070717_10000126 3300006028 Bacteria 56422
127 Ga0070717_10062019 3300006028 Bacteria 3100
128 Ga0070717_11237346 3300006028 Bacteria 679
129 Ga0070715_10021254 3300006163 Bacteria 2515
130 Ga0070716_100001888 3300006173 Bacteria 9508
131 Ga0070716_100500886 3300006173 Bacteria 896
132 Ga0070712_100022954 3300006175 Bacteria 4114
133 Ga0075427_10022103 3300006194 Bacteria 1014
134 Ga0068871_100068453 3300006358 Bacteria 2915
135 Ga0075428_100004907 3300006844 Bacteria 14857
136 Ga0075428_100384092 3300006844 Bacteria 1505
137 Ga0075430_100006077 3300006846 Bacteria 10178
138 Ga0075430_100057148 3300006846 Bacteria 3282
139 Ga0075431_100007638 3300006847 Bacteria 10767
140 Ga0075431_100012212 3300006847 Bacteria 8670
141 Ga0075431_100127876 3300006847 Bacteria 2622
142 Ga0075431_100131146 3300006847 Bacteria 2585
143 Ga0075431_100534047 3300006847 Bacteria 1161
144 Ga0075433_10006100 3300006852 Bacteria 9493
145 Ga0075433_10068248 3300006852 Bacteria 3121
146 Ga0075433_10068774 3300006852 Bacteria 3109
147 Ga0075433_10254991 3300006852 Bacteria 1556
148 Ga0075433_10645555 3300006852 Bacteria 928
149 Ga0075434_100113222 3300006871 Bacteria 2725
150 Ga0075434_100166476 3300006871 Bacteria 2224
151 Ga0075434_100359983 3300006871 Bacteria 1476
152 Ga0075429_100000231 3300006880 Bacteria 38094
153 Ga0075429_100086085 3300006880 Bacteria 2739
154 Ga0075429_100337031 3300006880 Bacteria 1320
155 Ga0075436_100081509 3300006914 Bacteria 2244
156 Ga0075436_100224791 3300006914 Bacteria 1332
157 Ga0097620_100003817 3300006931 Bacteria 15384
158 Ga0097620_100366441 3300006931 Bacteria 1536
159 Ga0097620_100369033 3300006931 Bacteria 1531
160 Ga0075435_100001983 3300007076 Bacteria 13366
161 Ga0075435_100279271 3300007076 Bacteria 1425
162 Ga0099794_10308617 3300007265 Bacteria 820
163 Ga0099795_10019514 3300007788 Bacteria 2196
164 Ga0105240_10034948 3300009093 Bacteria 6480
165 Ga0111539_10421820 3300009094 Bacteria 1554
166 Ga0111539_10745888 3300009094 Bacteria 1140
167 Ga0111539_11305606 3300009094 Bacteria 842
168 Ga0105245_10154311 3300009098 Bacteria 2174
169 Ga0105245_10929426 3300009098 Bacteria 912
170 Ga0105247_11740496 3300009101 Bacteria 517
171 Ga0114129_10045389 3300009147 Bacteria 6178
172 Ga0114129_10338797 3300009147 Bacteria 1995
173 Ga0114129_10784150 3300009147 Bacteria 1217
174 Ga0114129_11035922 3300009147 Bacteria 1031
175 Ga0114129_12750441 3300009147 Bacteria 586
176 Ga0105243_10011750 3300009148 Bacteria 6622
177 Ga0105243_10113583 3300009148 Bacteria 2271
178 Ga0105243_11334620 3300009148 Bacteria 736
179 Ga0105241_10000067 3300009174 Bacteria 79719
180 Ga0105241_10306443 3300009174 Unclassified 1365
181 Ga0105241_11323439 3300009174 Bacteria 687
182 Ga0105242_10549978 3300009176 Bacteria 1107
183 Ga0105248_10795693 3300009177 Bacteria 1067
184 Ga0105237_10199963 3300009545 Bacteria 1998
185 Ga0105238_11299172 3300009551 Bacteria 753
186 Ga0105249_10240315 3300009553 Bacteria 1790
187 Ga0105249_10506722 3300009553 Bacteria 1253
188 Ga0105249_10874613 3300009553 Bacteria 965
189 Ga0099796_10082787 3300010159 Bacteria 1179
190 Ga0105246_10239334 3300011119 Bacteria 1434
191 Ga0105246_10619614 3300011119 Bacteria 938
192 Ga0157373_10000417 3300013100 Bacteria 34189
193 Ga0157370_10798530 3300013104 Bacteria 859
194 Ga0157369_10026463 3300013105 Bacteria 6433
195 Ga0157378_10649454 3300013297 Bacteria 1070
196 Ga0163162_10876719 3300013306 Bacteria 1012
197 Ga0157372_10004397 3300013307 Bacteria 15035
198 Ga0157380_11235449 3300014326 Bacteria 792
199 Ga0182007_10018010 3300015262 Bacteria 2569
200 Ga0213873_10021552 3300021358 Bacteria 1517
201 Ga0213872_10110671 3300021361 Bacteria 1220
202 Ga0213872_10399062 3300021361 Bacteria 558
203 Ga0213875_10041476 3300021388 Bacteria 2166
204 Ga0213871_10012387 3300021441 Bacteria 1980
205 Ga0213871_10063746 3300021441 Bacteria 1030
206 Ga0213871_10106618 3300021441 Bacteria 825
207 Ga0207653_10007344 3300025885 Bacteria 3434
208 Ga0207653_10044138 3300025885 Bacteria 1469
209 Ga0207653_10137066 3300025885 Unclassified 892
