metagRoot

F458352

General Info

Members	Datasets	Scaffolds	Average Seq Length
519	366	414	418

Family's Representative Sequence

Representative Sequence	3300001989\|JGI24739J22299_10032695\|JGI24739J22299_100326951
Length	481
Sequence	VQQRATATSPPLSPPSATQAVPAKAWRVLAVSTLAFTVCFMVWMMFGVIGIPIRKALDLNATEFGLLTAMPVLTGSLVRVPLGIWTDRFGGRIVMTLLMAATVPAIWLMSYATQYWHFIVLGMXVLTGSLVRVPLGIWTDRFGGRIVMTLLMAATVPAIWLMSYATQYWHFIVLGMFVGLAGGAFSVGTPYVARWFPRGRQGFAMGIYGAGNSGAAVNKFVAPAIVVAVGWAVVPQVYAAIMLGATVLFWLLSTSDPAHLVGRSAGFAEQLGTLKDPRVLRYCQYYSIVFGGYVAISLWMVQYYVGEYGLDIRVAALLAACFSLPGGVLRAAGGWLSDRYGAHSVTWWVSYPQTDLTLVTVNGPRTFHIGLNVYSFTALMFVLGIAMAFGKASVFKYISDDYPANIGAISGIVGLAGGLGGFVLPVMFGALMDLTGIRSSAFMLMYGVVWVSLVWMYWTEVRGTQVMGGARESKLNLEAKS

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
3	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
4	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
5	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
6	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
7	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
8	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
9	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
10	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
11	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
12	2547132374	Acidovorax radicis N35	Isolate	Unclassified
13	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
14	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
15	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
16	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
17	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
18	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
19	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
20	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
21	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
22	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
23	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
24	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
25	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
26	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
27	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
28	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
29	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
30	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
31	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
32	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
33	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
34	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
35	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
36	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
37	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
38	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
39	2643221621	Achromobacter sp. Root83	Isolate	Unclassified
40	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
41	2643221645	Massilia sp. Root351	Isolate	Unclassified
42	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
43	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
44	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
45	2643221664	Massilia sp. Root418	Isolate	Unclassified
46	2643221672	Variovorax sp. Root434	Isolate	Unclassified
47	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
48	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
49	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
50	2721755523	Delftia sp. HK171	Isolate	Unclassified
51	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
52	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
53	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
54	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
55	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
56	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
57	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
58	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
59	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
60	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
61	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
62	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
63	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
64	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
65	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
66	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
67	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
68	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
69	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
70	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
71	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
72	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
73	2857564685	Duganella sp. R-74599	Isolate	Unclassified
74	2858950400	Achromobacter sp. K91	Isolate	Unclassified
75	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
76	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
77	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
78	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
79	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
80	2904456579	Variovorax sp. 2002	Isolate	Unclassified
81	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
82	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
83	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
84	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
85	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
86	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
87	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
88	2928163908	Burkholderia sp. 567	Isolate	Unclassified
89	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
90	2932422444	Comamonas sp. 4034	Isolate	Rhizosphere
91	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
92	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
93	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
94	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
95	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
96	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
97	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
98	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
99	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
100	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
101	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
102	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
103	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
104	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
105	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
106	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
107	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
108	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
109	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
110	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
111	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
112	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
113	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
114	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
115	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
116	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
117	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
118	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
119	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
120	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
121	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
122	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
123	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
124	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
125	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
126	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
127	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
128	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
129	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
130	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
131	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
132	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
133	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
134	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
135	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
136	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
137	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
138	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
139	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
140	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
141	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
142	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
143	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
144	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
145	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
146	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
147	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
148	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
149	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
150	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
151	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
152	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
153	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
154	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
155	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
156	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
157	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
158	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
159	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
160	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
161	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
162	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
163	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
164	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
165	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
166	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
167	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
168	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
169	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
170	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
171	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
172	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
176	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
177	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
179	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
180	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
182	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
186	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
189	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
226	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
228	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
231	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
232	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
233	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
234	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
235	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
236	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
237	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
238	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
239	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
240	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
241	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
242	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
243	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
244	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
245	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
246	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
247	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
248	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
249	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
250	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
251	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
252	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
253	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
254	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
255	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
256	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
257	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
258	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
259	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
260	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
261	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
262	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
263	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
264	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
265	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
266	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
267	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
268	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
269	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
270	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
271	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
272	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
273	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
274	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
275	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
276	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
277	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
278	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
279	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
280	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
281	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
282	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
283	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
284	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
285	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
286	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
287	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
288	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
289	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
290	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
291	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
292	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
293	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
294	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
295	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
296	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
297	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
298	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
299	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
300	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
301	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
302	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
303	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
304	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
305	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
306	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
307	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
308	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
309	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
310	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
311	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
312	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
313	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
314	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
315	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
316	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
317	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
318	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
319	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
320	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
321	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
322	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
323	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
324	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
325	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
326	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
327	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
328	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
329	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
330	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
331	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
332	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
333	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
334	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
335	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
336	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
337	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
338	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
339	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
340	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
341	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
342	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
343	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
344	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
345	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
346	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
347	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
348	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
349	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
350	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
351	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
352	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
353	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
354	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
355	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
356	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
357	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
358	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
359	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
360	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
361	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
362	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
363	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
364	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
365	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
366	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	79.58
Metatranscriptomes	0.19
Isolates	20.23

