F458474

General Info

Members Datasets Scaffolds Average Seq Length
519 416 1038 209

Family's Representative Sequence

Representative Sequence 3300053117|Ga0500593_038129|Ga0500593_038129_552_1256
Length 234
Sequence LKIIGFVRLAAVREGVKLMRMMSIMRFCALVLSLALAGSMTPDAAQAQQVQPPPDKKGEWIHPPKELPKAPRGDRTYNLDQLFEGLKIAPDEASAKAIENRIWATMLVSKSDTANLLMTRVKTAVDGEDLDLAVQLLDSIIELKPDYIEAWNRRATLYFLKKDYGRAFGDITEVLSREPRHFGALSGLGLIMQEMGDDKTALKVYRRALEVHPRLQRIPDIVKTLTEKVEGRPI

Samples

Sample ID Description Type Environment
1 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
118 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
267 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
274 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
275 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
276 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
279 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
280 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
281 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
284 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
285 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
286 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
287 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
288 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
292 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
293 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
294 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
295 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
296 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
297 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
298 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
299 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
300 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
301 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
302 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
303 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
304 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
305 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
306 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
307 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
308 2643221651 Afipia sp. Root123D2 Isolate Unclassified
309 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
310 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
311 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
312 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
313 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
314 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
315 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
316 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
317 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
318 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
319 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
320 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
321 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
322 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
323 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
324 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
325 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
326 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
327 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
328 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
329 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
330 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
331 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
332 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
333 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
334 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
335 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
336 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
337 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
338 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
339 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
340 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
341 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
342 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
343 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
344 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
345 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
346 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
347 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
348 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
349 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
350 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
351 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
352 2906610324
353 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
354 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
355 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
356 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
357 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
358 2922425934
359 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
360 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
361 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
362 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
363 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
364 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
365 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
366 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