210 Ga0207688_10040862 3300025901 Bacteria 2578
211 Ga0207647_10051520 3300025904 Bacteria 2544
212 Ga0207685_10059499 3300025905 Bacteria 1507
213 Ga0207685_10125036 3300025905 Bacteria 1134
214 Ga0207645_10000478 3300025907 Bacteria 33059
215 Ga0207645_10072756 3300025907 Bacteria 2201
216 Ga0207643_10000627 3300025908 Bacteria 22262
217 Ga0207643_10084744 3300025908 Bacteria 1840
218 Ga0207684_10000536 3300025910 Bacteria 47037
219 Ga0207684_10004839 3300025910 Bacteria 12599
220 Ga0207684_10018969 3300025910 Bacteria 5884
221 Ga0207684_10119638 3300025910 Bacteria 2258
222 Ga0207684_10371684 3300025910 Bacteria 1230
223 Ga0207684_10928232 3300025910 Bacteria 731
224 Ga0207654_10002210 3300025911 Bacteria 9978
225 Ga0207654_10184515 3300025911 Bacteria 1363
226 Ga0207707_10000124 3300025912 Bacteria 79966
227 Ga0207707_10120688 3300025912 Bacteria 2292
228 Ga0207695_10143820 3300025913 Bacteria 2331
229 Ga0207671_10076968 3300025914 Bacteria 2497
230 Ga0207693_10023275 3300025915 Bacteria 4919
231 Ga0207693_10104188 3300025915 Bacteria 2225
232 Ga0207693_10159534 3300025915 Bacteria 1774
233 Ga0207693_10572602 3300025915 Bacteria 880
234 Ga0207663_10792566 3300025916 Bacteria 754
235 Ga0207660_10000910 3300025917 Bacteria 19471
236 Ga0207660_10140366 3300025917 Bacteria 1847
237 Ga0207662_10224860 3300025918 Bacteria 1223
238 Ga0207657_10000049 3300025919 Bacteria 110963
239 Ga0207649_10035402 3300025920 Bacteria 3000
240 Ga0207652_10001219 3300025921 Bacteria 23033
241 Ga0207652_10077034 3300025921 Bacteria 2909
242 Ga0207646_10001461 3300025922 Bacteria 29246
243 Ga0207646_10011458 3300025922 Bacteria 8592
244 Ga0207646_10181697 3300025922 Bacteria 1900
245 Ga0207646_11389922 3300025922 Bacteria 611
246 Ga0207681_10109149 3300025923 Bacteria 2010
247 Ga0207681_10149010 3300025923 Bacteria 1751
248 Ga0207681_11471542 3300025923 Bacteria 571
249 Ga0207694_11227278 3300025924 Bacteria 634
250 Ga0207659_10075401 3300025926 Bacteria 2475
251 Ga0207687_10465594 3300025927 Bacteria 1050
252 Ga0207700_10377453 3300025928 Bacteria 1239
253 Ga0207644_11149516 3300025931 Bacteria 652
254 Ga0207690_10000447 3300025932 Bacteria 26702
255 Ga0207706_10000806 3300025933 Bacteria 32503
256 Ga0207686_10037683 3300025934 Bacteria 2919
257 Ga0207709_10041322 3300025935 Bacteria 2766
258 Ga0207670_10963722 3300025936 Bacteria 716
259 Ga0207665_10007520 3300025939 Bacteria 7201
260 Ga0207665_10233638 3300025939 Bacteria 1352
261 Ga0207691_10155916 3300025940 Bacteria 2005
262 Ga0207689_10000041 3300025942 Bacteria 93210
263 Ga0207689_10026989 3300025942 Bacteria 4808
264 Ga0207689_10050303 3300025942 Bacteria 3436
265 Ga0207661_10147384 3300025944 Bacteria 2032
266 Ga0207679_10000369 3300025945 Bacteria 32608
267 Ga0207667_10000260 3300025949 Bacteria 73502
268 Ga0207712_10495147 3300025961 Bacteria 1044
269 Ga0207712_11071174 3300025961 Bacteria 717
270 Ga0207640_10002099 3300025981 Bacteria 10721
271 Ga0207658_12102826 3300025986 Bacteria 513
272 Ga0207677_10149854 3300026023 Bacteria 1798
273 Ga0207703_10343643 3300026035 Bacteria 1372
274 Ga0207639_10007761 3300026041 Bacteria 7332
275 Ga0207708_10229058 3300026075 Bacteria 1491
276 Ga0207708_10308492 3300026075 Bacteria 1289
277 Ga0207702_10001344 3300026078 Bacteria 24592
278 Ga0207648_10000570 3300026089 Bacteria 41360
279 Ga0207648_10394499 3300026089 Bacteria 1253
280 Ga0207648_10423886 3300026089 Bacteria 1208
281 Ga0207676_10022909 3300026095 Bacteria 4598
282 Ga0207674_10004114 3300026116 Bacteria 17606
283 Ga0207674_10015847 3300026116 Bacteria 8265
284 Ga0207674_11169683 3300026116 Bacteria 739
285 Ga0207675_100005804 3300026118 Bacteria 11801
286 Ga0207675_100834655 3300026118 Bacteria 936
287 Ga0207675_101751216 3300026118 Bacteria 641
288 Ga0209588_1000722 3300027671 Bacteria 8346
289 Ga0207428_10793653 3300027907 Bacteria 673
290 Ga0268265_10012538 3300028380 Bacteria 5745
291 Ga0268265_10418646 3300028380 Bacteria 1243
292 Ga0268265_12139981 3300028380 Bacteria 566
293 Ga0268264_10013327 3300028381 Bacteria 6768