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.14
Nodule	2.7
Rhizoplane	4.62
Rhizosphere	62.62
Stem	0
Stem Tuber	0
Unclassified	17.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_2635904	2162886007	Bacteria	1759
2	SwRhRL2b_contig_3235048	2162886007	Bacteria	1817
3	JGI24739J22299_10010750	3300001989	Bacteria	3391
4	JGI24739J22299_10032695	3300001989	Bacteria	1787
5	JGI25154J39366_1001354	3300002738	Bacteria	8959
6	JGI25150J39212_1000684	3300002774	Bacteria	12339
7	Ga0006562J51391_1072458	3300003578	Bacteria	11300
8	Ga0055527_1000197	3300003760	Bacteria	39769
9	Ga0055535_1000548	3300003761	Bacteria	32250
10	Ga0055542_1000778	3300003762	Bacteria	23954
11	Ga0055526_1000001	3300003771	Bacteria	669703
12	Ga0055537_1000010	3300003773	Bacteria	138059
13	Ga0055534_1000015	3300003784	Bacteria	148531
14	Ga0055528_1000311	3300003790	Bacteria	41165
15	Ga0055540_1001672	3300003792	Bacteria	12822
16	Ga0055531_10000021	3300003794	Bacteria	167213
17	Ga0065704_10079188	3300005289	Bacteria	4235
18	Ga0065704_10108918	3300005289	Bacteria	2016
19	Ga0065715_10118152	3300005293	Bacteria	2325
20	Ga0065707_10086908	3300005295	Bacteria	5248
21	Ga0070670_100001687	3300005331	Bacteria	17947
22	Ga0070666_10057286	3300005335	Bacteria	2633
23	Ga0070666_10098661	3300005335	Bacteria	2012
24	Ga0068868_100009141	3300005338	Bacteria	7115
25	Ga0068868_100245084	3300005338	Bacteria	1507
26	Ga0070660_100000650	3300005339	Bacteria	23017
27	Ga0070669_100039633	3300005353	Bacteria	3423
28	Ga0070671_100006168	3300005355	Bacteria	9547
29	Ga0070671_100015429	3300005355	Bacteria	6172
30	Ga0070674_100063651	3300005356	Bacteria	2582
31	Ga0070673_100065613	3300005364	Bacteria	2896
32	Ga0070659_100000060	3300005366	Bacteria	85656
33	Ga0070659_100003435	3300005366	Bacteria	11281
34	Ga0070667_100009448	3300005367	Bacteria	8088
35	Ga0070663_100000356	3300005455	Bacteria	24096
36	Ga0070663_100108116	3300005455	Bacteria	2086
37	Ga0070678_100003291	3300005456	Bacteria	8984
38	Ga0070662_100044073	3300005457	Bacteria	3195
39	Ga0070662_100078276	3300005457	Bacteria	2456
40	Ga0070662_100087833	3300005457	Bacteria	2329
41	Ga0070681_10012801	3300005458	Bacteria	8327
42	Ga0070681_10050428	3300005458	Bacteria	4152
43	Ga0068867_100000098	3300005459	Bacteria	55567
44	Ga0068867_100039058	3300005459	Bacteria	3458
45	Ga0070685_10007418	3300005466	Bacteria	5612
46	Ga0068853_100031625	3300005539	Bacteria	4477
47	Ga0070672_100002858	3300005543	Bacteria	11086
48	Ga0070672_100005280	3300005543	Bacteria	8546
49	Ga0070665_100166596	3300005548	Bacteria	2206
50	Ga0068855_100000193	3300005563	Bacteria	78989
51	Ga0068855_100007456	3300005563	Bacteria	13249
52	Ga0068855_100193968	3300005563	Bacteria	2289
53	Ga0070664_100199723	3300005564	Bacteria	1784
54	Ga0068857_100175270	3300005577	Bacteria	1951
55	Ga0068852_100013792	3300005616	Bacteria	6196
56	Ga0068852_100015658	3300005616	Bacteria	5891
57	Ga0068852_100131078	3300005616	Bacteria	2309
58	Ga0068864_100011389	3300005618	Bacteria	7349
59	Ga0068861_100028252	3300005719	Bacteria	4092
60	Ga0068863_100021073	3300005841	Bacteria	6225
61	Ga0068863_100091596	3300005841	Bacteria	2883
62	Ga0068858_100004778	3300005842	Bacteria	13269
63	Ga0068862_100027815	3300005844	Bacteria	4762
64	Ga0075365_10054984	3300006038	Bacteria	2641
65	Ga0075364_10048732	3300006051	Bacteria	2761
66	Ga0075362_10002475	3300006177	Bacteria	6215
67	Ga0075362_10003653	3300006177	Bacteria	5423
68	Ga0075362_10027332	3300006177	Bacteria	2442
69	Ga0075367_10103657	3300006178	Bacteria	1741
70	Ga0075369_10012436	3300006186	Bacteria	3363
71	Ga0075366_10017039	3300006195	Bacteria	4178
72	Ga0075366_10033105	3300006195	Bacteria	3044
73	Ga0075366_10052312	3300006195	Bacteria	2427
74	Ga0097621_100003713	3300006237	Bacteria	10569
75	Ga0075370_10000256	3300006353	Bacteria	19065
76	Ga0075370_10000351	3300006353	Bacteria	16750
77	Ga0075370_10001884	3300006353	Bacteria	9413
78	Ga0075370_10005629	3300006353	Bacteria	6251
79	Ga0075370_10006456	3300006353	Bacteria	5900
80	Ga0068871_100005753	3300006358	Bacteria	8704
81	Ga0075430_100090488	3300006846	Bacteria	2560
82	Ga0068865_100012657	3300006881	Bacteria	5317
83	Ga0068865_100193622	3300006881	Bacteria	1574
84	Ga0079104_1000027	3300006946	Bacteria	212641
85	Ga0099826_10004505	3300006948	Bacteria	9779
86	Ga0105251_10055997	3300009011	Bacteria	1868
87	Ga0105244_10004730	3300009036	Bacteria	9265
88	Ga0105250_10000359	3300009092	Bacteria	34641
89	Ga0105240_10094283	3300009093	Bacteria	3652
90	Ga0105243_10004680	3300009148	Bacteria	10775
91	Ga0105243_10005200	3300009148	Bacteria	10184
92	Ga0105241_10003691	3300009174	Bacteria	11376
93	Ga0105248_10011623	3300009177	Bacteria	9698
94	Ga0105248_10064860	3300009177	Bacteria	4100
95	Ga0105237_10001878	3300009545	Bacteria	26806
96	Ga0105237_10004521	3300009545	Bacteria	16072
97	Ga0105237_10085630	3300009545	Bacteria	3141
98	Ga0105237_10160899	3300009545	Bacteria	2243
99	Ga0105249_10019234	3300009553	Bacteria	6090
100	Ga0105239_10022893	3300010375	Bacteria	6887
101	Ga0105239_10029884	3300010375	Bacteria	5993
102	Ga0105239_10068385	3300010375	Bacteria	3903
103	Ga0105239_10165847	3300010375	Bacteria	2470
104	Ga0157369_10062956	3300013105	Bacteria	3997
105	Ga0163162_10026551	3300013306	Bacteria	5724
106	Ga0163162_10035357	3300013306	Bacteria	4976
107	Ga0163162_10242132	3300013306	Bacteria	1935
108	Ga0163162_10244683	3300013306	Bacteria	1925
109	Ga0157375_10014885	3300013308	Bacteria	6953
110	Ga0157375_10041774	3300013308	Bacteria	4431
111	Ga0157375_10172123	3300013308	Bacteria	2313
112	Ga0163163_10024218	3300014325	Bacteria	5775
113	Ga0163163_10087852	3300014325	Bacteria	3120
114	Ga0157380_10007412	3300014326	Bacteria	7790
115	Ga0157380_10057148	3300014326	Bacteria	3106
116	Ga0182008_10019513	3300014497	Bacteria	3499
117	Ga0157377_10000045	3300014745	Bacteria	99825
118	Ga0157379_10124909	3300014968	Bacteria	2315
119	Ga0157379_10151452	3300014968	Bacteria	2092
120	Ga0163161_10011231	3300017792	Bacteria	6205
121	Ga0163161_10041107	3300017792	Bacteria	3322
122	Ga0213872_10000076	3300021361	Bacteria	90633
123	Ga0209672_100026	3300025228	Bacteria	348998
124	Ga0209147_100033	3300025229	Bacteria	348998
125	Ga0209258_100051	3300025242	Bacteria	348998
126	Ga0207425_1000165	3300025245	Bacteria	55745
127	Ga0209646_1000023	3300025246	Bacteria	441100
128	Ga0209148_1000627	3300025254	Bacteria	31284
129	Ga0209759_1013751	3300025256	Bacteria	2173
130	Ga0209565_1000025	3300025263	Bacteria	377969
131	Ga0209455_1000431	3300025272	Bacteria	32691
132	Ga0209673_1000149	3300025273	Bacteria	148659
133	Ga0209675_1000017	3300025291	Bacteria	378002
134	Ga0209676_1004988	3300025292	Bacteria	7117
135	Ga0209025_1005893	3300025294	Bacteria	9794
136	Ga0209564_1000002	3300025295	Bacteria	1636803
137	Ga0209758_1001425	3300025297	Bacteria	28285
138	Ga0209050_1001025	3300025298	Bacteria	34861
139	Ga0209050_1001684	3300025298	Bacteria	22185
140	Ga0209256_1015323	3300025299	Bacteria	2689
141	Ga0209051_1000144	3300025303	Bacteria	134811
142	Ga0209051_1000697	3300025303	Bacteria	36989
143	Ga0209051_1011227	3300025303	Bacteria	4444
144	Ga0209051_1012069	3300025303	Bacteria	4207
145	Ga0209257_1000032	3300025304	Bacteria	680354
146	Ga0207696_1000813	3300025711	Bacteria	20085
147	Ga0207680_10009440	3300025903	Bacteria	4840
148	Ga0207647_10012259	3300025904	Bacteria	5973
149	Ga0207647_10013742	3300025904	Bacteria	5605
150	Ga0207707_10015353	3300025912	Bacteria	6669
151	Ga0207695_10035860	3300025913	Bacteria	5369
152	Ga0207695_10102013	3300025913	Bacteria	2863
153	Ga0207671_10001494	3300025914	Bacteria	26993
154	Ga0207671_10009174	3300025914	Bacteria	8299
155	Ga0207671_10054897	3300025914	Bacteria	2951
156	Ga0207671_10117931	3300025914	Bacteria	2026
157	Ga0207662_10032003	3300025918	Bacteria	3058
158	Ga0207657_10000089	3300025919	Bacteria	86978
159	Ga0207652_10051566	3300025921	Bacteria	3528
160	Ga0207650_10000202	3300025925	Bacteria	68952
161	Ga0207644_10016237	3300025931	Bacteria	5009
162	Ga0207690_10000073	3300025932	Bacteria	88099
163	Ga0207690_10002428	3300025932	Bacteria	11272
164	Ga0207706_10000355	3300025933	Bacteria	49431
165	Ga0207706_10025087	3300025933	Bacteria	5344
166	Ga0207706_10027063	3300025933	Bacteria	5129
167	Ga0207706_10081942	3300025933	Bacteria	2836
168	Ga0207709_10000055	3300025935	Bacteria	222373
169	Ga0207709_10005227	3300025935	Bacteria	7386
170	Ga0207669_10027628	3300025937	Bacteria	3110
171	Ga0207691_10001423	3300025940	Bacteria	23865