367 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
368 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
369 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
370 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
371 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
372 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
373 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
374 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
375 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
376 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
377 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
378 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
379 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
380 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
381 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
382 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
383 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
384 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
385 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
386 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
387 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
388 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
389 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
390 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
391 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
392 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
393 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
394 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
395 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
396 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
397 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
398 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
399 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
400 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
401 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
402 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
403 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
404 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
405 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
406 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
407 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
408 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
409 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
410 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
411 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
412 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
413 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
414 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
415 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
416 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.44
Metatranscriptomes 0.58
Isolates 23.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.1
Nodule 21.19
Rhizoplane 3.08
Rhizosphere 48.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500593_038129 3300053117 Bacteria 2151
2 JGI24735J21928_10037831 3300002067 Bacteria 1414
3 JGI25165J46597_1006626 3300003214 Bacteria 2030
4 JGI25153J46596_10000371 3300003215 Bacteria 30777
5 JGI25153J46596_10015972 3300003215 Bacteria 3032
6 rootL2_10028832 3300003322 Bacteria 3213
7 rootH1_10145248 3300003323 Bacteria 1495
8 Ga0070683_100010541 3300005329 Bacteria 7946
9 Ga0070670_100442798 3300005331 Bacteria 1151
10 Ga0068868_100162489 3300005338 Bacteria 1845
11 Ga0070660_100494259 3300005339 Bacteria 1017
12 Ga0070689_100017026 3300005340 Bacteria 5331
13 Ga0070687_100704216 3300005343 Bacteria 706
14 Ga0070688_100046197 3300005365 Bacteria 2696
15 Ga0070659_100291805 3300005366 Bacteria 1358
16 Ga0070667_100054829 3300005367 Bacteria 3367
17 Ga0070667_100738750 3300005367 Bacteria 912
18 Ga0070709_10014752 3300005434 Bacteria 4426
19 Ga0070710_10089252 3300005437 Bacteria 1815
20 Ga0070710_10168552 3300005437 Bacteria 1363
21 Ga0070711_100010141 3300005439 Bacteria 5821
22 Ga0070663_100018712 3300005455 Bacteria 4547
23 Ga0070663_100075245 3300005455 Bacteria 2467
24 Ga0070663_100434154 3300005455 Bacteria 1079
25 Ga0070662_100199871 3300005457 Bacteria 1585
26 Ga0070681_10082287 3300005458 Bacteria 3174
27 Ga0070681_10129804 3300005458 Bacteria 2452
28 Ga0070685_10071598 3300005466 Bacteria 2056
29 Ga0070698_100140255 3300005471 Bacteria 2369
30 Ga0070693_100068034 3300005547 Bacteria 2090
31 Ga0070665_100089268 3300005548 Bacteria 3088
32 Ga0070665_100114119 3300005548 Bacteria 2704
33 Ga0070665_100362034 3300005548 Bacteria 1456
34 Ga0068854_100026148 3300005578 Bacteria 4009
35 Ga0068852_100444222 3300005616 Bacteria 1283
36 Ga0068852_100449611 3300005616 Bacteria 1275
37 Ga0068864_100541019 3300005618 Bacteria 1125
38 Ga0068858_100057944 3300005842 Bacteria 3580
39 Ga0068860_100001738 3300005843 Bacteria 23223
40 Ga0068860_100058489 3300005843 Bacteria 3664
41 Ga0081455_10000774 3300005937 Bacteria 41248
42 Ga0081455_10159742 3300005937 Bacteria 1729
43 Ga0081540_1003496 3300005983 Bacteria 12400
44 Ga0070717_10230531 3300006028 Bacteria 1630
45 Ga0075365_10327334 3300006038 Bacteria 1079
46 Ga0075364_10416734 3300006051 Bacteria 917
47 Ga0070716_100547688 3300006173 Bacteria 862
48 Ga0070712_100022657 3300006175 Bacteria 4139
49 Ga0075367_10028691 3300006178 Bacteria 3176
50 Ga0075367_10086244 3300006178 Bacteria 1905
51 Ga0075367_10241770 3300006178 Bacteria 1131
52 Ga0075369_10116027 3300006186 Bacteria 1209
53 Ga0075366_10087953 3300006195 Bacteria 1860