294 Ga0268264_10220000 3300028381 Bacteria 1748
295 Ga0268264_10773039 3300028381 Bacteria 958
296 Ga0307410_11313071 3300031852 Bacteria 633
297 Ga0373948_0074187 3300034817 Bacteria 767
298 Ga0373950_0035174 3300034818 Bacteria 941
299 Ga0373959_0036949 3300034820 Bacteria 1010
300 Ga0373928_0016165 3300035084 Bacteria 1525
301 Ga0373934_0011578 3300035086 Bacteria 3317
302 Ga0373940_0070626 3300035088 Bacteria 1016
303 Ga0373951_0013107 3300035091 Bacteria 1863
304 Ga0373951_0062663 3300035091 Bacteria 934
305 Ga0373952_0274645 3300035092 Bacteria 517
306 Ga0373923_0061037 3300035111 Bacteria 1601
307 Ga0373932_0130648 3300035112 Bacteria 846
308 Ga0373941_0407531 3300035115 Bacteria 563
309 Ga0373953_0025043 3300035117 Bacteria 2275
310 Ga0373954_0017689 3300035118 Bacteria 3203
311 Ga0373956_0003392 3300035119 Bacteria 6418
312 Ga0373957_0034906 3300035120 Bacteria 1865
313 Ga0373960_0009180 3300035121 Bacteria 2388
314 Ga0373955_0367102 3300035172 Bacteria 873
315 Ga0373942_0023000 3300035207 Bacteria 1588
316 Ga0373961_0002914 3300035241 Bacteria 4338
317 Ga0373962_0064353 3300035242 Bacteria 1083
318 Ga0373931_0009237 3300035691 Bacteria 4709
319 Ga0373931_0181035 3300035691 Bacteria 1248
320 Ga0373931_0627386 3300035691 Bacteria 704
321 Ga0373933_0005495 3300035724 Bacteria 6905
322 Ga0436364_0509304 3300037853 Bacteria 4813
323 Ga0242420_059987 3300038996 Bacteria 757
324 Ga0436365_0767904 3300039437 Bacteria 1376
325 Ga0436365_1669401 3300039437 Bacteria 1960
326 Ga0436360_0190001 3300039438 Bacteria 2199
327 Ga0436360_0281605 3300039438 Bacteria 565
328 Ga0436360_0415178 3300039438 Bacteria 694
329 Ga0436360_0631390 3300039438 Bacteria 845
330 Ga0436360_0669511 3300039438 Bacteria 1032
331 Ga0436360_1179637 3300039438 Bacteria 1284
332 Ga0436360_1215866 3300039438 Bacteria 527
333 Ga0436361_0001127 3300039447 Bacteria 1379
334 Ga0436361_0079547 3300039447 Bacteria 629
335 Ga0436361_0285337 3300039447 Bacteria 3883
336 Ga0436361_0666864 3300039447 Bacteria 2922
337 Ga0436361_0697580 3300039447 Bacteria 1152
338 Ga0436361_0978911 3300039447 Bacteria 1774
339 Ga0436363_0669833 3300039450 Bacteria 1736
340 Ga0436363_1129493 3300039450 Bacteria 748
341 Ga0436363_1376634 3300039450 Bacteria 2973
342 Ga0436363_1714652 3300039450 Bacteria 711
343 Ga0436362_0115332 3300039453 Unclassified 600
344 Ga0436362_0274543 3300039453 Bacteria 5191
345 Ga0436362_0306676 3300039453 Bacteria 1078
346 Ga0436362_0620031 3300039453 Bacteria 1869
347 Ga0436362_1082470 3300039453 Bacteria 909
348 Ga0439441_090286 3300042001 Unclassified 677
349 Ga0439443_038483 3300042003 Bacteria 811
350 Ga0439448_0001477 3300042005 Bacteria 6103
351 Ga0439450_022958 3300042008 Bacteria 1350
352 Ga0450889_003405 3300042144 Bacteria 1569
353 Ga0439435_0078806 3300042436 Unclassified 986
354 Ga0439435_0096841 3300042436 Bacteria 903
355 Ga0439464_0010301 3300042439 Bacteria 2467
356 Ga0439460_0000778 3300042461 Bacteria 7194
357 Ga0439460_0040316 3300042461 Unclassified 1368
358 Ga0439460_0156900 3300042461 Bacteria 761
359 Ga0451577_0016197 3300042876 Bacteria 6910
360 Ga0451577_0041830 3300042876 Bacteria 4112
361 Ga0451577_0191571 3300042876 Bacteria 1844
362 Ga0451577_0993300 3300042876 Bacteria 754
363 Ga0453683_0006938 3300044673 Bacteria 7722
364 Ga0453684_0102884 3300044712 Bacteria 3491
365 Ga0453684_1213774 3300044712 Bacteria 791
366 Ga0451576_0012884 3300045051 Bacteria 9372
367 Ga0451576_0283652 3300045051 Bacteria 1731
368 Ga0451576_0318476 3300045051 Bacteria 1627
369 Ga0451576_2710584 3300045051 Bacteria 504
370 Ga0495580_0059800 3300046472 Bacteria 2678
371 Ga0495580_0633299 3300046472 Bacteria 704
372 Ga0495639_0119586 3300046475 Bacteria 1256
373 Ga0495608_0452785 3300046511 Bacteria 781
374 Ga0495628_0148409 3300046516 Bacteria 1787
375 Ga0495640_0044191 3300046533 Bacteria 3099
376 Ga0495640_0269649 3300046533 Bacteria 1062
377 Ga0495587_0136873 3300046536 Bacteria 1399
378 Ga0495597_0219098 3300046542 Bacteria 756
379 Ga0495667_0250406 3300046559 Bacteria 1127