172	Ga0207711_10059828	3300025941	Bacteria	3281
173	Ga0207689_10054790	3300025942	Bacteria	3283
174	Ga0207661_10041908	3300025944	Bacteria	3607
175	Ga0207679_10151753	3300025945	Bacteria	1887
176	Ga0207667_10000208	3300025949	Bacteria	83316
177	Ga0207667_10003246	3300025949	Bacteria	20060
178	Ga0207667_10160659	3300025949	Bacteria	2311
179	Ga0207667_10366154	3300025949	Bacteria	1470
180	Ga0207651_10018592	3300025960	Bacteria	4141
181	Ga0207651_10090414	3300025960	Bacteria	2238
182	Ga0207658_10003976	3300025986	Bacteria	10361
183	Ga0207677_10018262	3300026023	Bacteria	4205
184	Ga0207703_10063624	3300026035	Bacteria	3025
185	Ga0207678_10003383	3300026067	Bacteria	14382
186	Ga0207702_10073212	3300026078	Bacteria	2954
187	Ga0207641_10019900	3300026088	Bacteria	5509
188	Ga0207648_10000422	3300026089	Bacteria	46575
189	Ga0207648_10002904	3300026089	Bacteria	18147
190	Ga0207648_10091553	3300026089	Bacteria	2658
191	Ga0207676_10037713	3300026095	Bacteria	3685
192	Ga0207674_10130682	3300026116	Bacteria	2475
193	Ga0207674_10164653	3300026116	Bacteria	2172
194	Ga0207675_100044155	3300026118	Bacteria	4164
195	Ga0207683_10011865	3300026121	Bacteria	7435
196	Ga0207683_10279581	3300026121	Bacteria	1525
197	Ga0207698_10003447	3300026142	Bacteria	9524
198	Ga0209281_1000002	3300027111	Bacteria	1924012
199	Ga0209970_1002203	3300027614	Bacteria	3345
200	Ga0209282_1000113	3300027666	Bacteria	52714
201	Ga0209282_1001580	3300027666	Bacteria	12580
202	Ga0209974_10004475	3300027876	Bacteria	4976
203	Ga0268266_10020546	3300028379	Bacteria	5628
204	Ga0307517_10000861	3300028786	Bacteria	51760
205	Ga0307515_10000089	3300028794	Bacteria	215736
206	Ga0307515_10000921	3300028794	Bacteria	67536
207	Ga0307515_10115275	3300028794	Bacteria	3097
208	Ga0265338_10000037	3300028800	Bacteria	237244
209	Ga0265338_10001920	3300028800	Bacteria	32417
210	Ga0316182_1313739	3300030745	Bacteria	4081
211	Ga0265330_10000043	3300031235	Bacteria	116829
212	Ga0265332_10000018	3300031238	Bacteria	224913
213	Ga0265332_10044193	3300031238	Bacteria	1922
214	Ga0265325_10010066	3300031241	Bacteria	5492
215	Ga0265327_10001160	3300031251	Bacteria	35832
216	Ga0265327_10014203	3300031251	Bacteria	5223
217	Ga0307509_10000033	3300031507	Bacteria	194363
218	Ga0307509_10001891	3300031507	Bacteria	34576
219	Ga0307509_10060132	3300031507	Bacteria	4017
220	Ga0307408_100000026	3300031548	Bacteria	261688
221	Ga0307408_100000156	3300031548	Bacteria	76233
222	Ga0307408_100024338	3300031548	Bacteria	4133
223	Ga0307408_100038506	3300031548	Bacteria	3374
224	Ga0307408_100117738	3300031548	Bacteria	2052
225	Ga0307508_10000041	3300031616	Bacteria	147868
226	Ga0307508_10132088	3300031616	Bacteria	2100
227	Ga0307514_10004984	3300031649	Bacteria	12027
228	Ga0307514_10085512	3300031649	Bacteria	2318
229	Ga0265314_10000126	3300031711	Bacteria	116852
230	Ga0307516_10002380	3300031730	Bacteria	25202
231	Ga0307516_10012703	3300031730	Bacteria	9052
232	Ga0307516_10122303	3300031730	Bacteria	2391
233	Ga0307516_10168563	3300031730	Bacteria	1932
234	Ga0307405_10001264	3300031731	Bacteria	10533
235	Ga0307413_10048576	3300031824	Bacteria	2537
236	Ga0307410_10019243	3300031852	Bacteria	4148
237	Ga0307410_10162056	3300031852	Bacteria	1677
238	Ga0307406_10000328	3300031901	Bacteria	27552
239	Ga0307406_10003982	3300031901	Bacteria	8033
240	Ga0307406_10047896	3300031901	Bacteria	2696
241	Ga0307406_10126703	3300031901	Bacteria	1785
242	Ga0307412_10000002	3300031911	Bacteria	743446
243	Ga0307412_10001680	3300031911	Bacteria	12238
244	Ga0307412_10008809	3300031911	Bacteria	5777
245	Ga0307412_10022454	3300031911	Bacteria	3868
246	Ga0307412_10090444	3300031911	Bacteria	2139
247	Ga0307412_10176243	3300031911	Bacteria	1603
248	Ga0307409_100001186	3300031995	Bacteria	12475
249	Ga0307416_100042835	3300032002	Bacteria	3538
250	Ga0307414_10068020	3300032004	Bacteria	2554
251	Ga0307411_10002152	3300032005	Bacteria	8546
252	Ga0307411_10077611	3300032005	Bacteria	2274
253	Ga0307411_10125700	3300032005	Bacteria	1865
254	Ga0307415_100001125	3300032126	Bacteria	12483
255	Ga0307507_10025028	3300033179	Bacteria	6485
256	Ga0307510_10000930	3300033180	Bacteria	31046
257	Ga0373948_0007925	3300034817	Bacteria	1798
258	Ga0373939_0000009	3300035114	Bacteria	69322
259	Ga0373960_0000942	3300035121	Bacteria	6235
260	Ga0373961_0030075	3300035241	Bacteria	1508
261	Ga0373931_0000526	3300035691	Bacteria	15674
262	Ga0373931_0003235	3300035691	Bacteria	7275
263	Ga0373933_0157325	3300035724	Bacteria	1442
264	Ga0373925_0084843	3300037068	Bacteria	2414
265	Ga0395899_0028570	3300037312	Bacteria	4198
266	Ga0395900_0011642	3300037418	Bacteria	8998
267	Ga0395900_0080266	3300037418	Bacteria	3352
268	Ga0395898_0000276	3300037466	Bacteria	124774
269	Ga0395905_0000009	3300037471	Bacteria	488729
270	Ga0395905_0007449	3300037471	Bacteria	10886
271	Ga0395905_0007804	3300037471	Bacteria	10609
272	Ga0395905_0026994	3300037471	Bacteria	5414
273	Ga0395905_0169574	3300037471	Bacteria	2050
274	Ga0395901_0000891	3300038443	Bacteria	32836
275	Ga0395901_0007246	3300038443	Bacteria	11189
276	Ga0436361_0837133	3300039447	Bacteria	1539
277	Ga0439436_0013681	3300041404	Bacteria	2453
278	Ga0439439_0010629	3300041406	Bacteria	2203
279	Ga0439466_0004902	3300041411	Bacteria	5144
280	Ga0439432_002970	3300042006	Bacteria	6319
281	Ga0439449_0017137	3300042007	Bacteria	2719
282	Ga0450891_001496	3300042129	Bacteria	2408
283	Ga0439464_0001591	3300042439	Bacteria	5397
284	Ga0451577_0000235	3300042876	Bacteria	109693
285	Ga0451577_0005745	3300042876	Bacteria	12579
286	Ga0451577_0008893	3300042876	Bacteria	9721
287	Ga0451577_0014347	3300042876	Bacteria	7387
288	Ga0451577_0015210	3300042876	Bacteria	7159
289	Ga0451577_0018112	3300042876	Bacteria	6492
290	Ga0451577_0032697	3300042876	Bacteria	4687
291	Ga0466972_0034661	3300044658	Bacteria	2472
292	Ga0466977_0000684	3300044666	Bacteria	11966
293	Ga0453683_0001302	3300044673	Bacteria	22014
294	Ga0466966_0033468	3300044684	Bacteria	3328
295	Ga0466961_0005056	3300044693	Bacteria	8295
296	Ga0453684_0000365	3300044712	Bacteria	186233
297	Ga0453684_0022136	3300044712	Bacteria	9451
298	Ga0453684_0026099	3300044712	Bacteria	8455
299	Ga0453684_0075653	3300044712	Bacteria	4230
300	Ga0453684_0238353	3300044712	Bacteria	2095
301	Ga0466957_0001684	3300044842	Bacteria	11622
302	Ga0466960_0005865	3300044901	Bacteria	4896
303	Ga0451576_0003373	3300045051	Bacteria	22077
304	Ga0451576_0033143	3300045051	Bacteria	5491
305	Ga0451576_0107342	3300045051	Bacteria	2905
306	Ga0451576_0171194	3300045051	Bacteria	2267
307	Ga0466958_0024903	3300045836	Bacteria	3524
308	Ga0495590_0005194	3300046457	Bacteria	5174
309	Ga0495629_0019542	3300046459	Bacteria	4839
310	Ga0495638_0000086	3300046460	Bacteria	152781
311	Ga0495651_0000481	3300046462	Bacteria	30764
312	Ga0495651_0015021	3300046462	Bacteria	5984
313	Ga0495650_0001120	3300046471	Bacteria	29266
314	Ga0495650_0005042	3300046471	Bacteria	8752
315	Ga0495605_0017017	3300046474	Bacteria	3926
316	Ga0495596_0006267	3300046500	Bacteria	5501
317	Ga0495583_0000456	3300046506	Bacteria	60762
318	Ga0495583_0004625	3300046506	Bacteria	9725
319	Ga0495583_0020394	3300046506	Bacteria	3434
320	Ga0495606_0014556	3300046507	Bacteria	6125
321	Ga0495608_0011056	3300046511	Bacteria	6291
322	Ga0495610_0008197	3300046512	Bacteria	6807
323	Ga0495616_0006395	3300046513	Bacteria	7133
324	Ga0495628_0000750	3300046516	Bacteria	29958
325	Ga0495648_0000001	3300046524	Bacteria	696872
326	Ga0495648_0018776	3300046524	Bacteria	4880
327	Ga0495648_0057270	3300046524	Bacteria	2339
328	Ga0495666_0057383	3300046526	Bacteria	1864
329	Ga0495642_0065469	3300046528	Bacteria	1513
330	Ga0495652_0001724	3300046529	Bacteria	23550
331	Ga0495652_0004342	3300046529	Bacteria	13578
332	Ga0495609_0000860	3300046538	Bacteria	22340
333	Ga0495609_0078829	3300046538	Bacteria	1441
334	Ga0495622_0000094	3300046557	Bacteria	79405
335	Ga0495633_0000096	3300046558	Bacteria	118933
336	Ga0495625_0098571	3300046660	Bacteria	2010
337	Ga0495623_0026843	3300046679	Bacteria	3705
338	Ga0495623_0088878	3300046679	Bacteria	1900
339	Ga0495671_0025539	3300046692	Bacteria	3070
340	Ga0495649_0020962	3300046694	Bacteria	3663
341	Ga0495660_0073495	3300046810	Bacteria	1808
342	Ga0495604_0028343	3300047317	Bacteria	4454
343	Ga0495674_0016132	3300047319	Bacteria	6972
344	Ga0495674_0024323	3300047319	Bacteria	5566
345	Ga0495672_0015723	3300047320	Bacteria	5127