54 Ga0075366_10378082 3300006195 Bacteria 871
55 Ga0097621_100138044 3300006237 Bacteria 2081
56 Ga0075370_10013715 3300006353 Bacteria 4312
57 Ga0068871_100159827 3300006358 Bacteria 1926
58 Ga0068871_101097797 3300006358 Bacteria 744
59 Ga0075431_100091809 3300006847 Bacteria 3133
60 Ga0075429_100385265 3300006880 Bacteria 1227
61 Ga0068865_100262636 3300006881 Bacteria 1367
62 Ga0075436_100156412 3300006914 Bacteria 1606
63 Ga0097620_100326479 3300006931 Bacteria 1628
64 Ga0099824_1003256 3300006942 Bacteria 23739
65 Ga0099822_1000157 3300006943 Bacteria 48143
66 Ga0099823_1041394 3300006944 Bacteria 3280
67 Ga0099795_10006976 3300007788 Bacteria 3121
68 Ga0105245_10012576 3300009098 Bacteria 7367
69 Ga0105247_10028239 3300009101 Bacteria 3394
70 Ga0114129_10207821 3300009147 Bacteria 2648
71 Ga0105243_10946049 3300009148 Bacteria 860
72 Ga0105241_10033265 3300009174 Bacteria 3869
73 Ga0105241_10153796 3300009174 Bacteria 1884
74 Ga0105242_10117957 3300009176 Bacteria 2273
75 Ga0105242_10785498 3300009176 Bacteria 941
76 Ga0105248_10423040 3300009177 Bacteria 1500
77 Ga0105237_10027195 3300009545 Bacteria 5841
78 Ga0105238_10048685 3300009551 Bacteria 4270
79 Ga0105238_10483964 3300009551 Bacteria 1237
80 Ga0105249_10907233 3300009553 Bacteria 948
81 Ga0105239_10025223 3300010375 Bacteria 6547
82 Ga0105239_10892855 3300010375 Bacteria 1020
83 Ga0105246_10230304 3300011119 Bacteria 1459
84 Ga0157373_10045591 3300013100 Bacteria 3129
85 Ga0157369_10045792 3300013105 Bacteria 4756
86 Ga0157374_10143041 3300013296 Bacteria 2322
87 Ga0157374_10544185 3300013296 Bacteria 1168
88 Ga0157378_10108436 3300013297 Bacteria 2542
89 Ga0157378_11571524 3300013297 Bacteria 703
90 Ga0157375_10367089 3300013308 Bacteria 1606
91 Ga0157375_11055388 3300013308 Bacteria 950
92 Ga0163163_10107938 3300014325 Bacteria 2810
93 Ga0163163_10572808 3300014325 Bacteria 1192
94 Ga0157380_10933398 3300014326 Bacteria 896
95 Ga0157376_10372120 3300014969 Bacteria 1374
96 Ga0163161_10203411 3300017792 Bacteria 1527
97 Ga0206355_1593182 3300020076 Bacteria 1666
98 Ga0206354_10027209 3300020081 Bacteria 1115
99 Ga0214544_1000003 3300021320 Bacteria 643752
100 Ga0214542_1000022 3300021321 Bacteria 193578
101 Ga0214545_1000010 3300021324 Bacteria 193578
102 Ga0214543_1000035 3300021327 Bacteria 183100
103 Ga0213874_10004227 3300021377 Bacteria 3252
104 Ga0213874_10034695 3300021377 Bacteria 1478
105 Ga0224712_10042266 3300022467 Bacteria 1726
106 Ga0209233_1012118 3300025261 Bacteria 2512
107 Ga0209564_1042274 3300025295 Bacteria 1211
108 Ga0209758_1000344 3300025297 Bacteria 85133
109 Ga0209758_1001622 3300025297 Bacteria 25624
110 Ga0209758_1007055 3300025297 Bacteria 7794
111 Ga0209256_1043709 3300025299 Bacteria 1123
112 Ga0207426_1017029 3300025302 Bacteria 2593
113 Ga0207692_10244029 3300025898 Bacteria 1074
114 Ga0207692_10576529 3300025898 Bacteria 721
115 Ga0207710_10014961 3300025900 Bacteria 3277
116 Ga0207647_10122961 3300025904 Bacteria 1529
117 Ga0207647_10170251 3300025904 Bacteria 1268
118 Ga0207699_10007971 3300025906 Bacteria 5201
119 Ga0207654_10198130 3300025911 Bacteria 1321
120 Ga0207707_10004597 3300025912 Bacteria 12121
121 Ga0207707_10056424 3300025912 Bacteria 3417
122 Ga0207671_10170462 3300025914 Bacteria 1690
123 Ga0207693_10017732 3300025915 Bacteria 5676
124 Ga0207693_10071814 3300025915 Bacteria 2710
125 Ga0207663_10028306 3300025916 Bacteria 3278
126 Ga0207660_10063053 3300025917 Bacteria 2671
127 Ga0207662_10713284 3300025918 Bacteria 703
128 Ga0207652_10012904 3300025921 Bacteria 6758
129 Ga0207652_10208711 3300025921 Bacteria 1758
130 Ga0207646_10179056 3300025922 Bacteria 1915
131 Ga0207687_10982874 3300025927 Bacteria 724
132 Ga0207700_11018031 3300025928 Bacteria 741
133 Ga0207670_10462929 3300025936 Bacteria 1024
134 Ga0207691_10127173 3300025940 Bacteria 2254
135 Ga0207711_10229241 3300025941 Bacteria 1701
136 Ga0207689_10032986 3300025942 Bacteria 4304
137 Ga0207689_10325562 3300025942 Bacteria 1276
138 Ga0207661_10041449 3300025944 Bacteria 3624
139 Ga0207667_10643674 3300025949 Bacteria 1066
140 Ga0207668_10142423 3300025972 Bacteria 1845
141 Ga0207703_10274643 3300026035 Bacteria 1528
142 Ga0207639_10090678 3300026041 Bacteria 2445
143 Ga0207639_10103833 3300026041 Bacteria 2303
144 Ga0207639_10183878 3300026041 Bacteria 1780
145 Ga0207678_10026701 3300026067 Bacteria 5038
146 Ga0207678_10505559 3300026067 Bacteria 1054
147 Ga0207678_10698980 3300026067 Bacteria 892
148 Ga0207678_10761665 3300026067 Bacteria 854
149 Ga0207708_10355202 3300026075 Bacteria 1203
150 Ga0207641_10293084 3300026088 Bacteria 1534
151 Ga0207683_10179922 3300026121 Bacteria 1917
152 Ga0207698_10411043 3300026142 Bacteria 1296
153 Ga0207698_10475416 3300026142 Bacteria 1211
154 Ga0207698_10915286 3300026142 Bacteria 885
155 Ga0209589_1000005 3300027357 Bacteria 530958
156 Ga0209489_100005 3300027361 Bacteria 530958
157 Ga0209489_100057 3300027361 Bacteria 147398
158 Ga0209489_100063 3300027361 Bacteria 144408
159 Ga0209700_100006 3300027363 Bacteria 530958
160 Ga0209700_100012 3300027363 Bacteria 357892
161 Ga0209179_1012801 3300027512 Bacteria 1513
162 Ga0268266_10016539 3300028379 Bacteria 6306
163 Ga0268266_10034175 3300028379 Bacteria 4323
164 Ga0268265_10189259 3300028380 Bacteria 1775
165 Ga0268264_10000042 3300028381 Bacteria 372069
166 Ga0268264_10774993 3300028381 Bacteria 957
167 Ga0307515_10011730 3300028794 Bacteria 16583
168 Ga0307511_10073592 3300030521 Bacteria 2470
169 Ga0265332_10160728 3300031238 Bacteria 938
170 Ga0265331_10225017 3300031250 Bacteria 843