380 Ga0495599_0144816 3300046678 Bacteria 1473
381 Ga0495600_0122799 3300046809 Bacteria 1689
382 Ga0495684_0183247 3300047471 Bacteria 1551
383 Ga0495602_0105366 3300048088 Bacteria 2305
384 Ga0495602_0596947 3300048088 Bacteria 760
385 Ga0496102_0034783 3300048905 Bacteria 4534
386 Ga0496102_0175090 3300048905 Bacteria 2020
387 Ga0496104_0652772 3300048907 Bacteria 961
388 Ga0496106_0094644 3300048909 Bacteria 2310
389 Ga0496107_0414725 3300048910 Bacteria 1001
390 Ga0496107_0601921 3300048910 Bacteria 812
391 Ga0496108_1443123 3300048911 Bacteria 574
392 Ga0496109_0239686 3300048912 Bacteria 1707
393 Ga0496112_0346490 3300048915 Bacteria 1428
394 Ga0501033_0182442 3300049570 Bacteria 1504
395 Ga0501034_0005819 3300049571 Bacteria 13410
396 Ga0501036_0111406 3300049572 Bacteria 2313
397 Ga0501037_0384161 3300049573 Bacteria 965
398 Ga0501038_0386898 3300049574 Bacteria 1084
399 Ga0501039_0729370 3300049575 Bacteria 774
400 Ga0501040_0001260 3300049576 Bacteria 16107
401 Ga0501040_0076427 3300049576 Bacteria 2315
402 Ga0501040_0093004 3300049576 Bacteria 2097
403 Ga0501040_0144834 3300049576 Bacteria 1674
404 Ga0501040_0315344 3300049576 Bacteria 1118
405 Ga0501041_0004806 3300049577 Bacteria 7848
406 Ga0501041_0170869 3300049577 Bacteria 1360
407 Ga0501041_0313942 3300049577 Bacteria 988
408 Ga0501041_0385948 3300049577 Bacteria 886
409 Ga0501043_0340360 3300049579 Bacteria 1141
410 Ga0501043_0465579 3300049579 Bacteria 948
411 Ga0501046_0125385 3300049580 Bacteria 1951
412 Ga0501046_0131343 3300049580 Bacteria 1899
413 Ga0501046_0205337 3300049580 Bacteria 1465
414 Ga0501046_0295567 3300049580 Bacteria 1184
415 Ga0501046_0468581 3300049580 Bacteria 905
416 Ga0501047_0038591 3300049581 Bacteria 4621
417 Ga0501048_0195980 3300049582 Bacteria 1432
418 Ga0501048_0430176 3300049582 Bacteria 945
419 Ga0501048_1147428 3300049582 Bacteria 559
420 Ga0501048_1338062 3300049582 Unclassified 515
421 Ga0501068_0210759 3300049584 Bacteria 1234
422 Ga0501069_0338218 3300049585 Bacteria 886
423 Ga0501071_0155772 3300049587 Bacteria 1706
424 Ga0501071_0220897 3300049587 Bacteria 1426
425 Ga0501071_0386773 3300049587 Bacteria 1067
426 Ga0501071_0767955 3300049587 Bacteria 743
427 Ga0501072_0011672 3300049588 Bacteria 6712
428 Ga0501072_0065907 3300049588 Bacteria 2856
429 Ga0501072_0072227 3300049588 Bacteria 2727
430 Ga0501072_0102103 3300049588 Bacteria 2279
431 Ga0501072_0139421 3300049588 Bacteria 1933
432 Ga0501072_0263881 3300049588 Bacteria 1371
433 Ga0501072_0270492 3300049588 Bacteria 1352
434 Ga0501072_0756335 3300049588 Bacteria 762
435 Ga0501073_0224944 3300049589 Bacteria 1296
436 Ga0501074_0034628 3300049590 Bacteria 3661
437 Ga0501074_0292096 3300049590 Bacteria 1158
438 Ga0501074_0354864 3300049590 Bacteria 1041
439 Ga0501075_0018651 3300049591 Bacteria 5024
440 Ga0501075_0069044 3300049591 Bacteria 2670
441 Ga0501075_0069789 3300049591 Bacteria 2655
442 Ga0501076_0005497 3300049592 Bacteria 9126
443 Ga0501076_0019515 3300049592 Bacteria 5183
444 Ga0501076_0036208 3300049592 Bacteria 3866
445 Ga0501076_0067340 3300049592 Bacteria 2859
446 Ga0501076_1052457 3300049592 Bacteria 670
447 Ga0501077_0038661 3300049593 Bacteria 3039
448 Ga0501077_0125625 3300049593 Bacteria 1626
449 Ga0501077_0146253 3300049593 Bacteria 1499
450 Ga0501077_0229668 3300049593 Bacteria 1179
451 Ga0501077_0451359 3300049593 Bacteria 823
452 Ga0501077_1118347 3300049593 Bacteria 507
453 Ga0501079_0002157 3300049741 Bacteria 14174
454 Ga0501079_0002771 3300049741 Bacteria 12780
455 Ga0501079_0008913 3300049741 Bacteria 7596
456 Ga0501079_0028445 3300049741 Bacteria 4290
457 Ga0501080_0116068 3300049742 Bacteria 2482
458 Ga0501080_0211920 3300049742 Bacteria 1775
459 Ga0501081_0001575 3300049743 Bacteria 14053
460 Ga0501081_0019907 3300049743 Bacteria 4470
461 Ga0501081_0113054 3300049743 Bacteria 1928
462 Ga0501081_0180353 3300049743 Bacteria 1527
463 Ga0501081_0891885 3300049743 Bacteria 670
464 Ga0501083_0057520 3300049744 Bacteria 2603
465 Ga0501083_0097260 3300049744 Bacteria 1942