346	Ga0495602_0002007	3300048088	Bacteria	20465
347	Ga0495626_0036054	3300048091	Bacteria	2358
348	Ga0496102_0149495	3300048905	Bacteria	2194
349	Ga0496103_0006128	3300048906	Bacteria	7186
350	Ga0496105_0011219	3300048908	Bacteria	7070
351	Ga0496105_0052231	3300048908	Bacteria	3375
352	Ga0496106_0000005	3300048909	Bacteria	273394
353	Ga0496106_0023197	3300048909	Bacteria	4610
354	Ga0496112_0021821	3300048915	Bacteria	6093
355	Ga0496113_0004619	3300048916	Bacteria	8487
356	Ga0496113_0218592	3300048916	Bacteria	1518
357	Ga0496115_0020101	3300048918	Bacteria	5146
358	Ga0496116_0004468	3300048919	Bacteria	13322
359	Ga0496116_0031302	3300048919	Bacteria	3811
360	Ga0496117_0003737	3300048920	Bacteria	17437
361	Ga0496117_0043624	3300048920	Bacteria	3258
362	Ga0496117_0107825	3300048920	Bacteria	1743
363	Ga0496118_0051827	3300048921	Bacteria	3136
364	Ga0496119_0005686	3300048922	Bacteria	11826
365	Ga0496120_0030273	3300048923	Bacteria	3292
366	Ga0496121_0000083	3300048924	Bacteria	226816
367	Ga0496121_0000249	3300048924	Bacteria	114260
368	Ga0496121_0000727	3300048924	Bacteria	60909
369	Ga0496121_0008227	3300048924	Bacteria	12353
370	Ga0496121_0012695	3300048924	Bacteria	9141
371	Ga0496121_0014057	3300048924	Bacteria	8542
372	Ga0496122_0000017	3300048925	Bacteria	439553
373	Ga0496123_0000114	3300048926	Bacteria	163598
374	Ga0496123_0030311	3300048926	Bacteria	3962
375	Ga0496124_0060688	3300048927	Bacteria	3171
376	Ga0496125_0000116	3300048928	Bacteria	180492
377	Ga0496125_0007131	3300048928	Bacteria	11927
378	Ga0496126_0026135	3300048929	Bacteria	5603
379	Ga0496126_0173493	3300048929	Bacteria	1835
380	Ga0495678_024860	3300049459	Bacteria	2580
381	Ga0501034_0200890	3300049571	Bacteria	1952
382	Ga0501036_0072196	3300049572	Bacteria	2918
383	Ga0501043_0210279	3300049579	Bacteria	1508
384	Ga0501043_0235754	3300049579	Bacteria	1412
385	Ga0501047_0260918	3300049581	Bacteria	1580
386	Ga0501072_0135628	3300049588	Bacteria	1962
387	Ga0501198_000028	3300049649	Bacteria	64045
388	Ga0501222_000086	3300049662	Bacteria	24843
389	Ga0501262_000772	3300049759	Bacteria	3701
390	Ga0501262_002547	3300049759	Bacteria	2060
391	Ga0501269_000102	3300049766	Bacteria	26721
392	Ga0501280_000731	3300049776	Bacteria	7232
393	Ga0501035_0106331	3300049822	Bacteria	2460
394	Ga0501035_0109765	3300049822	Bacteria	2418
395	Ga0501044_0000130	3300049823	Bacteria	92524
396	Ga0501044_0005988	3300049823	Bacteria	13444
397	Ga0501044_0115115	3300049823	Bacteria	2694
398	nmdc:mga03683_16375_c1	3300050489	Bacteria	2784
399	nmdc:mga03683_34599_c1	3300050489	Bacteria	2045
400	nmdc:mga03683_4142_c1	3300050489	Bacteria	4770
401	nmdc:mga03683_58622_c1	3300050489	Bacteria	1623
402	nmdc:mga03n38_69969_c1	3300050490	Bacteria	1622
403	nmdc:mga0yw44_126968_c1	3300050492	Bacteria	1648
404	nmdc:mga0k408_15743_c1	3300050493	Bacteria	4187
405	nmdc:mga0k408_41197_c1	3300050493	Bacteria	2659
406	nmdc:mga0k408_67972_c1	3300050493	Bacteria	2077
407	nmdc:mga06z11_107507_c1	3300050494	Bacteria	1540
408	nmdc:mga07m45_380_c1	3300050496	Bacteria	18186
409	nmdc:mga07m45_4310_c1	3300050496	Bacteria	6962
410	nmdc:mga07m45_57689_c2	3300050496	Bacteria	1818
411	nmdc:mga07m45_58041_c1	3300050496	Bacteria	2190
412	nmdc:mga0sz30_14985_c1	3300050516	Bacteria	3059
413	Ga0500607_000483	3300053121	Bacteria	38630
414	Ga0500559_0000325	3300053136	Bacteria	35998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050489	nmdc:mga03683_4142_c1	nmdc:mga03683_4142_c1_2519_3748	361
2	3300048920	Ga0496117_0107825	Ga0496117_0107825_12_1160	365
3	3300046459	Ga0495629_0019542	Ga0495629_0019542_495_1685	368
4	3300048924	Ga0496121_0000727	Ga0496121_0000727_34687_35961	370
5	3300048929	Ga0496126_0173493	Ga0496126_0173493_102_1376	370
6	3300031911	Ga0307412_10176243	Ga0307412_101762432	373
7	3300044842	Ga0466957_0001684	Ga0466957_0001684_879_2144	374
8	3300005339	Ga0070660_100000650	Ga0070660_10000065018	378
9	3300005366	Ga0070659_100000060	Ga0070659_10000006063	378
10	3300005455	Ga0070663_100000356	Ga0070663_1000003569	378
11	3300005563	Ga0068855_100007456	Ga0068855_1000074564	378
12	3300005564	Ga0070664_100199723	Ga0070664_1001997231	378
13	3300005616	Ga0068852_100015658	Ga0068852_1000156584	378
14	3300009093	Ga0105240_10094283	Ga0105240_100942832	378
15	3300010375	Ga0105239_10029884	Ga0105239_100298842	378
16	3300025904	Ga0207647_10013742	Ga0207647_100137425	378
17	3300025913	Ga0207695_10102013	Ga0207695_101020132	378
18	3300025919	Ga0207657_10000089	Ga0207657_1000008913	378
19	3300025932	Ga0207690_10000073	Ga0207690_1000007313	378
20	3300025945	Ga0207679_10151753	Ga0207679_101517532	378
21	3300025949	Ga0207667_10003246	Ga0207667_1000324615	378
22	3300026067	Ga0207678_10003383	Ga0207678_100033836	378
23	3300046462	Ga0495651_0000481	Ga0495651_0000481_9419_10657	378
24	3300046462	Ga0495651_0015021	Ga0495651_0015021_4358_5575	378
25	3300046511	Ga0495608_0011056	Ga0495608_0011056_698_1915	378
26	3300046516	Ga0495628_0000750	Ga0495628_0000750_21250_22467	378
27	3300046529	Ga0495652_0001724	Ga0495652_0001724_21804_23021	378
28	3300046529	Ga0495652_0004342	Ga0495652_0004342_12062_13300	378
29	3300046679	Ga0495623_0026843	Ga0495623_0026843_2000_3160	378
30	3300046679	Ga0495623_0088878	Ga0495623_0088878_72_1289	378
31	3300047317	Ga0495604_0028343	Ga0495604_0028343_11_1171	378
32	3300048088	Ga0495602_0002007	Ga0495602_0002007_9235_10473	378
33	3300048908	Ga0496105_0052231	Ga0496105_0052231_657_1922	378
34	3300048916	Ga0496113_0218592	Ga0496113_0218592_158_1423	378
35	3300048919	Ga0496116_0031302	Ga0496116_0031302_189_1457	378
36	3300048924	Ga0496121_0008227	Ga0496121_0008227_655_1920	378
37	3300028800	Ga0265338_10001920	Ga0265338_1000192022	379
38	3300046538	Ga0495609_0078829	Ga0495609_0078829_237_1415	379
39	3300042876	Ga0451577_0032697	Ga0451577_0032697_1032_2339	380
40	3300044712	Ga0453684_0075653	Ga0453684_0075653_537_1844	380
41	3300031548	Ga0307408_100000026	Ga0307408_10000002651	381
42	3300034817	Ga0373948_0007925	Ga0373948_0007925_260_1513	381
43	3300035114	Ga0373939_0000009	Ga0373939_0000009_52753_54006	381
44	3300035121	Ga0373960_0000942	Ga0373960_0000942_1141_2394	381
45	3300035241	Ga0373961_0030075	Ga0373961_0030075_216_1469	381
46	3300035691	Ga0373931_0000526	Ga0373931_0000526_11013_12266	381
47	3300050496	nmdc:mga07m45_58041_c1	nmdc:mga07m45_58041_c1_705_1958	381
48	3300009545	Ga0105237_10160899	Ga0105237_101608991	382
49	3300025914	Ga0207671_10117931	Ga0207671_101179312	382
50	3300045051	Ga0451576_0107342	Ga0451576_0107342_547_1830	382
51	3300046471	Ga0495650_0001120	Ga0495650_0001120_9037_10410	382
52	3300031548	Ga0307408_100000156	Ga0307408_10000015638	383
53	3300050489	nmdc:mga03683_58622_c1	nmdc:mga03683_58622_c1_10_1215	383
54	3300005289	Ga0065704_10108918	Ga0065704_101089182	384
55	3300006946	Ga0079104_1000027	Ga0079104_100002728	384
56	3300009092	Ga0105250_10000359	Ga0105250_100003595	384
57	3300009148	Ga0105243_10004680	Ga0105243_100046802	384
58	3300025711	Ga0207696_1000813	Ga0207696_10008135	384
59	3300025935	Ga0207709_10000055	Ga0207709_1000005544	384
60	3300027111	Ga0209281_1000002	Ga0209281_1000002480	384
61	3300048909	Ga0496106_0000005	Ga0496106_0000005_180588_181868	384
62	3300048924	Ga0496121_0000083	Ga0496121_0000083_45323_46603	384
63	3300009177	Ga0105248_10064860	Ga0105248_100648603	385
64	3300027614	Ga0209970_1002203	Ga0209970_10022031	385
65	3300028794	Ga0307515_10115275	Ga0307515_101152752	385
66	3300031731	Ga0307405_10001264	Ga0307405_100012644	385
67	3300031852	Ga0307410_10019243	Ga0307410_100192432	385
68	3300031901	Ga0307406_10126703	Ga0307406_101267032	385
69	3300031911	Ga0307412_10008809	Ga0307412_100088093	385
70	3300032002	Ga0307416_100042835	Ga0307416_1000428352	385
71	3300032004	Ga0307414_10068020	Ga0307414_100680202	385
72	3300037471	Ga0395905_0007449	Ga0395905_0007449_7916_9181	385
73	3300005539	Ga0068853_100031625	Ga0068853_1000316252	386
74	3300037471	Ga0395905_0007804	Ga0395905_0007804_714_1979	386
75	3300038443	Ga0395901_0007246	Ga0395901_0007246_4540_5805	386
76	3300044666	Ga0466977_0000684	Ga0466977_0000684_7670_8938	386
77	3300049823	Ga0501044_0005988	Ga0501044_0005988_1814_3058	386
78	iso_pu_bacteria	2857564685	2857567081	386
79	3300003760	Ga0055527_1000197	Ga0055527_100019719	387
80	3300003761	Ga0055535_1000548	Ga0055535_100054812	387
81	3300003762	Ga0055542_1000778	Ga0055542_100077814	387
82	3300025228	Ga0209672_100026	Ga0209672_100026260	387
83	3300025229	Ga0209147_100033	Ga0209147_100033260	387