171 Ga0265316_10347884 3300031344 Bacteria 1073
172 Ga0307513_10177887 3300031456 Bacteria 1995
173 Ga0307508_10105447 3300031616 Bacteria 2416
174 Ga0265314_10103076 3300031711 Bacteria 1830
175 Ga0265342_10150007 3300031712 Bacteria 1295
176 Ga0265342_10194758 3300031712 Bacteria 1104
177 Ga0307516_10032237 3300031730 Bacteria 5277
178 Ga0307405_10185330 3300031731 Bacteria 1498
179 Ga0307406_10633044 3300031901 Bacteria 886
180 Ga0307416_100299352 3300032002 Bacteria 1598
181 Ga0307411_10079313 3300032005 Bacteria 2254
182 Ga0307415_100039892 3300032126 Bacteria 3107
183 Ga0307507_10056426 3300033179 Bacteria 3712
184 Ga0307507_10230203 3300033179 Bacteria 1230
185 Ga0307510_10199878 3300033180 Bacteria 1535
186 Ga0315911_1000012 3300033442 Bacteria 248988
187 Ga0373943_0145735 3300035170 Bacteria 1279
188 Ga0373937_0934806 3300036401 Bacteria 816
189 Ga0373925_0015873 3300037068 Bacteria 5449
190 Ga0395899_0102282 3300037312 Bacteria 2067
191 Ga0395900_0482870 3300037418 Bacteria 1191
192 Ga0395900_0483958 3300037418 Bacteria 1190
193 Ga0395898_0017060 3300037466 Bacteria 7416
194 Ga0395898_0025002 3300037466 Bacteria 6021
195 Ga0395898_0134234 3300037466 Bacteria 2370
196 Ga0395898_0549924 3300037466 Bacteria 1096
197 Ga0395905_0109478 3300037471 Bacteria 2594
198 Ga0395905_0113262 3300037471 Bacteria 2548
199 Ga0395905_0570670 3300037471 Bacteria 1033
200 Ga0395901_0047469 3300038443 Bacteria 4459
201 Ga0395901_0358110 3300038443 Bacteria 1505
202 Ga0436365_0499558 3300039437 Bacteria 1064
203 Ga0436363_0790707 3300039450 Bacteria 1679
204 Ga0436363_1476364 3300039450 Bacteria 4825
205 Ga0451802_1575681 3300041460 Bacteria 1169
206 Ga0451833_0907776 3300041491 Bacteria 1292
207 Ga0451835_0272401 3300041492 Bacteria 992
208 Ga0451849_1409082 3300041505 Bacteria 1520
209 Ga0451843_0468972 3300041509 Bacteria 1566
210 Ga0451853_1488998 3300041512 Bacteria 1530
211 Ga0451853_3788260 3300041512 Bacteria 898
212 Ga0466969_0111903 3300044656 Bacteria 1277
213 Ga0466972_0000179 3300044658 Bacteria 49010
214 Ga0466972_0000236 3300044658 Bacteria 38201
215 Ga0466965_0046204 3300044683 Bacteria 2155
216 Ga0466966_0000288 3300044684 Bacteria 33104
217 Ga0466961_0000235 3300044693 Bacteria 37337
218 Ga0466968_0053848 3300044735 Bacteria 1724
219 Ga0466968_0123797 3300044735 Bacteria 1172
220 Ga0466959_0006430 3300045049 Bacteria 8136
221 Ga0466967_0391138 3300045976 Bacteria 1351
222 Ga0495592_0043963 3300046454 Bacteria 3340
223 Ga0495603_0029148 3300046455 Bacteria 3329
224 Ga0495590_0085249 3300046457 Bacteria 1115
225 Ga0495629_0006093 3300046459 Bacteria 8962
226 Ga0495638_0031309 3300046460 Bacteria 3420
227 Ga0495638_0055111 3300046460 Bacteria 2470
228 Ga0495651_0182897 3300046462 Bacteria 1482
229 Ga0495653_0107346 3300046463 Bacteria 2012
230 Ga0495662_0224836 3300046476 Bacteria 925
231 Ga0495664_0038387 3300046477 Bacteria 2827
232 Ga0495607_0136889 3300046501 Bacteria 1268
233 Ga0495606_0234839 3300046507 Bacteria 1025
234 Ga0495608_0048657 3300046511 Bacteria 2816
235 Ga0495618_0097775 3300046514 Bacteria 1878
236 Ga0495620_0082949 3300046515 Bacteria 1295
237 Ga0495628_0020174 3300046516 Bacteria 5501
238 Ga0495644_0167592 3300046523 Bacteria 843
239 Ga0495648_0030726 3300046524 Bacteria 3547
240 Ga0495652_0017676 3300046529 Bacteria 6363
241 Ga0495652_0035230 3300046529 Bacteria 4357
242 Ga0495652_0157894 3300046529 Bacteria 1764
243 Ga0495654_0108087 3300046530 Bacteria 1272
244 Ga0495640_0015439 3300046533 Bacteria 5747
245 Ga0495640_0029868 3300046533 Bacteria 3907
246 Ga0495587_0037347 3300046536 Bacteria 2917
247 Ga0495622_0067598 3300046557 Bacteria 1651
248 Ga0495667_0016196 3300046559 Bacteria 5036
249 Ga0495667_0050254 3300046559 Bacteria 2753
250 Ga0495656_0022970 3300046615 Bacteria 2449
251 Ga0495634_0287183 3300046642 Bacteria 998
252 Ga0495625_0118431 3300046660 Bacteria 1804
253 Ga0495625_0233678 3300046660 Bacteria 1200
254 Ga0495635_0006042 3300046663 Bacteria 8444
255 Ga0495657_0003968 3300046675 Bacteria 11874
256 Ga0495657_0008779 3300046675 Bacteria 7706
257 Ga0495599_0010495 3300046678 Bacteria 5667
258 Ga0495623_0016510 3300046679 Bacteria 4770
259 Ga0495613_0427598 3300046689 Bacteria 900
260 Ga0495624_0189964 3300046690 Bacteria 1249
261 Ga0495600_0001327 3300046809 Bacteria 13654
262 Ga0495581_0054573 3300047315 Bacteria 2307
263 Ga0495581_0103629 3300047315 Bacteria 1653
264 Ga0495604_0182821 3300047317 Bacteria 1465
265 Ga0495672_0000894 3300047320 Bacteria 31271
266 Ga0495686_0077852 3300047472 Bacteria 2030
267 Ga0495593_0085022 3300047673 Bacteria 1633
268 Ga0495602_0035721 3300048088 Bacteria 4632
269 Ga0496101_0025387 3300048904 Bacteria 4112
270 Ga0496102_0502076 3300048905 Bacteria 1135
271 Ga0496103_0387308 3300048906 Bacteria 898
272 Ga0496104_0020161 3300048907 Bacteria 6107
273 Ga0496104_0729261 3300048907 Bacteria 898
274 Ga0496105_0001384 3300048908 Bacteria 17029
275 Ga0496106_0001950 3300048909 Bacteria 15496
276 Ga0496108_0026927 3300048911 Bacteria 4745
277 Ga0496110_0231049 3300048913 Bacteria 1682
278 Ga0496112_0640472 3300048915 Bacteria 993
279 Ga0496113_0495240 3300048916 Bacteria 981
280 Ga0496114_0462409 3300048917 Bacteria 1123
281 Ga0496114_0519909 3300048917 Bacteria 1053
282 Ga0496115_0444993 3300048918 Bacteria 1047
283 Ga0496116_0203950 3300048919 Bacteria 1032
284 Ga0496117_0006897 3300048920 Bacteria 11270
285 Ga0496118_0003991 3300048921 Bacteria 17983
286 Ga0496118_0127800 3300048921 Bacteria 1639
287 Ga0496119_0014573 3300048922 Bacteria 6134
288 Ga0496120_0005741 3300048923 Bacteria 9763
289 Ga0496121_0002762 3300048924 Bacteria 26052