466 Ga0501083_0275909 3300049744 Bacteria 1094
467 Ga0501035_0347456 3300049822 Bacteria 1242
468 Ga0501035_1260463 3300049822 Bacteria 571
469 Ga0501035_1470546 3300049822 Bacteria 520
470 Ga0501045_0002137 3300049824 Bacteria 13383
471 Ga0501045_0072085 3300049824 Bacteria 2543
472 Ga0501045_0136581 3300049824 Bacteria 1823
473 Ga0501045_0225745 3300049824 Bacteria 1394
474 Ga0501045_0642104 3300049824 Bacteria 785
475 nmdc:mga05p37_127026_c1 3300050507 Bacteria 3131
476 nmdc:mga05p37_33814_c1 3300050507 Bacteria 6262
477 nmdc:mga05p37_45237_c1 3300050507 Bacteria 5416
478 nmdc:mga09592_21637_c1 3300050508 Bacteria 5301
479 nmdc:mga09592_691_c1 3300050508 Bacteria 25783
480 nmdc:mga0qj67_213_c1 3300050509 Bacteria 39502
481 nmdc:mga0qj67_47974_c1 3300050509 Bacteria 3375
482 nmdc:mga06r32_105563_c1 3300050510 Bacteria 2767
483 nmdc:mga06r32_110665_c1 3300050510 Bacteria 2702
484 nmdc:mga06r32_119271_c1 3300050510 Bacteria 2601
485 nmdc:mga06r32_1284263_c1 3300050510 Bacteria 676
486 nmdc:mga06r32_179777_c1 3300050510 Bacteria 2101
487 nmdc:mga06r32_33229_c1 3300050510 Bacteria 4859
488 nmdc:mga0n895_111401_c1 3300050512 Bacteria 2753
489 nmdc:mga0n895_302403_c1 3300050512 Bacteria 1622
490 nmdc:mga0n895_38971_c1 3300050512 Bacteria 4608
491 nmdc:mga0n895_404904_c1 3300050512 Bacteria 1380
492 nmdc:mga0rr50_12491_c1 3300050513 Bacteria 5493
493 nmdc:mga0rr50_202284_c1 3300050513 Bacteria 1632
494 nmdc:mga0rr50_70099_c1 3300050513 Bacteria 2671
495 nmdc:mga08x19_200151_c1 3300050514 Bacteria 1369
496 nmdc:mga08x19_49658_c1 3300050514 Bacteria 2691
497 nmdc:mga08x19_585223_c1 3300050514 Bacteria 791
498 nmdc:mga0a205_4078_c1 3300050515 Bacteria 13061
499 nmdc:mga0a205_50888_c1 3300050515 Bacteria 3999
500 nmdc:mga0a205_71744_c1 3300050515 Bacteria 3345
501 nmdc:mga0a205_86194_c1 3300050515 Bacteria 3033
502 Ga0495601_0004791 3300053077 Bacteria 7845
503 Ga0495595_0091144 3300053084 Bacteria 1462
504 Ga0495619_0050417 3300053085 Bacteria 2747
505 Ga0501084_0002108 3300054114 Bacteria 15892
506 Ga0501084_0047111 3300054114 Bacteria 3610
507 Ga0501084_0078163 3300054114 Bacteria 2773
508 Ga0501084_0156132 3300054114 Bacteria 1924
509 Ga0501084_0625516 3300054114 Bacteria 909
510 Ga0501082_0000316 3300060353 Bacteria 43097
511 Ga0501082_0027357 3300060353 Bacteria 4910
512 Ga0501082_0054313 3300060353 Bacteria 3453
513 Ga0501082_1121782 3300060353 Bacteria 687
514 Ga0501082_1598231 3300060353 Bacteria 569
515 Ga0530510_0009931 3300061734 Bacteria 6679
516 Ga0530510_0029940 3300061734 Bacteria 3908
517 Ga0530510_0074823 3300061734 Bacteria 2459
518 Ga0530510_0296697 3300061734 Bacteria 1209
519 Ga0530510_0350347 3300061734 Bacteria 1109
520 Ga0530510_0701527 3300061734 Bacteria 771
521 Ga0213872_10106621
522 JGI24745J21846_1025672
523 Ga0065715_10092167
524 Ga0065707_10049202
525 Ga0070676_10000790
526 Ga0070683_100060567
527 Ga0070690_100029737
528 Ga0070670_100000289
529 Ga0068869_100000097
530 Ga0070680_100017224
531 Ga0070680_100211323
532 Ga0070682_100000470
533 Ga0068868_100094573
534 Ga0070660_100000344
535 Ga0070691_10021360
536 Ga0070687_100217514
537 Ga0070661_100000216
538 Ga0070692_10016505
539 Ga0070692_11339179
540 Ga0070668_101841077
541 Ga0070669_100388757
542 Ga0070669_100667198
543 Ga0070675_100602006
544 Ga0070671_100079895
545 Ga0070659_100000946
546 Ga0070667_102264361
547 Ga0070703_10007423
548 Ga0070703_10009804
549 Ga0070709_10107659
550 Ga0070714_100202433
551 Ga0070714_100241201
552 Ga0070713_100014369
553 Ga0070710_10900443
554 Ga0070701_10011108
555 Ga0070711_101844682
556 Ga0070705_100032189
557 Ga0070705_100084109
558 Ga0070705_100094320
559 Ga0070705_100191797
560 Ga0070700_100073418
561 Ga0070700_100166639
562 Ga0070694_100000301
563 Ga0070694_100001633
564 Ga0070694_100027249
565 Ga0070694_100112221
566 Ga0070694_101244803
567 Ga0070708_100021037
568 Ga0070708_100524123
569 Ga0070662_100021873
570 Ga0070681_10175883
571 Ga0070681_10685443
572 Ga0068867_100000427
573 Ga0068867_100152943
574 Ga0068867_100350324
575 Ga0070706_100004251
576 Ga0070706_100048473