84	3300025242	Ga0209258_100051	Ga0209258_100051260	387
85	3300025254	Ga0209148_1000627	Ga0209148_100062712	387
86	3300037312	Ga0395899_0028570	Ga0395899_0028570_1423_2685	387
87	3300037418	Ga0395900_0011642	Ga0395900_0011642_174_1436	387
88	3300037418	Ga0395900_0080266	Ga0395900_0080266_305_1567	387
89	3300037466	Ga0395898_0000276	Ga0395898_0000276_110053_111315	387
90	3300037471	Ga0395905_0000009	Ga0395905_0000009_239942_241204	387
91	3300038443	Ga0395901_0000891	Ga0395901_0000891_22674_23936	387
92	3300044658	Ga0466972_0034661	Ga0466972_0034661_531_1796	387
93	3300044684	Ga0466966_0033468	Ga0466966_0033468_758_2074	387
94	3300044693	Ga0466961_0005056	Ga0466961_0005056_455_1720	387
95	3300044901	Ga0466960_0005865	Ga0466960_0005865_399_1664	387
96	3300045836	Ga0466958_0024903	Ga0466958_0024903_1954_3219	387
97	3300046506	Ga0495583_0004625	Ga0495583_0004625_6292_7488	387
98	3300046506	Ga0495583_0020394	Ga0495583_0020394_11_1273	387
99	3300046513	Ga0495616_0006395	Ga0495616_0006395_4634_5896	387
100	3300046524	Ga0495648_0018776	Ga0495648_0018776_1840_3102	387
101	3300046526	Ga0495666_0057383	Ga0495666_0057383_460_1722	387
102	3300046692	Ga0495671_0025539	Ga0495671_0025539_631_1893	387
103	3300047320	Ga0495672_0015723	Ga0495672_0015723_1953_3215	387
104	3300048091	Ga0495626_0036054	Ga0495626_0036054_681_1943	387
105	3300048908	Ga0496105_0011219	Ga0496105_0011219_3021_4283	387
106	3300048909	Ga0496106_0023197	Ga0496106_0023197_2588_3850	387
107	3300048915	Ga0496112_0021821	Ga0496112_0021821_4251_5513	387
108	3300048916	Ga0496113_0004619	Ga0496113_0004619_5108_6370	387
109	3300048918	Ga0496115_0020101	Ga0496115_0020101_2950_4212	387
110	3300048924	Ga0496121_0012695	Ga0496121_0012695_732_1994	387
111	3300049459	Ga0495678_024860	Ga0495678_024860_542_1804	387
112	iso_pu_bacteria	2513237166	2514048437	387
113	iso_pu_bacteria	2519103095	2519462513	387
114	iso_pu_bacteria	2562617112	2563057609	387
115	iso_pu_bacteria	2582581311	2585295513	387
116	iso_pu_bacteria	2711768613	2713473693	387
117	iso_pu_bacteria	2816332253	2817263120	387
118	iso_pu_bacteria	2816332256	2817276538	387
119	iso_pu_bacteria	2816332286	2817454569	387
120	iso_pu_bacteria	2870068957	2870076348	387
121	iso_pu_bacteria	2928163908	2928166875	387
122	iso_pu_bacteria	8020807995	8020811522	387
123	iso_pu_bacteria	8020938398	8020940096	387
124	iso_pu_bacteria	8020945358	8020949912	387
125	iso_pu_bacteria	8020953355	8020960317	387
126	iso_pu_bacteria	8039098773	8039103693	387
127	iso_pu_bacteria	8040167225	8040172913	387
128	iso_pu_bacteria	8040173305	8040178779	387
129	3300009011	Ga0105251_10055997	Ga0105251_100559972	388
130	3300027666	Ga0209282_1000113	Ga0209282_100011331	388
131	3300046524	Ga0495648_0057270	Ga0495648_0057270_272_1561	388
132	3300048924	Ga0496121_0014057	Ga0496121_0014057_4933_6222	388
133	3300025303	Ga0209051_1000697	Ga0209051_100069733	389
134	iso_pu_bacteria	2510065045	2510248987	390
135	iso_pu_bacteria	2718217991	2719642596	390
136	iso_pu_bacteria	2885270888	2885272858	390
137	3300001989	JGI24739J22299_10032695	JGI24739J22299_100326951	391
138	3300002774	JGI25150J39212_1000684	JGI25150J39212_10006845	391
139	3300003578	Ga0006562J51391_1072458	Ga0006562J51391_107245812	391
140	3300003773	Ga0055537_1000010	Ga0055537_100001043	391
141	3300003784	Ga0055534_1000015	Ga0055534_100001587	391
142	3300003790	Ga0055528_1000311	Ga0055528_10003113	391
143	3300006353	Ga0075370_10006456	Ga0075370_100064568	391
144	3300006948	Ga0099826_10004505	Ga0099826_1000450511	391
145	3300014497	Ga0182008_10019513	Ga0182008_100195132	391
146	3300025245	Ga0207425_1000165	Ga0207425_100016517	391
147	3300025263	Ga0209565_1000025	Ga0209565_1000025108	391
148	3300025272	Ga0209455_1000431	Ga0209455_100043121	391
149	3300025273	Ga0209673_1000149	Ga0209673_100014939	391
150	3300025291	Ga0209675_1000017	Ga0209675_1000017266	391
151	3300025294	Ga0209025_1005893	Ga0209025_10058937	391
152	3300025297	Ga0209758_1001425	Ga0209758_100142519	391
153	3300025299	Ga0209256_1015323	Ga0209256_10153231	391
154	3300027666	Ga0209282_1001580	Ga0209282_10015805	391
155	3300028800	Ga0265338_10000037	Ga0265338_1000003758	391
156	3300031238	Ga0265332_10044193	Ga0265332_100441932	391
157	3300032005	Ga0307411_10077611	Ga0307411_100776112	391
158	3300049579	Ga0501043_0235754	Ga0501043_0235754_94_1347	391
159	3300049822	Ga0501035_0106331	Ga0501035_0106331_713_1966	391
160	3300049823	Ga0501044_0000130	Ga0501044_0000130_10098_11351	391
161	3300050496	nmdc:mga07m45_57689_c2	nmdc:mga07m45_57689_c2_373_1638	391
162	iso_pu_bacteria	2501025501	2501073230	391
163	iso_pu_bacteria	2501025502	2501083794	391
164	iso_pu_bacteria	2501025504	2501413134	391
165	iso_pu_bacteria	2510917013	2511087378	391
166	iso_pu_bacteria	2510917014	2511100424	391
167	iso_pu_bacteria	2510917015	2511105912	391
168	iso_pu_bacteria	2842324504	2842333210	391
169	iso_pu_bacteria	2857357740	2857364906	391
170	iso_pu_bacteria	2883087390	2883092612	391
171	iso_pu_bacteria	2921643360	2921645267	391
172	iso_pu_bacteria	2990703756	2990710540	391
173	3300005458	Ga0070681_10012801	Ga0070681_100128017	392
174	3300013105	Ga0157369_10062956	Ga0157369_100629562	392
175	3300025912	Ga0207707_10015353	Ga0207707_100153535	392
176	3300025921	Ga0207652_10051566	Ga0207652_100515665	392
177	3300025944	Ga0207661_10041908	Ga0207661_100419082	392
178	3300031235	Ga0265330_10000043	Ga0265330_1000004345	392
179	3300031238	Ga0265332_10000018	Ga0265332_10000018156	392
180	3300031241	Ga0265325_10010066	Ga0265325_100100662	392
181	3300031711	Ga0265314_10000126	Ga0265314_1000012659	392
182	3300035691	Ga0373931_0003235	Ga0373931_0003235_5445_6647	392
183	3300037471	Ga0395905_0169574	Ga0395905_0169574_692_1984	392
184	3300046507	Ga0495606_0014556	Ga0495606_0014556_2541_3818	392
185	3300046810	Ga0495660_0073495	Ga0495660_0073495_206_1483	392
186	3300053136	Ga0500559_0000325	Ga0500559_0000325_22384_23586	392
187	iso_pu_bacteria	2808606390	2809005823	392
188	iso_pu_bacteria	2808606391	2809012420	392
189	2162886007	SwRhRL2b_contig_3235048	SwRhRL2b_0220.00001480	393
190	3300002738	JGI25154J39366_1001354	JGI25154J39366_10013544	393
191	3300003792	Ga0055540_1001672	Ga0055540_10016727	393
192	3300005289	Ga0065704_10079188	Ga0065704_100791882	393
193	3300005366	Ga0070659_100003435	Ga0070659_10000343510	393
194	3300005457	Ga0070662_100044073	Ga0070662_1000440732	393
195	3300006038	Ga0075365_10054984	Ga0075365_100549842	393
196	3300006051	Ga0075364_10048732	Ga0075364_100487323	393
197	3300006177	Ga0075362_10002475	Ga0075362_100024753	393
198	3300006195	Ga0075366_10033105	Ga0075366_100331053	393
199	3300025246	Ga0209646_1000023	Ga0209646_1000023122	393
200	3300025292	Ga0209676_1004988	Ga0209676_10049884	393
201	3300025298	Ga0209050_1001025	Ga0209050_10010254	393
202	3300025303	Ga0209051_1000144	Ga0209051_1000144121	393
203	3300025303	Ga0209051_1012069	Ga0209051_10120693	393
204	3300025932	Ga0207690_10002428	Ga0207690_1000242810	393
205	3300025933	Ga0207706_10000355	Ga0207706_1000035548	393
206	3300031548	Ga0307408_100024338	Ga0307408_1000243382	393
207	3300031649	Ga0307514_10004984	Ga0307514_100049843	393
208	3300031730	Ga0307516_10012703	Ga0307516_100127033	393
209	3300031901	Ga0307406_10003982	Ga0307406_100039823	393
210	3300042876	Ga0451577_0008893	Ga0451577_0008893_1645_2886	393
211	3300044712	Ga0453684_0022136	Ga0453684_0022136_7752_8993	393
212	3300046457	Ga0495590_0005194	Ga0495590_0005194_550_1845	393
213	3300046460	Ga0495638_0000086	Ga0495638_0000086_93008_94276	393
214	3300046471	Ga0495650_0005042	Ga0495650_0005042_5583_6851	393
215	3300046506	Ga0495583_0000456	Ga0495583_0000456_2148_3416	393
216	3300046524	Ga0495648_0000001	Ga0495648_0000001_293720_294988	393
217	3300046528	Ga0495642_0065469	Ga0495642_0065469_48_1316	393
218	3300046538	Ga0495609_0000860	Ga0495609_0000860_18773_20041	393
219	3300046557	Ga0495622_0000094	Ga0495622_0000094_19719_20987	393
220	3300046558	Ga0495633_0000096	Ga0495633_0000096_26402_27670	393
221	3300047319	Ga0495674_0016132	Ga0495674_0016132_5563_6810	393
222	3300047319	Ga0495674_0024323	Ga0495674_0024323_557_1804	393
223	3300048905	Ga0496102_0149495	Ga0496102_0149495_33_1253	393
224	3300048920	Ga0496117_0043624	Ga0496117_0043624_501_1760	393
225	3300048921	Ga0496118_0051827	Ga0496118_0051827_1570_2829	393
226	3300050490	nmdc:mga03n38_69969_c1	nmdc:mga03n38_69969_c1_11_1276	393
227	3300050492	nmdc:mga0yw44_126968_c1	nmdc:mga0yw44_126968_c1_37_1302	393
