F458052

General Info

Members Datasets Scaffolds Average Seq Length
516 241 1032 202

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0420174|Ga0496109_0420174_318_1067
Length 237
Sequence VVTLVYDWDPLNDIAFAGPSPDASRRADEPRFGRQSMKLTASMMLTLDGVYQGPGGPDEDRRGGFERGGWTAAHADEEMWPFLTSWFERADSLLLGRKTWEIWEPYWPLHDGGDPVSHGINVLPKYVPSTTLKDPTWQNTHVIGGDLEAAVRELKAQPGRELQVHGSGELLRWLLERDLVDELNLRIYPVIVGDGLRLFPERGQTHDLELVESRSTSSGVMIQTYRPAGRATFGNAG

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2643221629 Devosia sp. Root105 Isolate Unclassified
238 2643221662 Devosia sp. Root413D1 Isolate Unclassified
239 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
240 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
241 3006393351 Streptomyces sp. SID4985 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 10.08
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 19.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0420174 3300048912 Bacteria 1263
2 rootH1_10101548 3300003316 Bacteria 3043
3 rootH2_10189904 3300003320 Bacteria 1724
4 rootL2_10138112 3300003322 Bacteria 2597
5 rootH1_10256490 3300003323 Bacteria 1466
6 Ga0065707_10107585 3300005295 Bacteria 2544
7 Ga0070676_10035556 3300005328 Bacteria 2866
8 Ga0070683_100695387 3300005329 Bacteria 974
9 Ga0070690_100105774 3300005330 Bacteria 1871
10 Ga0068869_100312861 3300005334 Unclassified 1271
11 Ga0070666_10227729 3300005335 Unclassified 1316
12 Ga0070680_100000008 3300005336 Bacteria 100309
13 Ga0070680_100458639 3300005336 Bacteria 1089
14 Ga0068868_100178273 3300005338 Unclassified 1762
15 Ga0070660_100082293 3300005339 Unclassified 2528
16 Ga0070689_100020660 3300005340 Bacteria 4888
17 Ga0070687_100042727 3300005343 Unclassified 2298
18 Ga0070687_100069693 3300005343 Bacteria 1884
19 Ga0070692_10002332 3300005345 Bacteria 7325
20 Ga0070668_100321107 3300005347 Unclassified 1304
21 Ga0070675_100080032 3300005354 Unclassified 2723
22 Ga0070675_100138771 3300005354 Bacteria 2076
23 Ga0070671_100254038 3300005355 Unclassified 1493
24 Ga0070674_100013375 3300005356 Bacteria 5071
25 Ga0070674_100223768 3300005356 Bacteria 1465
26 Ga0070659_100132796 3300005366 Unclassified 2023
27 Ga0070659_100271661 3300005366 Unclassified 1409
28 Ga0070705_100048020 3300005440 Bacteria 2470
29 Ga0070700_100018205 3300005441 Unclassified 4035
30 Ga0070694_100035993 3300005444 Unclassified 3276
31 Ga0070694_100081040 3300005444 Unclassified 2257
32 Ga0070694_100668233 3300005444 Bacteria 842
33 Ga0070708_100000850 3300005445 Bacteria 22991
34 Ga0070708_100009613 3300005445 Bacteria 7798
35 Ga0070708_100091604 3300005445 Bacteria 2769
36 Ga0070708_100148642 3300005445 Unclassified 2178
37 Ga0070708_100193783 3300005445 Bacteria 1901
38 Ga0070708_100247970 3300005445 Bacteria 1673
39 Ga0070708_100563953 3300005445 Bacteria 1074
40 Ga0070678_100096870 3300005456 Unclassified 2277
41 Ga0070678_100116325 3300005456 Bacteria 2101
42 Ga0070662_100024849 3300005457 Bacteria 4132
43 Ga0070681_10099609 3300005458 Bacteria 2852