577 Ga0070707_100025451
578 Ga0070707_100272186
579 Ga0070707_100703295
580 Ga0070707_101685160
581 Ga0070698_100004064
582 Ga0070698_100007638
583 Ga0070698_100279914
584 Ga0070698_100329191
585 Ga0070699_100009798
586 Ga0070699_100033501
587 Ga0070699_100043321
588 Ga0070699_100049900
589 Ga0070699_100159587
590 Ga0070699_100224160
591 Ga0070699_101172483
592 Ga0070679_100004642
593 Ga0070679_100149601
594 Ga0070679_100210215
595 Ga0070684_100008924
596 Ga0070697_100082923
597 Ga0070697_100188176
598 Ga0070697_100190064
599 Ga0070697_100397519
600 Ga0070697_100511739
601 Ga0070697_101158447
602 Ga0068853_100000092
603 Ga0070672_100890256
604 Ga0070695_100002567
605 Ga0070695_100009200
606 Ga0070695_100011701
607 Ga0070695_100024999
608 Ga0070695_100098564
609 Ga0070696_100001282
610 Ga0070696_100021346
611 Ga0070696_100061701
612 Ga0070696_101185625
613 Ga0070696_101924018
614 Ga0070693_100000157
615 Ga0070704_100000312
616 Ga0070704_100020972
617 Ga0070704_100041229
618 Ga0070704_100110194
619 Ga0068855_100000264
620 Ga0070664_100004423
621 Ga0068857_100014562
622 Ga0068857_100086610
623 Ga0068857_102300524
624 Ga0068854_100001501
625 Ga0068856_100000198
626 Ga0068856_101887319
627 Ga0070702_100018421
628 Ga0068859_100003817
629 Ga0068859_100366398
630 Ga0068859_100369012
631 Ga0068864_100016973
632 Ga0068861_100004041
633 Ga0068861_102187924
634 Ga0068870_10000535
635 Ga0068870_10245473
636 Ga0068863_100227240
637 Ga0068858_100012773
638 Ga0068860_100011921
639 Ga0068860_100386746
640 Ga0068860_100394632
641 Ga0068862_100008493
642 Ga0068862_100080858
643 Ga0068862_101306983
644 Ga0081455_10000851
645 Ga0081539_10298671
646 Ga0070717_10000126
647 Ga0070717_10062019
648 Ga0070717_11237346
649 Ga0070715_10021254
650 Ga0070716_100001888
651 Ga0070716_100500886
652 Ga0070712_100022954
653 Ga0075427_10022103
654 Ga0068871_100068453
655 Ga0075428_100004907
656 Ga0075428_100384092
657 Ga0075430_100006077
658 Ga0075430_100057148
659 Ga0075431_100007638
660 Ga0075431_100012212
661 Ga0075431_100127876
662 Ga0075431_100131146
663 Ga0075431_100534047
664 Ga0075433_10006100
665 Ga0075433_10068248
666 Ga0075433_10068774
667 Ga0075433_10254991
668 Ga0075433_10645555
669 Ga0075434_100113222
670 Ga0075434_100166476
671 Ga0075434_100359983
672 Ga0075429_100000231
673 Ga0075429_100086085
674 Ga0075429_100337031
675 Ga0075436_100081509
676 Ga0075436_100224791
677 Ga0097620_100003817
678 Ga0097620_100366441
679 Ga0097620_100369033
680 Ga0075435_100001983
681 Ga0075435_100279271
682 Ga0099794_10308617
683 Ga0099795_10019514
684 Ga0105240_10034948
685 Ga0111539_10421820
686 Ga0111539_10745888
687 Ga0111539_11305606
688 Ga0105245_10154311
689 Ga0105245_10929426
690 Ga0105247_11740496
691 Ga0114129_10045389
692 Ga0114129_10338797
693 Ga0114129_10784150
694 Ga0114129_11035922
695 Ga0114129_12750441
696 Ga0105243_10011750
697 Ga0105243_10113583
698 Ga0105243_11334620
699 Ga0105241_10000067
700 Ga0105241_10306443
701 Ga0105241_11323439
702 Ga0105242_10549978
703 Ga0105248_10795693
704 Ga0105237_10199963
705 Ga0105238_11299172
706 Ga0105249_10240315
707 Ga0105249_10506722
708 Ga0105249_10874613
709 Ga0099796_10082787
710 Ga0105246_10239334
711 Ga0105246_10619614
712 Ga0157373_10000417
713 Ga0157370_10798530
714 Ga0157369_10026463
715 Ga0157378_10649454
716 Ga0163162_10876719
717 Ga0157372_10004397
718 Ga0157380_11235449
719 Ga0182007_10018010
720 Ga0213873_10021552
721 Ga0213872_10110671
722 Ga0213872_10399062
723 Ga0213875_10041476
724 Ga0213871_10012387
725 Ga0213871_10063746
726 Ga0213871_10106618
727 Ga0207653_10007344
728 Ga0207653_10044138
729 Ga0207653_10137066
730 Ga0207688_10040862
731 Ga0207647_10051520
732 Ga0207685_10059499
733 Ga0207685_10125036
734 Ga0207645_10000478
735 Ga0207645_10072756
736 Ga0207643_10000627
737 Ga0207643_10084744
738 Ga0207684_10000536
739 Ga0207684_10004839
740 Ga0207684_10018969
741 Ga0207684_10119638
742 Ga0207684_10371684
743 Ga0207684_10928232
744 Ga0207654_10002210
745 Ga0207654_10184515
746 Ga0207707_10000124
747 Ga0207707_10120688
748 Ga0207695_10143820