290 Ga0496121_0089296 3300048924 Bacteria 2413
291 Ga0496123_0191699 3300048926 Bacteria 1057
292 Ga0496124_0002443 3300048927 Bacteria 24353
293 Ga0496124_0179727 3300048927 Bacteria 1629
294 Ga0496124_0236671 3300048927 Bacteria 1361
295 Ga0496125_0028043 3300048928 Bacteria 5092
296 Ga0496125_0038062 3300048928 Bacteria 4171
297 Ga0496125_0094032 3300048928 Bacteria 2235
298 Ga0496126_0004375 3300048929 Bacteria 16937
299 Ga0496126_0015683 3300048929 Bacteria 7612
300 Ga0496126_0025131 3300048929 Bacteria 5736
301 Ga0496126_0075786 3300048929 Bacteria 2985
302 Ga0496126_0093167 3300048929 Bacteria 2645
303 Ga0496126_0178810 3300048929 Bacteria 1803
304 Ga0496126_0255914 3300048929 Bacteria 1457
305 Ga0501031_0286296 3300049568 Bacteria 1069
306 Ga0501032_0090961 3300049569 Bacteria 2025
307 Ga0501032_0320893 3300049569 Bacteria 1000
308 Ga0501033_0105913 3300049570 Bacteria 2049
309 Ga0501033_0319679 3300049570 Bacteria 1090
310 Ga0501034_0325278 3300049571 Bacteria 1470
311 Ga0501034_0453324 3300049571 Bacteria 1200
312 Ga0501036_0207830 3300049572 Bacteria 1645
313 Ga0501036_1075842 3300049572 Bacteria 657
314 Ga0501038_0093235 3300049574 Bacteria 2520
315 Ga0501039_0124896 3300049575 Bacteria 2018
316 Ga0501039_0179627 3300049575 Bacteria 1664
317 Ga0501039_0484575 3300049575 Bacteria 971
318 Ga0501043_0203779 3300049579 Bacteria 1534
319 Ga0501043_0395621 3300049579 Bacteria 1044
320 Ga0501046_0559893 3300049580 Bacteria 814
321 Ga0501047_0116964 3300049581 Bacteria 2547
322 Ga0501047_0401731 3300049581 Bacteria 1203
323 Ga0501048_0161259 3300049582 Bacteria 1587
324 Ga0501068_0069691 3300049584 Bacteria 2144
325 Ga0501069_0342875 3300049585 Bacteria 880
326 Ga0501070_0128775 3300049586 Bacteria 2091
327 Ga0501070_0250715 3300049586 Bacteria 1448
328 Ga0501070_0254547 3300049586 Bacteria 1436
329 Ga0501070_0714218 3300049586 Bacteria 792
330 Ga0501071_0076133 3300049587 Bacteria 2450
331 Ga0501072_0240175 3300049588 Bacteria 1443
332 Ga0501074_0262349 3300049590 Bacteria 1228
333 Ga0501075_0011852 3300049591 Bacteria 6185
334 Ga0501079_0253497 3300049741 Bacteria 1375
335 Ga0501079_0527662 3300049741 Bacteria 928
336 Ga0501044_0138179 3300049823 Bacteria 2426
337 Ga0501044_0217752 3300049823 Bacteria 1861
338 Ga0501045_0093178 3300049824 Bacteria 2228
339 nmdc:mga0yw44_294241_c1 3300050492 Bacteria 1087
340 nmdc:mga0yw44_454718_c1 3300050492 Bacteria 868
341 nmdc:mga05p37_224107_c1 3300050507 Bacteria 2268
342 nmdc:mga09592_140455_c1 3300050508 Bacteria 2082
343 nmdc:mga08x19_19452_c1 3300050514 Bacteria 4166
344 nmdc:mga0sz30_157479_c1 3300050516 Bacteria 1006
345 Ga0500610_0060065 3300053079 Bacteria 1984
346 Ga0495655_0052602 3300053083 Bacteria 1083
347 Ga0495595_0020734 3300053084 Bacteria 2863
348 Ga0500643_003055 3300053087 Bacteria 8252
349 Ga0500644_0001156 3300053088 Bacteria 7653
350 Ga0500647_0073426 3300053091 Bacteria 1642
351 Ga0500583_0103074 3300053092 Bacteria 1399
352 Ga0500651_0013227 3300053093 Bacteria 5021
353 Ga0500566_0048090 3300053094 Bacteria 2447
354 Ga0500640_033975 3300053095 Bacteria 2239
355 Ga0500641_0002260 3300053096 Bacteria 6823
356 Ga0500641_0010309 3300053096 Bacteria 3373
357 Ga0500557_000046 3300053105 Bacteria 59508
358 Ga0500594_0048431 3300053118 Bacteria 1189
359 Ga0500595_000006 3300053119 Bacteria 300857
360 Ga0500595_016089 3300053119 Bacteria 2793
361 Ga0500595_132089 3300053119 Bacteria 702
362 Ga0500607_011628 3300053121 Bacteria 5198
363 Ga0500626_157043 3300053128 Bacteria 939
364 Ga0500642_0000038 3300053130 Bacteria 98299
365 Ga0500652_001097 3300053131 Bacteria 8732
366 Ga0500655_019480 3300053133 Bacteria 1264
367 Ga0500658_0042943 3300053134 Bacteria 1819
368 Ga0500559_0168668 3300053136 Bacteria 1029
369 Ga0500564_039855 3300053138 Bacteria 2163
370 Ga0500585_132810 3300053144 Bacteria 881
371 Ga0500590_044090 3300053148 Bacteria 2285
372 Ga0500590_083407 3300053148 Bacteria 1566
373 Ga0500603_053043 3300053150 Bacteria 1115
374 Ga0500616_0000001 3300053153 Bacteria 1986011
375 Ga0500616_0000048 3300053153 Bacteria 313108
376 Ga0500616_0084012 3300053153 Bacteria 1593
377 Ga0500619_058818 3300053154 Bacteria 1260
378 Ga0500620_001931 3300053155 Bacteria 4012
379 Ga0500638_110018 3300053162 Bacteria 1273
380 Ga0500639_155094 3300053163 Bacteria 1050
381 Ga0500636_0002084 3300053177 Bacteria 11042
382 Ga0500636_0054298 3300053177 Bacteria 2348
383 Ga0500636_0170390 3300053177 Bacteria 1178
384 Ga0500637_0036100 3300053178 Bacteria 2774
385 Ga0500637_0448680 3300053178 Bacteria 655
386 Ga0500649_112816 3300053722 Bacteria 1051
387 Ga0500625_009859 3300053729 Bacteria 4277
388 Ga0500609_001982 3300053731 Bacteria 2950
389 Ga0500552_000731 3300053733 Bacteria 3058
390 Ga0500552_002843 3300053733 Bacteria 1716
391 Ga0500601_000170 3300053737 Bacteria 13475
392 Ga0501082_0054461 3300060353 Bacteria 3448
393 Ga0530510_0054164 3300061734 Bacteria 2899
394 2507512019 2507262055 Bacteria 8048963
395 2508545678 2508501009 Bacteria 7784016
396 2508694501 2508501042 Bacteria 8719808
397 2513650951 2513237095 Bacteria 8976980
398 2513655561 2513237096 Bacteria 8722461
399 2513704016 2513237102 Bacteria 7703324
400 2513720208 2513237104 Bacteria 10034502
401 2513859756 2513237137 Bacteria 9558895
402 2513874351 2513237139 Bacteria 8737671
403 2513916361 2513237145 Bacteria 8979722
404 2514016843 2513237161 Bacteria 8871253
405 2515624568 2515154112 Bacteria 8294334
406 2517104496 2517093001 Bacteria 9002274
407 2517890024 2517572143 Bacteria 9484767
408 2524534897 2524023228 Bacteria 10118060
409 2617353110 2617270735 Bacteria 9163226