44 Ga0068867_101128637 3300005459 Bacteria 717
45 Ga0070685_10054311 3300005466 Unclassified 2323
46 Ga0070685_10414336 3300005466 Bacteria 936
47 Ga0070706_100010360 3300005467 Bacteria 8661
48 Ga0070706_100011227 3300005467 Bacteria 8318
49 Ga0070706_100049622 3300005467 Bacteria 3873
50 Ga0070706_100070342 3300005467 Unclassified 3236
51 Ga0070706_100098865 3300005467 Bacteria 2711
52 Ga0070706_100368329 3300005467 Bacteria 1338
53 Ga0070707_100001121 3300005468 Bacteria 26448
54 Ga0070707_100004788 3300005468 Bacteria 12668
55 Ga0070707_100005272 3300005468 Bacteria 12101
56 Ga0070707_100009237 3300005468 Bacteria 9148
57 Ga0070707_100023134 3300005468 Bacteria 5878
58 Ga0070707_100083769 3300005468 Bacteria 3081
59 Ga0070707_100104003 3300005468 Bacteria 2752
60 Ga0070707_100237552 3300005468 Bacteria 1774
61 Ga0070707_100470771 3300005468 Bacteria 1218
62 Ga0070698_100038564 3300005471 Bacteria 4923
63 Ga0070698_100047642 3300005471 Bacteria 4381
64 Ga0070698_100098591 3300005471 Unclassified 2896
65 Ga0070698_100117610 3300005471 Unclassified 2620
66 Ga0070698_100213439 3300005471 Bacteria 1864
67 Ga0070698_100347005 3300005471 Bacteria 1416
68 Ga0070699_100022475 3300005518 Bacteria 5436
69 Ga0070699_100057239 3300005518 Bacteria 3377
70 Ga0070699_100187305 3300005518 Unclassified 1838
71 Ga0070699_100251963 3300005518 Bacteria 1577
72 Ga0070679_100053994 3300005530 Bacteria 4000
73 Ga0070679_100721215 3300005530 Bacteria 940
74 Ga0070684_100058757 3300005535 Bacteria 3361
75 Ga0070697_100006267 3300005536 Bacteria 9209
76 Ga0070697_100019865 3300005536 Bacteria 5309
77 Ga0070697_100092511 3300005536 Unclassified 2502
78 Ga0070697_100320606 3300005536 Unclassified 1335
79 Ga0070697_100927968 3300005536 Bacteria 773
80 Ga0068853_101196161 3300005539 Bacteria 734
81 Ga0070686_100025150 3300005544 Bacteria 3579
82 Ga0070686_100216641 3300005544 Bacteria 1381
83 Ga0070686_100388219 3300005544 Bacteria 1058
84 Ga0070695_100034940 3300005545 Unclassified 3156
85 Ga0070695_100225378 3300005545 Unclassified 1353
86 Ga0070695_100229809 3300005545 Bacteria 1340
87 Ga0070696_100006701 3300005546 Bacteria 7695
88 Ga0070696_100027828 3300005546 Bacteria 3855
89 Ga0070696_100138130 3300005546 Bacteria 1778
90 Ga0070693_100016753 3300005547 Bacteria 3798
91 Ga0070693_100720972 3300005547 Bacteria 732
92 Ga0070704_100024596 3300005549 Bacteria 3953
93 Ga0070704_100051679 3300005549 Bacteria 2896
94 Ga0068855_100876297 3300005563 Bacteria 950
95 Ga0070664_100231768 3300005564 Bacteria 1655
96 Ga0070664_100607047 3300005564 Bacteria 1015
97 Ga0070664_100859008 3300005564 Bacteria 850
98 Ga0068857_100431627 3300005577 Bacteria 1230
99 Ga0068857_100493322 3300005577 Bacteria 1149
100 Ga0068854_100334675 3300005578 Unclassified 1235
101 Ga0068856_100143784 3300005614 Bacteria 2393
102 Ga0068856_101471217 3300005614 Unclassified 695
103 Ga0070702_100002044 3300005615 Bacteria 8531
104 Ga0070702_100235477 3300005615 Bacteria 1233