228	3300053121	Ga0500607_000483	Ga0500607_000483_3356_4681	393
229	3300009036	Ga0105244_10004730	Ga0105244_100047308	394
230	3300031507	Ga0307509_10000033	Ga0307509_10000033133	394
231	3300048906	Ga0496103_0006128	Ga0496103_0006128_987_2258	394
232	3300049572	Ga0501036_0072196	Ga0501036_0072196_585_1808	394
233	3300049579	Ga0501043_0210279	Ga0501043_0210279_194_1417	394
234	3300049581	Ga0501047_0260918	Ga0501047_0260918_118_1341	394
235	3300049822	Ga0501035_0109765	Ga0501035_0109765_1039_2262	394
236	3300049823	Ga0501044_0115115	Ga0501044_0115115_123_1346	394
237	iso_pu_bacteria	2551306416	2553007098	394
238	iso_pu_bacteria	2599185292	2599903586	394
239	iso_pu_bacteria	2643221569	2643860080	394
240	iso_pu_bacteria	2643221594	2643979292	394
241	iso_pu_bacteria	2643221621	2644125049	394
242	iso_pu_bacteria	2643221645	2644250321	394
243	iso_pu_bacteria	2643221664	2644357680	394
244	iso_pu_bacteria	2808606395	2809035925	394
245	iso_pu_bacteria	2857537821	2857541330	394
246	iso_pu_bacteria	2858950400	2858950527	394
247	iso_pu_bacteria	2923510766	2923513281	394
248	3300003771	Ga0055526_1000001	Ga0055526_1000001487	395
249	3300006195	Ga0075366_10017039	Ga0075366_100170393	395
250	3300010375	Ga0105239_10068385	Ga0105239_100683852	395
251	3300025295	Ga0209564_1000002	Ga0209564_100000281	395
252	3300028379	Ga0268266_10020546	Ga0268266_100205462	395
253	3300030745	Ga0316182_1313739	Ga0316182_13137392	395
254	3300031548	Ga0307408_100038506	Ga0307408_1000385062	395
255	3300039447	Ga0436361_0837133	Ga0436361_0837133_260_1513	395
256	3300042876	Ga0451577_0014347	Ga0451577_0014347_3577_4860	395
257	3300044712	Ga0453684_0238353	Ga0453684_0238353_182_1465	395
258	3300046660	Ga0495625_0098571	Ga0495625_0098571_236_1489	395
259	3300049759	Ga0501262_000772	Ga0501262_000772_1883_3148	395
260	3300049776	Ga0501280_000731	Ga0501280_000731_4262_5509	395
261	iso_pu_bacteria	2596583598	2597031851	395
262	iso_pu_bacteria	2919046199	2919047787	395
263	iso_pu_bacteria	2929520902	2929522419	395
264	iso_pu_bacteria	2932422444	2932422903	395
265	3300006195	Ga0075366_10052312	Ga0075366_100523122	396
266	3300049571	Ga0501034_0200890	Ga0501034_0200890_88_1353	396
267	3300049588	Ga0501072_0135628	Ga0501072_0135628_348_1613	396
268	3300050493	nmdc:mga0k408_67972_c1	nmdc:mga0k408_67972_c1_347_1597	396
269	iso_pu_bacteria	2599185167	2599397500	396
270	iso_pu_bacteria	2599185179	2599451939	396
271	iso_pu_bacteria	2599185191	2599521982	396
272	iso_pu_bacteria	2834028612	2834034424	396
273	iso_pu_bacteria	2904424332	2904425153	396
274	iso_pu_bacteria	2945928738	2945933065	396
275	iso_pu_bacteria	8054285046	8054290869	396
276	iso_pu_bacteria	8056161164	8056165707	396
277	3300006353	Ga0075370_10000256	Ga0075370_1000025615	397
278	3300009545	Ga0105237_10085630	Ga0105237_100856302	397
279	3300021361	Ga0213872_10000076	Ga0213872_1000007647	397
280	3300025914	Ga0207671_10054897	Ga0207671_100548972	397
281	3300031911	Ga0307412_10022454	Ga0307412_100224542	397
282	3300037471	Ga0395905_0026994	Ga0395905_0026994_2625_3974	397
283	3300048922	Ga0496119_0005686	Ga0496119_0005686_134_1372	397
284	3300048923	Ga0496120_0030273	Ga0496120_0030273_1730_2968	397
285	3300048924	Ga0496121_0000249	Ga0496121_0000249_93539_94777	397
286	3300048926	Ga0496123_0030311	Ga0496123_0030311_1388_2626	397
287	3300048928	Ga0496125_0000116	Ga0496125_0000116_143784_145022	397
288	3300049766	Ga0501269_000102	Ga0501269_000102_21152_22411	397
289	3300050496	nmdc:mga07m45_380_c1	nmdc:mga07m45_380_c1_936_2231	397
290	iso_pu_bacteria	2643221672	2644398196	397
291	iso_pu_bacteria	2904449895	2904453565	397
292	iso_pu_bacteria	2904456579	2904459104	397
293	3300003794	Ga0055531_10000021	Ga0055531_10000021116	398
294	3300005331	Ga0070670_100001687	Ga0070670_1000016876	398
295	3300005367	Ga0070667_100009448	Ga0070667_1000094483	398
296	3300005457	Ga0070662_100087833	Ga0070662_1000878332	398
297	3300005458	Ga0070681_10050428	Ga0070681_100504282	398
298	3300005548	Ga0070665_100166596	Ga0070665_1001665962	398
299	3300005563	Ga0068855_100193968	Ga0068855_1001939682	398
300	3300005577	Ga0068857_100175270	Ga0068857_1001752702	398
301	3300006177	Ga0075362_10003653	Ga0075362_100036532	398
302	3300006178	Ga0075367_10103657	Ga0075367_101036571	398
303	3300006186	Ga0075369_10012436	Ga0075369_100124362	398
304	3300006353	Ga0075370_10001884	Ga0075370_100018844	398
305	3300006353	Ga0075370_10005629	Ga0075370_100056296	398
306	3300006846	Ga0075430_100090488	Ga0075430_1000904882	398
307	3300009174	Ga0105241_10003691	Ga0105241_100036912	398
308	3300009545	Ga0105237_10001878	Ga0105237_1000187811	398
309	3300009545	Ga0105237_10004521	Ga0105237_100045218	398
310	3300010375	Ga0105239_10022893	Ga0105239_100228934	398
311	3300025298	Ga0209050_1001684	Ga0209050_10016843	398
312	3300025303	Ga0209051_1011227	Ga0209051_10112272	398
313	3300025304	Ga0209257_1000032	Ga0209257_1000032402	398
314	3300025913	Ga0207695_10035860	Ga0207695_100358602	398
315	3300025914	Ga0207671_10001494	Ga0207671_100014949	398
316	3300025914	Ga0207671_10009174	Ga0207671_100091743	398
317	3300025925	Ga0207650_10000202	Ga0207650_1000020229	398
318	3300025933	Ga0207706_10081942	Ga0207706_100819422	398
319	3300025949	Ga0207667_10160659	Ga0207667_101606592	398
320	3300025986	Ga0207658_10003976	Ga0207658_100039768	398
321	3300026116	Ga0207674_10130682	Ga0207674_101306823	398
322	3300026116	Ga0207674_10164653	Ga0207674_101646532	398
323	3300027876	Ga0209974_10004475	Ga0209974_100044755	398
324	3300028794	Ga0307515_10000089	Ga0307515_10000089170	398
325	3300031730	Ga0307516_10002380	Ga0307516_100023804	398
326	3300031824	Ga0307413_10048576	Ga0307413_100485762	398
327	3300031901	Ga0307406_10047896	Ga0307406_100478962	398
328	3300031911	Ga0307412_10001680	Ga0307412_100016804	398
329	3300031995	Ga0307409_100001186	Ga0307409_1000011865	398
330	3300032005	Ga0307411_10002152	Ga0307411_100021525	398
331	3300032126	Ga0307415_100001125	Ga0307415_1000011252	398
332	3300035724	Ga0373933_0157325	Ga0373933_0157325_136_1392	398
333	3300042876	Ga0451577_0000235	Ga0451577_0000235_5999_7267	398
334	3300044673	Ga0453683_0001302	Ga0453683_0001302_18562_19887	398
335	3300044712	Ga0453684_0000365	Ga0453684_0000365_181340_182608	398
336	3300045051	Ga0451576_0033143	Ga0451576_0033143_3807_5132	398
337	3300050489	nmdc:mga03683_16375_c1	nmdc:mga03683_16375_c1_150_1445	398
338	3300050493	nmdc:mga0k408_15743_c1	nmdc:mga0k408_15743_c1_1340_2635	398
339	3300050493	nmdc:mga0k408_41197_c1	nmdc:mga0k408_41197_c1_501_1796	398
340	3300050494	nmdc:mga06z11_107507_c1	nmdc:mga06z11_107507_c1_146_1495	398
341	3300050516	nmdc:mga0sz30_14985_c1	nmdc:mga0sz30_14985_c1_969_2264	398
342	iso_pu_bacteria	2599185288	2599880597	398
343	iso_pu_bacteria	2599185303	2599952106	398
344	iso_pu_bacteria	2619619299	2621299207	398
345	iso_pu_bacteria	2643221609	2644060246	398
346	iso_pu_bacteria	2643221611	2644076042	398
347	iso_pu_bacteria	2643221639	2644217870	398
348	iso_pu_bacteria	2643221646	2644258393	398
349	iso_pu_bacteria	2643221654	2644302960	398
350	iso_pu_bacteria	2738541265	2738674750	398
351	iso_pu_bacteria	2738541282	2738753143	398
352	iso_pu_bacteria	2738541294	2738806283	398
353	iso_pu_bacteria	2738541303	2738862054	398
354	iso_pu_bacteria	2738541309	2738893643	398
355	iso_pu_bacteria	2808606385	2808978629	398
356	iso_pu_bacteria	2808606388	2808996724	398
357	iso_pu_bacteria	2816332298	2817491698	398
358	iso_pu_bacteria	2852612431	2852614015	398
359	iso_pu_bacteria	2852667396	2852668248	398
360	iso_pu_bacteria	2941479691	2941481264	398
361	iso_pu_bacteria	8056131705	8056135130	398
362	3300005293	Ga0065715_10118152	Ga0065715_101181522	399
363	3300005338	Ga0068868_100009141	Ga0068868_1000091413	399
364	3300005355	Ga0070671_100015429	Ga0070671_1000154292	399
365	3300005364	Ga0070673_100065613	Ga0070673_1000656132	399
366	3300005456	Ga0070678_100003291	Ga0070678_1000032912	399
367	3300005459	Ga0068867_100039058	Ga0068867_1000390583	399
368	3300005466	Ga0070685_10007418	Ga0070685_100074182	399
369	3300005616	Ga0068852_100131078	Ga0068852_1001310782	399
370	3300005841	Ga0068863_100021073	Ga0068863_1000210733	399
371	3300005842	Ga0068858_100004778	Ga0068858_1000047783	399
372	3300013306	Ga0163162_10035357	Ga0163162_100353572	399
373	3300013308	Ga0157375_10041774	Ga0157375_100417743	399
374	3300014325	Ga0163163_10024218	Ga0163163_100242183	399
375	3300014326	Ga0157380_10057148	Ga0157380_100571482	399