749 Ga0207671_10076968
750 Ga0207693_10023275
751 Ga0207693_10104188
752 Ga0207693_10159534
753 Ga0207693_10572602
754 Ga0207663_10792566
755 Ga0207660_10000910
756 Ga0207660_10140366
757 Ga0207662_10224860
758 Ga0207657_10000049
759 Ga0207649_10035402
760 Ga0207652_10001219
761 Ga0207652_10077034
762 Ga0207646_10001461
763 Ga0207646_10011458
764 Ga0207646_10181697
765 Ga0207646_11389922
766 Ga0207681_10109149
767 Ga0207681_10149010
768 Ga0207681_11471542
769 Ga0207694_11227278
770 Ga0207659_10075401
771 Ga0207687_10465594
772 Ga0207700_10377453
773 Ga0207644_11149516
774 Ga0207690_10000447
775 Ga0207706_10000806
776 Ga0207686_10037683
777 Ga0207709_10041322
778 Ga0207670_10963722
779 Ga0207665_10007520
780 Ga0207665_10233638
781 Ga0207691_10155916
782 Ga0207689_10000041
783 Ga0207689_10026989
784 Ga0207689_10050303
785 Ga0207661_10147384
786 Ga0207679_10000369
787 Ga0207667_10000260
788 Ga0207712_10495147
789 Ga0207712_11071174
790 Ga0207640_10002099
791 Ga0207658_12102826
792 Ga0207677_10149854
793 Ga0207703_10343643
794 Ga0207639_10007761
795 Ga0207708_10229058
796 Ga0207708_10308492
797 Ga0207702_10001344
798 Ga0207648_10000570
799 Ga0207648_10394499
800 Ga0207648_10423886
801 Ga0207676_10022909
802 Ga0207674_10004114
803 Ga0207674_10015847
804 Ga0207674_11169683
805 Ga0207675_100005804
806 Ga0207675_100834655
807 Ga0207675_101751216
808 Ga0209588_1000722
809 Ga0207428_10793653
810 Ga0268265_10012538
811 Ga0268265_10418646
812 Ga0268265_12139981
813 Ga0268264_10013327
814 Ga0268264_10220000
815 Ga0268264_10773039
816 Ga0307410_11313071
817 Ga0373948_0074187
818 Ga0373950_0035174
819 Ga0373959_0036949
820 Ga0373928_0016165
821 Ga0373934_0011578
822 Ga0373940_0070626
823 Ga0373951_0013107
824 Ga0373951_0062663
825 Ga0373952_0274645
826 Ga0373923_0061037
827 Ga0373932_0130648
828 Ga0373941_0407531
829 Ga0373953_0025043
830 Ga0373954_0017689
831 Ga0373956_0003392
832 Ga0373957_0034906
833 Ga0373960_0009180
834 Ga0373955_0367102
835 Ga0373942_0023000
836 Ga0373961_0002914
837 Ga0373962_0064353
838 Ga0373931_0009237
839 Ga0373931_0181035
840 Ga0373931_0627386
841 Ga0373933_0005495
842 Ga0436364_0509304
843 Ga0242420_059987
844 Ga0436365_0767904
845 Ga0436365_1669401
846 Ga0436360_0190001
847 Ga0436360_0281605
848 Ga0436360_0415178
849 Ga0436360_0631390
850 Ga0436360_0669511
851 Ga0436360_1179637
852 Ga0436360_1215866
853 Ga0436361_0001127
854 Ga0436361_0079547
855 Ga0436361_0285337
856 Ga0436361_0666864
857 Ga0436361_0697580
858 Ga0436361_0978911
859 Ga0436363_0669833
860 Ga0436363_1129493
861 Ga0436363_1376634
862 Ga0436363_1714652
863 Ga0436362_0115332
864 Ga0436362_0274543
865 Ga0436362_0306676
866 Ga0436362_0620031
867 Ga0436362_1082470
868 Ga0439441_090286
869 Ga0439443_038483
870 Ga0439448_0001477
871 Ga0439450_022958
872 Ga0450889_003405
873 Ga0439435_0078806
874 Ga0439435_0096841
875 Ga0439464_0010301
876 Ga0439460_0000778
877 Ga0439460_0040316
878 Ga0439460_0156900
879 Ga0451577_0016197
880 Ga0451577_0041830
881 Ga0451577_0191571
882 Ga0451577_0993300
883 Ga0453683_0006938
884 Ga0453684_0102884
885 Ga0453684_1213774
886 Ga0451576_0012884
887 Ga0451576_0283652
888 Ga0451576_0318476
889 Ga0451576_2710584
890 Ga0495580_0059800
891 Ga0495580_0633299
892 Ga0495639_0119586
893 Ga0495608_0452785
894 Ga0495628_0148409
895 Ga0495640_0044191
896 Ga0495640_0269649
897 Ga0495587_0136873
898 Ga0495597_0219098
899 Ga0495667_0250406
900 Ga0495599_0144816
901 Ga0495600_0122799
902 Ga0495684_0183247
903 Ga0495602_0105366
904 Ga0495602_0596947
905 Ga0496102_0034783
906 Ga0496102_0175090
907 Ga0496104_0652772
908 Ga0496106_0094644
909 Ga0496107_0414725
910 Ga0496107_0601921
911 Ga0496108_1443123
912 Ga0496109_0239686
913 Ga0496112_0346490
914 Ga0501033_0182442
915 Ga0501034_0005819
916 Ga0501036_0111406
917 Ga0501037_0384161
918 Ga0501038_0386898
919 Ga0501039_0729370
920 Ga0501040_0001260
921 Ga0501040_0076427
922 Ga0501040_0093004
923 Ga0501040_0144834
924 Ga0501040_0315344
925 Ga0501041_0004806
926 Ga0501041_0170869
927 Ga0501041_0313942
928 Ga0501041_0385948