105 Ga0068864_100009827 3300005618 Bacteria 7888
106 Ga0068864_100429043 3300005618 Bacteria 1261
107 Ga0068861_100397462 3300005719 Bacteria 1222
108 Ga0068851_10111754 3300005834 Bacteria 1459
109 Ga0068870_10018561 3300005840 Bacteria 3360
110 Ga0068858_100241603 3300005842 Bacteria 1714
111 Ga0068858_100277975 3300005842 Unclassified 1594
112 Ga0068860_100026480 3300005843 Bacteria 5590
113 Ga0068860_100049435 3300005843 Unclassified 4005
114 Ga0068860_100958193 3300005843 Bacteria 873
115 Ga0068862_100608148 3300005844 Unclassified 1050
116 Ga0081538_10135918 3300005981 Bacteria 1145
117 Ga0081539_10007974 3300005985 Bacteria 9415
118 Ga0097621_100205736 3300006237 Bacteria 1710
119 Ga0068871_100081466 3300006358 Bacteria 2682
120 Ga0075428_100000179 3300006844 Bacteria 59465
121 Ga0075428_100026694 3300006844 Bacteria 6395
122 Ga0075428_100066419 3300006844 Bacteria 3949
123 Ga0075428_100111223 3300006844 Bacteria 2985
124 Ga0075428_100480986 3300006844 Bacteria 1329
125 Ga0075428_101754162 3300006844 Bacteria 647
126 Ga0075430_100011058 3300006846 Bacteria 7647
127 Ga0075430_100122424 3300006846 Bacteria 2169
128 Ga0075433_10027975 3300006852 Bacteria 4789
129 Ga0075433_10095348 3300006852 Bacteria 2633
130 Ga0075433_10149617 3300006852 Bacteria 2076
131 Ga0075433_10186478 3300006852 Bacteria 1846
132 Ga0075433_10401700 3300006852 Bacteria 1209
133 Ga0075433_10453020 3300006852 Bacteria 1131
134 Ga0075433_10492236 3300006852 Bacteria 1080
135 Ga0075434_100123700 3300006871 Bacteria 2603
136 Ga0075434_100475401 3300006871 Unclassified 1271
137 Ga0075429_100003086 3300006880 Bacteria 14130
138 Ga0068865_100005205 3300006881 Bacteria 7865
139 Ga0075435_100410347 3300007076 Bacteria 1166
140 Ga0075435_100416542 3300007076 Unclassified 1157
141 Ga0105244_10087922 3300009036 Bacteria 1531
142 Ga0111539_10007016 3300009094 Bacteria 14452
143 Ga0111539_10085538 3300009094 Bacteria 3706
144 Ga0111539_10499728 3300009094 Bacteria 1416
145 Ga0111539_10651760 3300009094 Bacteria 1226
146 Ga0105245_10026760 3300009098 Bacteria 5079
147 Ga0105245_10083060 3300009098 Bacteria 2931
148 Ga0105245_10119906 3300009098 Unclassified 2456
149 Ga0105245_10698164 3300009098 Bacteria 1048
150 Ga0114129_10008152 3300009147 Bacteria 14931
151 Ga0114129_10337934 3300009147 Bacteria 1998
152 Ga0114129_10472342 3300009147 Bacteria 1642
153 Ga0114129_10554598 3300009147 Unclassified 1494
154 Ga0114129_10631879 3300009147 Bacteria 1384
155 Ga0114129_10928679 3300009147 Bacteria 1101
156 Ga0105243_10011398 3300009148 Bacteria 6727
157 Ga0105243_10908762 3300009148 Bacteria 876
158 Ga0105241_10157925 3300009174 Bacteria 1861
159 Ga0105248_10022352 3300009177 Bacteria 7015
160 Ga0105248_10262790 3300009177 Bacteria 1943
161 Ga0105248_10295531 3300009177 Bacteria 1824
162 Ga0105248_10344922 3300009177 Unclassified 1677
163 Ga0105249_10008942 3300009553 Bacteria 8749
164 Ga0105249_10013362 3300009553 Bacteria 7251
165 Ga0105249_10276446 3300009553 Bacteria 1675