376	3300014968	Ga0157379_10124909	Ga0157379_101249092	399
377	3300025918	Ga0207662_10032003	Ga0207662_100320032	399
378	3300025931	Ga0207644_10016237	Ga0207644_100162373	399
379	3300025933	Ga0207706_10025087	Ga0207706_100250872	399
380	3300025960	Ga0207651_10018592	Ga0207651_100185922	399
381	3300026023	Ga0207677_10018262	Ga0207677_100182623	399
382	3300026035	Ga0207703_10063624	Ga0207703_100636242	399
383	3300026088	Ga0207641_10019900	Ga0207641_100199002	399
384	3300026089	Ga0207648_10091553	Ga0207648_100915533	399
385	3300026121	Ga0207683_10011865	Ga0207683_100118655	399
386	3300031251	Ga0265327_10014203	Ga0265327_100142033	399
387	3300042129	Ga0450891_001496	Ga0450891_001496_918_2180	399
388	3300042439	Ga0439464_0001591	Ga0439464_0001591_1388_2761	399
389	3300049759	Ga0501262_002547	Ga0501262_002547_487_1839	399
390	iso_pu_bacteria	2547132374	2548499572	399
391	iso_pu_bacteria	2643221570	2643866408	399
392	iso_pu_bacteria	2643221596	2643991915	399
393	iso_pu_bacteria	2643221652	2644293223	399
394	iso_pu_bacteria	2643221717	2644648239	399
395	iso_pu_bacteria	2954767861	2954768330	399
396	iso_pu_bacteria	2990710928	2990714458	399
397	3300005335	Ga0070666_10057286	Ga0070666_100572861	400
398	3300005563	Ga0068855_100000193	Ga0068855_10000019355	400
399	3300025949	Ga0207667_10000208	Ga0207667_1000020823	400
400	3300025960	Ga0207651_10090414	Ga0207651_100904142	400
401	3300026121	Ga0207683_10279581	Ga0207683_102795811	400
402	3300031251	Ga0265327_10001160	Ga0265327_100011603	400
403	3300031730	Ga0307516_10122303	Ga0307516_101223032	400
404	3300031852	Ga0307410_10162056	Ga0307410_101620562	400
405	3300032005	Ga0307411_10125700	Ga0307411_101257001	400
406	3300042876	Ga0451577_0005745	Ga0451577_0005745_8863_10134	400
407	iso_pu_bacteria	2600255067	2600812760	400
408	3300001989	JGI24739J22299_10010750	JGI24739J22299_100107503	401
409	3300005455	Ga0070663_100108116	Ga0070663_1001081161	401
410	3300006177	Ga0075362_10027332	Ga0075362_100273322	401
411	3300006353	Ga0075370_10000351	Ga0075370_100003513	401
412	3300010375	Ga0105239_10165847	Ga0105239_101658472	401
413	3300025256	Ga0209759_1013751	Ga0209759_10137512	401
414	3300025904	Ga0207647_10012259	Ga0207647_100122592	401
415	3300025942	Ga0207689_10054790	Ga0207689_100547902	401
416	3300025949	Ga0207667_10366154	Ga0207667_103661542	401
417	3300026078	Ga0207702_10073212	Ga0207702_100732122	401
418	3300031548	Ga0307408_100117738	Ga0307408_1001177382	401
419	3300031901	Ga0307406_10000328	Ga0307406_1000032819	401
420	3300031911	Ga0307412_10000002	Ga0307412_10000002319	401
421	3300031911	Ga0307412_10090444	Ga0307412_100904442	401
422	3300041404	Ga0439436_0013681	Ga0439436_0013681_619_1908	401
423	3300041406	Ga0439439_0010629	Ga0439439_0010629_528_1817	401
424	3300041411	Ga0439466_0004902	Ga0439466_0004902_469_1830	401
425	3300042006	Ga0439432_002970	Ga0439432_002970_1550_2839	401
426	3300042007	Ga0439449_0017137	Ga0439449_0017137_890_2179	401
427	3300042876	Ga0451577_0015210	Ga0451577_0015210_1641_3023	401
428	3300046474	Ga0495605_0017017	Ga0495605_0017017_1954_3276	401
429	3300046500	Ga0495596_0006267	Ga0495596_0006267_2909_4231	401
430	3300046512	Ga0495610_0008197	Ga0495610_0008197_2548_3870	401
431	3300046694	Ga0495649_0020962	Ga0495649_0020962_816_2138	401
432	3300048920	Ga0496117_0003737	Ga0496117_0003737_15258_16580	401
433	3300050489	nmdc:mga03683_34599_c1	nmdc:mga03683_34599_c1_36_1325	401
434	3300050496	nmdc:mga07m45_4310_c1	nmdc:mga07m45_4310_c1_5020_6309	401
435	iso_pu_bacteria	2721755523	2722886046	401
436	iso_pu_bacteria	2839138175	2839143223	401
437	iso_pu_bacteria	2928130867	2928134134	401
438	3300005295	Ga0065707_10086908	Ga0065707_100869083	402
439	3300005353	Ga0070669_100039633	Ga0070669_1000396332	402
440	3300005356	Ga0070674_100063651	Ga0070674_1000636513	402
441	3300005457	Ga0070662_100078276	Ga0070662_1000782762	402
442	3300005459	Ga0068867_100000098	Ga0068867_10000009811	402
443	3300005543	Ga0070672_100005280	Ga0070672_1000052803	402
444	3300005719	Ga0068861_100028252	Ga0068861_1000282523	402
445	3300005844	Ga0068862_100027815	Ga0068862_1000278153	402
446	3300006881	Ga0068865_100012657	Ga0068865_1000126573	402
447	3300009148	Ga0105243_10005200	Ga0105243_100052007	402
448	3300009553	Ga0105249_10019234	Ga0105249_100192342	402
449	3300013306	Ga0163162_10026551	Ga0163162_100265514	402
450	3300014326	Ga0157380_10007412	Ga0157380_100074124	402
451	3300014745	Ga0157377_10000045	Ga0157377_1000004530	402
452	3300017792	Ga0163161_10011231	Ga0163161_100112312	402
453	3300017792	Ga0163161_10041107	Ga0163161_100411073	402
454	3300025935	Ga0207709_10005227	Ga0207709_100052276	402
455	3300025937	Ga0207669_10027628	Ga0207669_100276282	402
456	3300025940	Ga0207691_10001423	Ga0207691_1000142312	402
457	3300026089	Ga0207648_10000422	Ga0207648_1000042237	402
458	3300026089	Ga0207648_10002904	Ga0207648_100029043	402
459	3300026118	Ga0207675_100044155	Ga0207675_1000441552	402
460	3300028786	Ga0307517_10000861	Ga0307517_1000086120	402
461	3300028794	Ga0307515_10000921	Ga0307515_1000092162	402
462	3300031507	Ga0307509_10001891	Ga0307509_100018913	402
463	3300031507	Ga0307509_10060132	Ga0307509_100601322	402
464	3300031616	Ga0307508_10000041	Ga0307508_1000004156	402
465	3300031616	Ga0307508_10132088	Ga0307508_101320882	402
466	3300031649	Ga0307514_10085512	Ga0307514_100855123	402
467	3300031730	Ga0307516_10168563	Ga0307516_101685631	402
468	3300033179	Ga0307507_10025028	Ga0307507_100250283	402
469	3300033180	Ga0307510_10000930	Ga0307510_100009305	402
470	3300037068	Ga0373925_0084843	Ga0373925_0084843_818_2101	402
471	3300044712	Ga0453684_0026099	Ga0453684_0026099_3814_5115	402
472	3300045051	Ga0451576_0003373	Ga0451576_0003373_17444_18745	402
473	3300045051	Ga0451576_0171194	Ga0451576_0171194_1004_2245	402
474	3300005335	Ga0070666_10098661	Ga0070666_100986612	403
475	3300005338	Ga0068868_100245084	Ga0068868_1002450842	403
476	3300005355	Ga0070671_100006168	Ga0070671_1000061684	403
477	3300005543	Ga0070672_100002858	Ga0070672_1000028584	403
478	3300005616	Ga0068852_100013792	Ga0068852_1000137922	403
479	3300005618	Ga0068864_100011389	Ga0068864_1000113893	403
480	3300005841	Ga0068863_100091596	Ga0068863_1000915962	403
481	3300006237	Ga0097621_100003713	Ga0097621_1000037135	403
482	3300006358	Ga0068871_100005753	Ga0068871_1000057533	403
483	3300006881	Ga0068865_100193622	Ga0068865_1001936221	403
484	3300009177	Ga0105248_10011623	Ga0105248_100116237	403
485	3300013306	Ga0163162_10242132	Ga0163162_102421322	403
486	3300013306	Ga0163162_10244683	Ga0163162_102446832	403
487	3300013308	Ga0157375_10014885	Ga0157375_100148852	403
488	3300013308	Ga0157375_10172123	Ga0157375_101721232	403
489	3300014325	Ga0163163_10087852	Ga0163163_100878523	403
490	3300014968	Ga0157379_10151452	Ga0157379_101514522	403
491	3300025903	Ga0207680_10009440	Ga0207680_100094403	403
492	3300025933	Ga0207706_10027063	Ga0207706_100270633	403
493	3300025941	Ga0207711_10059828	Ga0207711_100598282	403
494	3300026095	Ga0207676_10037713	Ga0207676_100377131	403
495	3300026142	Ga0207698_10003447	Ga0207698_100034479	403
496	3300042876	Ga0451577_0018112	Ga0451577_0018112_442_1860	403
497	3300049649	Ga0501198_000028	Ga0501198_000028_5523_6857	403
498	3300049662	Ga0501222_000086	Ga0501222_000086_17949_19283	403
499	3300048919	Ga0496116_0004468	Ga0496116_0004468_10429_11691	405
500	3300048925	Ga0496122_0000017	Ga0496122_0000017_126883_128145	405
501	3300048926	Ga0496123_0000114	Ga0496123_0000114_35454_36716	405
502	3300048927	Ga0496124_0060688	Ga0496124_0060688_1175_2437	405
503	3300048928	Ga0496125_0007131	Ga0496125_0007131_7027_8289	405
504	3300048929	Ga0496126_0026135	Ga0496126_0026135_1175_2437	405
505	iso_pu_bacteria	2842324504	2842330303	405
506	iso_pu_bacteria	2919481497	2919485453	410
507	2162886007	SwRhRL2b_contig_2635904	SwRhRL2b_0061.00002590	414
508	iso_pu_bacteria	2511231018	2511339383	414
509	iso_pu_bacteria	2599185302	2599943576	414
510	iso_pu_bacteria	2599185304	2599954687	414
511	iso_pu_bacteria	2599185309	2599985242	414
512	iso_pu_bacteria	2599185310	2599988507	414
513	iso_pu_bacteria	2599185311	2599992481	414
514	iso_pu_bacteria	2599185312	2600003212	414
515	iso_pu_bacteria	2599185318	2600033752	414
516	iso_pu_bacteria	2599185320	2600049767	414
517	iso_pu_bacteria	2825651385	2825651419	414
518	iso_pu_bacteria	2913036834	2913039458	414
519	iso_pu_bacteria	2923586266	2923586352	414