410 2617374560 2617270741 Bacteria 8201522
411 2644287134 2643221651 Bacteria 4798932
412 2671120934 2667528175 Bacteria 7532676
413 2793067997 2791355197 Bacteria 8420563
414 2805920949 2802429603 Bacteria 8777136
415 2818242331 2816332527 Bacteria 8933356
416 2824604511 2824600985 Bacteria 8488197
417 2824614948 2824609381 Bacteria 8672835
418 2824625870 2824617872 Bacteria 8814715
419 2824633015 2824626560 Bacteria 8813858
420 2824642421 2824635225 Bacteria 8785348
421 2824649942 2824644064 Bacteria 8743947
422 2824657528 2824653114 Bacteria 8493680
423 2824673975 2824671348 Bacteria 8369588
424 2824687080 2824679649 Bacteria 8248951
425 2824694577 2824687955 Bacteria 8360029
426 2824701389 2824696289 Bacteria 8335049
427 2824719806 2824714736 Bacteria 8717648
428 2824730199 2824723954 Bacteria 8758240
429 2824736037 2824732956 Bacteria 7810675
430 2824750664 2824746037 Bacteria 7911610
431 2824778343 2824773399 Bacteria 8360218
432 2838128534 2838122688 Bacteria 8803140
433 2841942392 2841941048 Bacteria 8688029
434 2841955478 2841949485 Bacteria 8680857
435 2841973849 2841966195 Bacteria 8673214
436 2841982913 2841974524 Bacteria 8931498
437 2841984408 2841983080 Bacteria 8395090
438 2842041866 2842038055 Bacteria 8002051
439 2842049909 2842045827 Bacteria 8006841
440 2847943398 2847939898 Bacteria 8606328
441 2874595807 2874590934 Bacteria 8299676
442 2874651561 2874645413 Bacteria 8214782
443 2876776004 2876771140 Bacteria 8287509
444 2876821212 2876818435 Bacteria 8274608
445 2879080093 2879074833 Bacteria 8279565
446 2879132676 2879127579 Bacteria 8294491
447 2879146461 2879142872 Bacteria 8267021
448 2881669233 2881665667 Bacteria 8175609
449 2885374592 2885366525 Bacteria 8326213
450 2885377192 2885374607 Bacteria 8927485
451 2888387529 2888378607 Bacteria 9652610
452 2888426760 2888419890 Bacteria 7857137
453 2903754503 2903748898 Bacteria 9972761
454 2904697641 2904690495 Bacteria 9412302
455 2906612211
456 2906638439 2906635258 Bacteria 8601019
457 2906663276 2906660503 Bacteria 8595048
458 2908740246 2908739725 Bacteria 8628932
459 2908757748 2908756301 Bacteria 8864324
460 2922393434 2922393267 Bacteria 8285685
461 2922427086
462 2932796748 2932794094 Bacteria 7915132
463 2932802472 2932801729 Bacteria 7987968
464 2935613336 2935608549 Bacteria 8203142
465 2935633237 2935630451 Bacteria 8169952
466 2935653788 2935648319 Bacteria 8801166
467 2935662537 2935656913 Bacteria 8965014
468 2935776365 2935769743 Bacteria 7878163
469 2935784374 2935777560 Bacteria 8077691
470 2935792410 2935785616 Bacteria 7962367
471 2935800573 2935793552 Bacteria 8012592
472 2935824810 2935819856 Bacteria 8261050
473 2935852030 2935847175 Bacteria 8228321
474 2935887086 2935883170 Bacteria 7964738
475 2935911377 2935908558 Bacteria 8568796
476 2935920910 2935916978 Bacteria 9113783
477 2935928406 2935926038 Bacteria 8601059
478 2935938051 2935934488 Bacteria 8602579
479 2935945333 2935942939 Bacteria 8599779
480 2935954161 2935951376 Bacteria 8602333
481 2935965983 2935959822 Bacteria 7869783
482 2935971571 2935967501 Bacteria 8603075
483 2935979969 2935975950 Bacteria 8347125
484 2935989398 2935984226 Bacteria 8302647
485 2936016815 2936011229 Bacteria 8801034
486 2936025448 2936019824 Bacteria 8804134
487 2936034314 2936028420 Bacteria 8965941
488 2936052371 2936046547 Bacteria 8903709
489 2936060651 2936055302 Bacteria 8785755
490 2941509461 2941507105 Bacteria 8166816
491 2941517290 2941515067 Bacteria 8166720
492 2941526757 2941523033 Bacteria 8169134
493 3005476259 3005474847 Bacteria 9259049
494 3005485896 3005483717 Bacteria 7877331
495 3005588881 3005587118 Bacteria 7794411
496 3005724271 3005718088 Bacteria 8283608
497 8016538593 8016530956 Bacteria 8155261
498 8016542878 8016539877 Bacteria 8155419
499 8016550410 8016548790 Bacteria 8155074
500 8016558824 8016557553 Bacteria 8154380
501 8016580936 8016575299 Bacteria 8154085
502 8016587810 8016583857 Bacteria 10421953
503 8016596792 8016595262 Bacteria 8149947
504 8016607682 8016603502 Bacteria 8731218
505 8016619474 8016613128 Bacteria 8794220
506 8016630130 8016622563 Bacteria 7999408
507 8016637036 8016630954 Bacteria 9217207
508 8019538260 8019530166 Bacteria 8155624
509 8019541716 8019538911 Bacteria 7872763
510 8019549070 8019547302 Bacteria 7996444
511 8019561036 8019555841 Bacteria 9642137
512 8019571123 8019565922 Bacteria 9639779
513 8019623992 8019619141 Bacteria 9218857
514 8019638041 8019629233 Bacteria 8687553
515 8019641594 8019638758 Bacteria 9062356
516 8019665962 8019659431 Bacteria 8577854
517 8019675482 8019668869 Bacteria 8791617
518 8019680617 8019678201 Bacteria 8863603
519 8019695143 8019687851 Bacteria 8712826
520 Ga0500593_038129
521 JGI24735J21928_10037831
522 JGI25165J46597_1006626
523 JGI25153J46596_10000371
524 JGI25153J46596_10015972
525 rootL2_10028832
526 rootH1_10145248
527 Ga0070683_100010541
528 Ga0070670_100442798
529 Ga0068868_100162489
530 Ga0070660_100494259
531 Ga0070689_100017026
532 Ga0070687_100704216
533 Ga0070688_100046197
534 Ga0070659_100291805
535 Ga0070667_100054829
536 Ga0070667_100738750
537 Ga0070709_10014752
538 Ga0070710_10089252
539 Ga0070710_10168552
540 Ga0070711_100010141
541 Ga0070663_100018712
542 Ga0070663_100075245
543 Ga0070663_100434154
544 Ga0070662_100199871
545 Ga0070681_10082287
546 Ga0070681_10129804
547 Ga0070685_10071598
548 Ga0070698_100140255
549 Ga0070693_100068034
550 Ga0070665_100089268
551 Ga0070665_100114119
552 Ga0070665_100362034
553 Ga0068854_100026148
554 Ga0068852_100444222
555 Ga0068852_100449611
556 Ga0068864_100541019
557 Ga0068858_100057944