166 Ga0105239_10007492 3300010375 Bacteria 12525
167 Ga0105246_10006263 3300011119 Bacteria 7265
168 Ga0105246_10120809 3300011119 Unclassified 1941
169 Ga0105246_10790251 3300011119 Bacteria 841
170 Ga0105246_11100851 3300011119 Bacteria 725
171 Ga0157374_10278444 3300013296 Bacteria 1651
172 Ga0157378_10067238 3300013297 Unclassified 3211
173 Ga0157378_10087735 3300013297 Bacteria 2822
174 Ga0157378_10960180 3300013297 Bacteria 888
175 Ga0163162_10031587 3300013306 Bacteria 5253
176 Ga0163162_10063592 3300013306 Bacteria 3734
177 Ga0157375_10009449 3300013308 Bacteria 8561
178 Ga0157375_10279789 3300013308 Bacteria 1832
179 Ga0157375_10380779 3300013308 Bacteria 1578
180 Ga0163163_10089124 3300014325 Bacteria 3097
181 Ga0163163_10135798 3300014325 Bacteria 2501
182 Ga0163163_10206012 3300014325 Bacteria 2015
183 Ga0157380_10231147 3300014326 Bacteria 1661
184 Ga0157380_10358414 3300014326 Unclassified 1367
185 Ga0157377_10001281 3300014745 Bacteria 10769
186 Ga0157377_10080409 3300014745 Bacteria 1904
187 Ga0157377_10165442 3300014745 Bacteria 1379
188 Ga0157377_10311852 3300014745 Bacteria 1042
189 Ga0157377_10365791 3300014745 Bacteria 972
190 Ga0157377_10911418 3300014745 Bacteria 658
191 Ga0157379_10026068 3300014968 Bacteria 5201
192 Ga0157379_10341537 3300014968 Bacteria 1369
193 Ga0157379_11083773 3300014968 Bacteria 767
194 Ga0157379_11195332 3300014968 Unclassified 731
195 Ga0157376_10238757 3300014969 Bacteria 1692
196 Ga0207688_10016535 3300025901 Bacteria 4002
197 Ga0207688_10134861 3300025901 Bacteria 1449
198 Ga0207680_10313546 3300025903 Unclassified 1095
199 Ga0207680_10412097 3300025903 Bacteria 956
200 Ga0207645_10102211 3300025907 Bacteria 1850
201 Ga0207643_10008132 3300025908 Bacteria 5628
202 Ga0207684_10005293 3300025910 Bacteria 11964
203 Ga0207684_10026002 3300025910 Bacteria 4989
204 Ga0207684_10287778 3300025910 Unclassified 1417
205 Ga0207684_10300626 3300025910 Bacteria 1384
206 Ga0207663_10904771 3300025916 Bacteria 706
207 Ga0207660_10000001 3300025917 Bacteria 1034169
208 Ga0207660_10545124 3300025917 Unclassified 943
209 Ga0207660_11085018 3300025917 Bacteria 652
210 Ga0207662_10006928 3300025918 Bacteria 6146
211 Ga0207662_10093515 3300025918 Bacteria 1853
212 Ga0207657_10051432 3300025919 Unclassified 3581
213 Ga0207649_10039133 3300025920 Unclassified 2873
214 Ga0207652_10186606 3300025921 Bacteria 1865
215 Ga0207652_11194298 3300025921 Bacteria 662
216 Ga0207646_10004384 3300025922 Bacteria 15362
217 Ga0207646_10007900 3300025922 Bacteria 10738
218 Ga0207646_10008075 3300025922 Bacteria 10611
219 Ga0207646_10009882 3300025922 Bacteria 9386
220 Ga0207646_10026215 3300025922 Bacteria 5321
221 Ga0207646_10038181 3300025922 Bacteria 4327
222 Ga0207646_10048627 3300025922 Bacteria 3802
223 Ga0207646_10084381 3300025922 Unclassified 2842
224 Ga0207646_10129008 3300025922 Bacteria 2275
225 Ga0207646_10849501 3300025922 Bacteria 811
226 Ga0207681_10299133 3300025923 Unclassified 1273