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

119

352

0.83 PF07690

MFS_1

Major Facilitator Superfamily

31

129

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4u4v-assembly1.cif.gz_A	structure of a nitrate/nitrite antiporter nark in apo inward-open state	0.807	2	385
8hpk-assembly1.cif.gz_A	crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form	0.8061	2	385
6kkl-assembly1.cif.gz_A	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant)	0.7972	2	387
6kkj-assembly1.cif.gz_B	crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation	0.7945	2	383
4jre-assembly1.cif.gz_A	crystal structure of nitrate/nitrite exchanger nark with nitrite bound	0.7926	2	380

ID	Description	Score	Start	End	Superfamily
af_P9WJY7_2_188_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9559	2	172	1.20.1250.20
af_Q2FVN1_5_182_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9537	2	171	1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.911	2	178	1.20.1250.20
af_B6T9A5_7_198_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9109	2	172	1.20.1250.20
af_Q2FVN1_5_182_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9074	2	171	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-A0A358C7N8-F1-model_v4	MFS transporter	0.9667	1	121	GO:0005886 GO:0015112 GO:0042128
AF-A0A2G2I1Y7-F1-model_v4	deleted	0.9305	1	384
AF-A0A157RHF5-F1-model_v4	Nitrite extrusion protein	0.9265	2	390	GO:0005886 GO:0015112 GO:0042128
AF-A0A2N8Q494-F1-model_v4	deleted	0.9194	2	400
AF-A0A848TEX8-F1-model_v4	NarK/NasA family nitrate transporter	0.9141	2	384	GO:0005886 GO:0015112 GO:0042128

Feature Viewer

pLDDT	pTM	Quality
79.16	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F458352

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07690

MFS_1

Major Facilitator Superfamily

119

352

0.83

PF07690

MFS_1

Major Facilitator Superfamily

31

129

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map