558 Ga0068860_100001738
559 Ga0068860_100058489
560 Ga0081455_10000774
561 Ga0081455_10159742
562 Ga0081540_1003496
563 Ga0070717_10230531
564 Ga0075365_10327334
565 Ga0075364_10416734
566 Ga0070716_100547688
567 Ga0070712_100022657
568 Ga0075367_10028691
569 Ga0075367_10086244
570 Ga0075367_10241770
571 Ga0075369_10116027
572 Ga0075366_10087953
573 Ga0075366_10378082
574 Ga0097621_100138044
575 Ga0075370_10013715
576 Ga0068871_100159827
577 Ga0068871_101097797
578 Ga0075431_100091809
579 Ga0075429_100385265
580 Ga0068865_100262636
581 Ga0075436_100156412
582 Ga0097620_100326479
583 Ga0099824_1003256
584 Ga0099822_1000157
585 Ga0099823_1041394
586 Ga0099795_10006976
587 Ga0105245_10012576
588 Ga0105247_10028239
589 Ga0114129_10207821
590 Ga0105243_10946049
591 Ga0105241_10033265
592 Ga0105241_10153796
593 Ga0105242_10117957
594 Ga0105242_10785498
595 Ga0105248_10423040
596 Ga0105237_10027195
597 Ga0105238_10048685
598 Ga0105238_10483964
599 Ga0105249_10907233
600 Ga0105239_10025223
601 Ga0105239_10892855
602 Ga0105246_10230304
603 Ga0157373_10045591
604 Ga0157369_10045792
605 Ga0157374_10143041
606 Ga0157374_10544185
607 Ga0157378_10108436
608 Ga0157378_11571524
609 Ga0157375_10367089
610 Ga0157375_11055388
611 Ga0163163_10107938
612 Ga0163163_10572808
613 Ga0157380_10933398
614 Ga0157376_10372120
615 Ga0163161_10203411
616 Ga0206355_1593182
617 Ga0206354_10027209
618 Ga0214544_1000003
619 Ga0214542_1000022
620 Ga0214545_1000010
621 Ga0214543_1000035
622 Ga0213874_10004227
623 Ga0213874_10034695
624 Ga0224712_10042266
625 Ga0209233_1012118
626 Ga0209564_1042274
627 Ga0209758_1000344
628 Ga0209758_1001622
629 Ga0209758_1007055
630 Ga0209256_1043709
631 Ga0207426_1017029
632 Ga0207692_10244029
633 Ga0207692_10576529
634 Ga0207710_10014961
635 Ga0207647_10122961
636 Ga0207647_10170251
637 Ga0207699_10007971
638 Ga0207654_10198130
639 Ga0207707_10004597
640 Ga0207707_10056424
641 Ga0207671_10170462
642 Ga0207693_10017732
643 Ga0207693_10071814
644 Ga0207663_10028306
645 Ga0207660_10063053
646 Ga0207662_10713284
647 Ga0207652_10012904
648 Ga0207652_10208711
649 Ga0207646_10179056
650 Ga0207687_10982874
651 Ga0207700_11018031
652 Ga0207670_10462929
653 Ga0207691_10127173
654 Ga0207711_10229241
655 Ga0207689_10032986
656 Ga0207689_10325562
657 Ga0207661_10041449
658 Ga0207667_10643674
659 Ga0207668_10142423
660 Ga0207703_10274643
661 Ga0207639_10090678
662 Ga0207639_10103833
663 Ga0207639_10183878
664 Ga0207678_10026701
665 Ga0207678_10505559
666 Ga0207678_10698980
667 Ga0207678_10761665
668 Ga0207708_10355202
669 Ga0207641_10293084
670 Ga0207683_10179922
671 Ga0207698_10411043
672 Ga0207698_10475416
673 Ga0207698_10915286
674 Ga0209589_1000005
675 Ga0209489_100005
676 Ga0209489_100057
677 Ga0209489_100063
678 Ga0209700_100006
679 Ga0209700_100012
680 Ga0209179_1012801
681 Ga0268266_10016539
682 Ga0268266_10034175
683 Ga0268265_10189259
684 Ga0268264_10000042
685 Ga0268264_10774993
686 Ga0307515_10011730
687 Ga0307511_10073592
688 Ga0265332_10160728
689 Ga0265331_10225017
690 Ga0265316_10347884
691 Ga0307513_10177887
692 Ga0307508_10105447
693 Ga0265314_10103076
694 Ga0265342_10150007
695 Ga0265342_10194758
696 Ga0307516_10032237
697 Ga0307405_10185330
698 Ga0307406_10633044
699 Ga0307416_100299352
700 Ga0307411_10079313
701 Ga0307415_100039892
702 Ga0307507_10056426
703 Ga0307507_10230203
704 Ga0307510_10199878
705 Ga0315911_1000012
706 Ga0373943_0145735
707 Ga0373937_0934806
708 Ga0373925_0015873
709 Ga0395899_0102282
710 Ga0395900_0482870
711 Ga0395900_0483958
712 Ga0395898_0017060
713 Ga0395898_0025002
714 Ga0395898_0134234
715 Ga0395898_0549924
716 Ga0395905_0109478
717 Ga0395905_0113262
718 Ga0395905_0570670
719 Ga0395901_0047469
720 Ga0395901_0358110
721 Ga0436365_0499558
722 Ga0436363_0790707
723 Ga0436363_1476364
724 Ga0451802_1575681
725 Ga0451833_0907776
726 Ga0451835_0272401
727 Ga0451849_1409082
728 Ga0451843_0468972
729 Ga0451853_1488998
730 Ga0451853_3788260
731 Ga0466969_0111903
732 Ga0466972_0000179
733 Ga0466972_0000236
734 Ga0466965_0046204
735 Ga0466966_0000288
736 Ga0466961_0000235
737 Ga0466968_0053848
738 Ga0466968_0123797
739 Ga0466959_0006430
740 Ga0466967_0391138
741 Ga0495592_0043963
742 Ga0495603_0029148
743 Ga0495590_0085249
744 Ga0495629_0006093
745 Ga0495638_0031309
746 Ga0495638_0055111
747 Ga0495651_0182897
748 Ga0495653_0107346
749 Ga0495662_0224836
750 Ga0495664_0038387
751 Ga0495607_0136889
752 Ga0495606_0234839
753 Ga0495608_0048657
754 Ga0495618_0097775
755 Ga0495620_0082949
756 Ga0495628_0020174
757 Ga0495644_0167592
758 Ga0495648_0030726
759 Ga0495652_0017676
760 Ga0495652_0035230
761 Ga0495652_0157894
762 Ga0495654_0108087
763 Ga0495640_0015439
764 Ga0495640_0029868
765 Ga0495587_0037347
766 Ga0495622_0067598
767 Ga0495667_0016196
768 Ga0495667_0050254
769 Ga0495656_0022970
770 Ga0495634_0287183
771 Ga0495625_0118431
772 Ga0495625_0233678
773 Ga0495635_0006042
774 Ga0495657_0003968
775 Ga0495657_0008779
776 Ga0495599_0010495
777 Ga0495623_0016510
778 Ga0495613_0427598
779 Ga0495624_0189964
780 Ga0495600_0001327
781 Ga0495581_0054573
782 Ga0495581_0103629
783 Ga0495604_0182821
784 Ga0495672_0000894
785 Ga0495686_0077852
786 Ga0495593_0085022
787 Ga0495602_0035721
788 Ga0496101_0025387
789 Ga0496102_0502076
790 Ga0496103_0387308
791 Ga0496104_0020161
792 Ga0496104_0729261
793 Ga0496105_0001384
794 Ga0496106_0001950
795 Ga0496108_0026927
796 Ga0496110_0231049
797 Ga0496112_0640472
798 Ga0496113_0495240
799 Ga0496114_0462409
800 Ga0496114_0519909
801 Ga0496115_0444993
802 Ga0496116_0203950
803 Ga0496117_0006897
804 Ga0496118_0003991
805 Ga0496118_0127800