227 Ga0207659_10047938 3300025926 Unclassified 3024
228 Ga0207659_10083597 3300025926 Bacteria 2367
229 Ga0207659_10745235 3300025926 Bacteria 840
230 Ga0207690_10067126 3300025932 Unclassified 2459
231 Ga0207686_10017711 3300025934 Unclassified 4018
232 Ga0207709_10314103 3300025935 Unclassified 1170
233 Ga0207670_10231174 3300025936 Unclassified 1420
234 Ga0207669_10315478 3300025937 Unclassified 1194
235 Ga0207665_10401036 3300025939 Unclassified 1044
236 Ga0207711_10560113 3300025941 Bacteria 1066
237 Ga0207711_10903857 3300025941 Bacteria 821
238 Ga0207689_10116537 3300025942 Unclassified 2196
239 Ga0207689_10173237 3300025942 Bacteria 1779
240 Ga0207661_10369923 3300025944 Bacteria 1296
241 Ga0207679_10135208 3300025945 Bacteria 1984
242 Ga0207679_10220733 3300025945 Bacteria 1595
243 Ga0207679_10771102 3300025945 Bacteria 876
244 Ga0207679_11092229 3300025945 Bacteria 732
245 Ga0207667_10812966 3300025949 Bacteria 931
246 Ga0207712_10105767 3300025961 Unclassified 2101
247 Ga0207640_10166106 3300025981 Unclassified 1639
248 Ga0207640_11012207 3300025981 Bacteria 731
249 Ga0207677_10143282 3300026023 Bacteria 1833
250 Ga0207677_10386724 3300026023 Bacteria 1182
251 Ga0207677_10468917 3300026023 Unclassified 1082
252 Ga0207677_10544288 3300026023 Bacteria 1011
253 Ga0207703_10104524 3300026035 Unclassified 2406
254 Ga0207703_10215974 3300026035 Bacteria 1712
255 Ga0207703_10405687 3300026035 Bacteria 1265
256 Ga0207708_10002298 3300026075 Bacteria 14056
257 Ga0207708_10272258 3300026075 Bacteria 1370
258 Ga0207702_10158689 3300026078 Bacteria 2064
259 Ga0207648_10011437 3300026089 Bacteria 8359
260 Ga0207676_10048787 3300026095 Bacteria 3289
261 Ga0207676_10622850 3300026095 Bacteria 1039
262 Ga0207674_10224073 3300026116 Bacteria 1829
263 Ga0207674_10368960 3300026116 Bacteria 1388
264 Ga0207674_10533569 3300026116 Bacteria 1134
265 Ga0207675_100136532 3300026118 Bacteria 2327
266 Ga0207675_101044801 3300026118 Bacteria 836
267 Ga0207683_10193895 3300026121 Bacteria 1845
268 Ga0207698_10479747 3300026142 Bacteria 1206
269 Ga0209983_1030049 3300027665 Bacteria 1156
270 Ga0209974_10021911 3300027876 Unclassified 2115
271 Ga0207428_10268764 3300027907 Bacteria 1268
272 Ga0268264_11650479 3300028381 Bacteria 651
273 Ga0307408_100149747 3300031548 Bacteria 1841
274 Ga0316576_10015876 3300031727 Bacteria 5068
275 Ga0307405_10436162 3300031731 Bacteria 1035
276 Ga0307413_10372220 3300031824 Bacteria 1110
277 Ga0307409_100763301 3300031995 Bacteria 972
278 Ga0307414_11064186 3300032004 Bacteria 746
279 Ga0307411_10312090 3300032005 Bacteria 1266
280 Ga0307415_100771706 3300032126 Unclassified 875
281 Ga0307510_10166807 3300033180 Bacteria 1788
282 Ga0373960_0127023 3300035121 Bacteria 852
283 Ga0373935_0161002 3300035692 Unclassified 1530
284 Ga0373947_0710023 3300035725 Bacteria 686
285 Ga0316582_0532038 3300036647 Bacteria 810
286 Ga0373925_0528954 3300037068 Bacteria 969
287 Ga0395905_1175250 3300037471 Bacteria 671