929 Ga0501043_0340360
930 Ga0501043_0465579
931 Ga0501046_0125385
932 Ga0501046_0131343
933 Ga0501046_0205337
934 Ga0501046_0295567
935 Ga0501046_0468581
936 Ga0501047_0038591
937 Ga0501048_0195980
938 Ga0501048_0430176
939 Ga0501048_1147428
940 Ga0501048_1338062
941 Ga0501068_0210759
942 Ga0501069_0338218
943 Ga0501071_0155772
944 Ga0501071_0220897
945 Ga0501071_0386773
946 Ga0501071_0767955
947 Ga0501072_0011672
948 Ga0501072_0065907
949 Ga0501072_0072227
950 Ga0501072_0102103
951 Ga0501072_0139421
952 Ga0501072_0263881
953 Ga0501072_0270492
954 Ga0501072_0756335
955 Ga0501073_0224944
956 Ga0501074_0034628
957 Ga0501074_0292096
958 Ga0501074_0354864
959 Ga0501075_0018651
960 Ga0501075_0069044
961 Ga0501075_0069789
962 Ga0501076_0005497
963 Ga0501076_0019515
964 Ga0501076_0036208
965 Ga0501076_0067340
966 Ga0501076_1052457
967 Ga0501077_0038661
968 Ga0501077_0125625
969 Ga0501077_0146253
970 Ga0501077_0229668
971 Ga0501077_0451359
972 Ga0501077_1118347
973 Ga0501079_0002157
974 Ga0501079_0002771
975 Ga0501079_0008913
976 Ga0501079_0028445
977 Ga0501080_0116068
978 Ga0501080_0211920
979 Ga0501081_0001575
980 Ga0501081_0019907
981 Ga0501081_0113054
982 Ga0501081_0180353
983 Ga0501081_0891885
984 Ga0501083_0057520
985 Ga0501083_0097260
986 Ga0501083_0275909
987 Ga0501035_0347456
988 Ga0501035_1260463
989 Ga0501035_1470546
990 Ga0501045_0002137
991 Ga0501045_0072085
992 Ga0501045_0136581
993 Ga0501045_0225745
994 Ga0501045_0642104
995 nmdc:mga05p37_127026_c1
996 nmdc:mga05p37_33814_c1
997 nmdc:mga05p37_45237_c1
998 nmdc:mga09592_21637_c1
999 nmdc:mga09592_691_c1
1000 nmdc:mga0qj67_213_c1
1001 nmdc:mga0qj67_47974_c1
1002 nmdc:mga06r32_105563_c1
1003 nmdc:mga06r32_110665_c1
1004 nmdc:mga06r32_119271_c1
1005 nmdc:mga06r32_1284263_c1
1006 nmdc:mga06r32_179777_c1
1007 nmdc:mga06r32_33229_c1
1008 nmdc:mga0n895_111401_c1
1009 nmdc:mga0n895_302403_c1
1010 nmdc:mga0n895_38971_c1
1011 nmdc:mga0n895_404904_c1
1012 nmdc:mga0rr50_12491_c1
1013 nmdc:mga0rr50_202284_c1
1014 nmdc:mga0rr50_70099_c1
1015 nmdc:mga08x19_200151_c1
1016 nmdc:mga08x19_49658_c1
1017 nmdc:mga08x19_585223_c1
1018 nmdc:mga0a205_4078_c1
1019 nmdc:mga0a205_50888_c1
1020 nmdc:mga0a205_71744_c1
1021 nmdc:mga0a205_86194_c1
1022 Ga0495601_0004791
1023 Ga0495595_0091144
1024 Ga0495619_0050417
1025 Ga0501084_0002108
1026 Ga0501084_0047111
1027 Ga0501084_0078163
1028 Ga0501084_0156132
1029 Ga0501084_0625516
1030 Ga0501082_0000316
1031 Ga0501082_0027357
1032 Ga0501082_0054313
1033 Ga0501082_1121782
1034 Ga0501082_1598231
1035 Ga0530510_0009931
1036 Ga0530510_0029940
1037 Ga0530510_0074823
1038 Ga0530510_0296697
1039 Ga0530510_0350347
1040 Ga0530510_0701527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

64

147

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.9129 1 129
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9073 47 108
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.8688 1 129
2qeu-assembly1.cif.gz_B crystal structure of putative carboxymuconolactone decarboxylase (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution 0.8563 16 111
3bey-assembly1.cif.gz_E crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.8298 41 123
ID Description Score Start End Superfamily
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9121 47 112 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9073 47 108 1.20.1290.10
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9059 1 129 1.20.1290.10
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9049 47 112 1.20.1290.10
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8864 1 129 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4Q4CUE4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9756 3 129 GO:0051920
AF-K9PCW6-F1-model_v4 Alkylhydroperoxidase like protein, AhpD family 0.9733 3 130 GO:0051920
AF-Q8YLD1-F1-model_v4 All5371 protein 0.9732 3 129 GO:0051920
AF-A0A2N9M8P8-F1-model_v4 Alkylhydroperoxidase like protein, AhpD family 0.973 1 129 GO:0051920
AF-A0A534E8U9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9719 1 129 GO:0051920

Map