806 Ga0496119_0014573
807 Ga0496120_0005741
808 Ga0496121_0002762
809 Ga0496121_0089296
810 Ga0496123_0191699
811 Ga0496124_0002443
812 Ga0496124_0179727
813 Ga0496124_0236671
814 Ga0496125_0028043
815 Ga0496125_0038062
816 Ga0496125_0094032
817 Ga0496126_0004375
818 Ga0496126_0015683
819 Ga0496126_0025131
820 Ga0496126_0075786
821 Ga0496126_0093167
822 Ga0496126_0178810
823 Ga0496126_0255914
824 Ga0501031_0286296
825 Ga0501032_0090961
826 Ga0501032_0320893
827 Ga0501033_0105913
828 Ga0501033_0319679
829 Ga0501034_0325278
830 Ga0501034_0453324
831 Ga0501036_0207830
832 Ga0501036_1075842
833 Ga0501038_0093235
834 Ga0501039_0124896
835 Ga0501039_0179627
836 Ga0501039_0484575
837 Ga0501043_0203779
838 Ga0501043_0395621
839 Ga0501046_0559893
840 Ga0501047_0116964
841 Ga0501047_0401731
842 Ga0501048_0161259
843 Ga0501068_0069691
844 Ga0501069_0342875
845 Ga0501070_0128775
846 Ga0501070_0250715
847 Ga0501070_0254547
848 Ga0501070_0714218
849 Ga0501071_0076133
850 Ga0501072_0240175
851 Ga0501074_0262349
852 Ga0501075_0011852
853 Ga0501079_0253497
854 Ga0501079_0527662
855 Ga0501044_0138179
856 Ga0501044_0217752
857 Ga0501045_0093178
858 nmdc:mga0yw44_294241_c1
859 nmdc:mga0yw44_454718_c1
860 nmdc:mga05p37_224107_c1
861 nmdc:mga09592_140455_c1
862 nmdc:mga08x19_19452_c1
863 nmdc:mga0sz30_157479_c1
864 Ga0500610_0060065
865 Ga0495655_0052602
866 Ga0495595_0020734
867 Ga0500643_003055
868 Ga0500644_0001156
869 Ga0500647_0073426
870 Ga0500583_0103074
871 Ga0500651_0013227
872 Ga0500566_0048090
873 Ga0500640_033975
874 Ga0500641_0002260
875 Ga0500641_0010309
876 Ga0500557_000046
877 Ga0500594_0048431
878 Ga0500595_000006
879 Ga0500595_016089
880 Ga0500595_132089
881 Ga0500607_011628
882 Ga0500626_157043
883 Ga0500642_0000038
884 Ga0500652_001097
885 Ga0500655_019480
886 Ga0500658_0042943
887 Ga0500559_0168668
888 Ga0500564_039855
889 Ga0500585_132810
890 Ga0500590_044090
891 Ga0500590_083407
892 Ga0500603_053043
893 Ga0500616_0000001
894 Ga0500616_0000048
895 Ga0500616_0084012
896 Ga0500619_058818
897 Ga0500620_001931
898 Ga0500638_110018
899 Ga0500639_155094
900 Ga0500636_0002084
901 Ga0500636_0054298
902 Ga0500636_0170390
903 Ga0500637_0036100
904 Ga0500637_0448680
905 Ga0500649_112816
906 Ga0500625_009859
907 Ga0500609_001982
908 Ga0500552_000731
909 Ga0500552_002843
910 Ga0500601_000170
911 Ga0501082_0054461
912 Ga0530510_0054164
913 2507512019
914 2508545678
915 2508694501
916 2513650951
917 2513655561
918 2513704016
919 2513720208
920 2513859756
921 2513874351
922 2513916361
923 2514016843
924 2515624568
925 2517104496
926 2517890024
927 2524534897
928 2617353110
929 2617374560
930 2644287134
931 2671120934
932 2793067997
933 2805920949
934 2818242331
935 2824604511
936 2824614948
937 2824625870
938 2824633015
939 2824642421
940 2824649942
941 2824657528
942 2824673975
943 2824687080
944 2824694577
945 2824701389
946 2824719806
947 2824730199
948 2824736037
949 2824750664
950 2824778343
951 2838128534
952 2841942392
953 2841955478
954 2841973849
955 2841982913
956 2841984408
957 2842041866
958 2842049909
959 2847943398
960 2874595807
961 2874651561
962 2876776004
963 2876821212
964 2879080093
965 2879132676
966 2879146461
967 2881669233
968 2885374592
969 2885377192
970 2888387529
971 2888426760
972 2903754503
973 2904697641
974 2906612211
975 2906638439
976 2906663276
977 2908740246
978 2908757748
979 2922393434
980 2922427086
981 2932796748
982 2932802472
983 2935613336
984 2935633237
985 2935653788
986 2935662537
987 2935776365
988 2935784374
989 2935792410
990 2935800573
991 2935824810
992 2935852030
993 2935887086
994 2935911377
995 2935920910
996 2935928406
997 2935938051
998 2935945333
999 2935954161
1000 2935965983
1001 2935971571
1002 2935979969
1003 2935989398
1004 2936016815
1005 2936025448
1006 2936034314
1007 2936052371
1008 2936060651
1009 2941509461
1010 2941517290
1011 2941526757
1012 3005476259
1013 3005485896
1014 3005588881
1015 3005724271
1016 8016538593
1017 8016542878
1018 8016550410
1019 8016558824
1020 8016580936
1021 8016587810
1022 8016596792
1023 8016607682
1024 8016619474
1025 8016630130
1026 8016637036
1027 8019538260
1028 8019541716
1029 8019549070
1030 8019561036
1031 8019571123
1032 8019623992
1033 8019638041
1034 8019641594
1035 8019665962
1036 8019675482
1037 8019680617
1038 8019695143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9603 125 191
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.9352 90 188
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9336 125 191
3kd7-assembly5.cif.gz_E designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.9317 93 188
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.9313 124 204
ID Description Score Start End Superfamily
af_D4A8B1_169_244_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9786 93 161 1.25.40.10
af_P10505_529_631_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9737 90 188 1.25.40.10
af_A0A1D8PRX3_759_859_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9655 90 189 1.25.40.10
af_A4I5Y0_484_573_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.962 99 185 1.25.40.10
af_C0PEY7_222_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9615 88 160 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7C7ZJ12-F1-model_v4 Tetratricopeptide repeat protein 0.9181 88 207
AF-A0A538RY23-F1-model_v4 Tetratricopeptide repeat protein 0.8816 90 210
AF-A0A0S7KYX2-F1-model_v4 deleted 0.8766 81 210
AF-A0A6J4FVH7-F1-model_v4 protein O-GlcNAc transferase (EC 2.4.1.255) 0.8713 89 203 GO:0016020
GO:0016757
AF-A0A7R9KYV3-F1-model_v4 Uncharacterized protein 0.8677 83 210 GO:0101031

Map