288 Ga0436365_1014753 3300039437 Bacteria 1292
289 Ga0439466_0134482 3300041411 Bacteria 760
290 Ga0439465_0063385 3300041413 Bacteria 1228
291 Ga0451849_1019919 3300041505 Bacteria 904
292 Ga0439441_011331 3300042001 Bacteria 1511
293 Ga0450920_019040 3300042122 Bacteria 1317
294 Ga0439446_0104160 3300042156 Bacteria 900
295 Ga0451577_0633070 3300042876 Unclassified 970
296 Ga0453684_1411839 3300044712 Unclassified 722
297 Ga0495603_0278809 3300046455 Bacteria 961
298 Ga0495629_0500106 3300046459 Bacteria 820
299 Ga0495641_0249967 3300046461 Bacteria 797
300 Ga0495653_0065951 3300046463 Bacteria 2724
301 Ga0495582_0201035 3300046473 Unclassified 1138
302 Ga0495607_0296822 3300046501 Unclassified 762
303 Ga0495608_0531228 3300046511 Bacteria 710
304 Ga0495618_0053289 3300046514 Bacteria 2558
305 Ga0495586_0431968 3300046535 Bacteria 759
306 Ga0495587_0074747 3300046536 Bacteria 1968
307 Ga0495634_0082120 3300046642 Bacteria 2107
308 Ga0495604_0242690 3300047317 Bacteria 1231
309 Ga0495674_0082039 3300047319 Bacteria 2765
310 Ga0495676_0373496 3300047321 Unclassified 950
311 Ga0495676_0633384 3300047321 Bacteria 695
312 Ga0495680_0079805 3300047322 Bacteria 2474
313 Ga0495684_0370998 3300047471 Bacteria 1011
314 Ga0495602_0457465 3300048088 Bacteria 900
315 Ga0496100_0097622 3300048903 Bacteria 2018
316 Ga0496101_0017466 3300048904 Bacteria 4867
317 Ga0496101_0250539 3300048904 Unclassified 1380
318 Ga0496102_0160072 3300048905 Bacteria 2117
319 Ga0496102_0288978 3300048905 Bacteria 1545
320 Ga0496103_0124074 3300048906 Unclassified 1646
321 Ga0496104_0010068 3300048907 Bacteria 8439
322 Ga0496104_0028357 3300048907 Bacteria 5189
323 Ga0496104_0100633 3300048907 Bacteria 2767
324 Ga0496104_0122496 3300048907 Bacteria 2496
325 Ga0496104_0680795 3300048907 Bacteria 937
326 Ga0496105_0006969 3300048908 Bacteria 8708
327 Ga0496105_0081356 3300048908 Bacteria 2675
328 Ga0496105_0491742 3300048908 Bacteria 964
329 Ga0496106_0118589 3300048909 Bacteria 2067
330 Ga0496106_0242855 3300048909 Bacteria 1439
331 Ga0496106_0460453 3300048909 Unclassified 1022
332 Ga0496107_0086783 3300048910 Bacteria 2284
333 Ga0496107_0170475 3300048910 Bacteria 1615
334 Ga0496107_0272107 3300048910 Bacteria 1261
335 Ga0496107_0491464 3300048910 Bacteria 910
336 Ga0496108_0005939 3300048911 Bacteria 9889
337 Ga0496108_0083635 3300048911 Unclassified 2707
338 Ga0496108_0154172 3300048911 Bacteria 1983
339 Ga0496109_0009280 3300048912 Bacteria 8381
340 Ga0496109_0067794 3300048912 Bacteria 3269
341 Ga0496109_0121645 3300048912 Bacteria 2432
342 Ga0496109_0133528 3300048912 Bacteria 2318
343 Ga0496109_0380129 3300048912 Bacteria 1334
344 Ga0496110_0024139 3300048913 Bacteria 5179
345 Ga0496110_0058585 3300048913 Bacteria 3392
346 Ga0496110_0251807 3300048913 Unclassified 1607
347 Ga0496110_0509823 3300048913 Bacteria 1095
348 Ga0496110_0731217 3300048913 Bacteria 892
349 Ga0496111_0010763 3300048914 Bacteria 6150
350 Ga0496111_0019748 3300048914 Bacteria 4686
351 Ga0496111_0232525 3300048914 Bacteria 1369
352 Ga0496112_0000069 3300048915 Bacteria 68177
353 Ga0496112_0006768 3300048915 Bacteria 10100
354 Ga0496112_0030260 3300048915 Bacteria 5238
355 Ga0496112_0086810 3300048915 Bacteria 3095
356 Ga0496112_0126191 3300048915 Bacteria 2530
357 Ga0496112_0273259 3300048915 Bacteria 1638
358 Ga0496113_0022293 3300048916 Bacteria 4477
359 Ga0496113_0055711 3300048916 Bacteria 2965
360 Ga0496113_0246198 3300048916 Bacteria 1427
361 Ga0496113_0272019 3300048916 Bacteria 1354
362 Ga0496113_0575868 3300048916 Bacteria 902
363 Ga0496114_0002654 3300048917 Bacteria 13645
364 Ga0496114_0131691 3300048917 Unclassified 2160
365 Ga0496114_0502361 3300048917 Bacteria 1073
366 Ga0496117_0422115 3300048920 Bacteria 667
367 Ga0501031_0002165 3300049568 Bacteria 12399
368 Ga0501032_0035575 3300049569 Bacteria 3404
369 Ga0501033_0554573 3300049570 Unclassified 791
370 Ga0501034_0095188 3300049571 Bacteria 2975
371 Ga0501036_0002502 3300049572 Bacteria 14415
372 Ga0501036_0005075 3300049572 Bacteria 10655
373 Ga0501036_0160917 3300049572 Bacteria 1893
374 Ga0501037_0030738 3300049573 Bacteria 3967
375 Ga0501038_0001735 3300049574 Bacteria 20278
376 Ga0501038_0182225 3300049574 Unclassified 1694
377 Ga0501038_0208795 3300049574 Bacteria 1563
378 Ga0501038_0361639 3300049574 Unclassified 1128
379 Ga0501039_0001299 3300049575 Bacteria 18249
380 Ga0501039_0352625 3300049575 Bacteria 1156
381 Ga0501039_0778181 3300049575 Bacteria 747
382 Ga0501040_0000326 3300049576 Bacteria 27922
383 Ga0501040_0053508 3300049576 Bacteria 2765
384 Ga0501040_0072012 3300049576 Unclassified 2387
385 Ga0501040_0123858 3300049576 Unclassified 1815
386 Ga0501040_0297828 3300049576 Bacteria 1153
387 Ga0501041_0003115 3300049577 Bacteria 9537
388 Ga0501041_0563060 3300049577 Bacteria 727
389 Ga0501042_0000230 3300049578 Bacteria 26959
390 Ga0501042_0015787 3300049578 Bacteria 5175
391 Ga0501042_0110141 3300049578 Unclassified 1983
392 Ga0501042_0565669 3300049578 Bacteria 826
393 Ga0501043_0055842 3300049579 Bacteria 3102
394 Ga0501046_0007260 3300049580 Bacteria 9744
395 Ga0501046_0326285 3300049580 Unclassified 1118
396 Ga0501048_0003596 3300049582 Bacteria 11806
397 Ga0501048_0259566 3300049582 Unclassified 1234
398 Ga0501067_0008487 3300049583 Bacteria 5696
399 Ga0501067_0325661 3300049583 Bacteria 856
400 Ga0501067_0510249 3300049583 Bacteria 673
401 Ga0501068_0118122 3300049584 Bacteria 1652
402 Ga0501068_0410865 3300049584 Bacteria 873
403 Ga0501068_0499117 3300049584 Bacteria 789
404 Ga0501069_0017032 3300049585 Bacteria 3907
405 Ga0501069_0058811 3300049585 Bacteria 2144
406 Ga0501069_0281918 3300049585 Bacteria 972
407 Ga0501069_0425179 3300049585 Bacteria 788
408 Ga0501070_0032732 3300049586 Bacteria 4350
409 Ga0501070_0095327 3300049586 Bacteria 2462
410 Ga0501071_0002472 3300049587 Bacteria 11227
411 Ga0501071_0003239 3300049587 Bacteria 10151
412 Ga0501071_0421984 3300049587 Unclassified 1019
413 Ga0501071_0463705 3300049587 Unclassified 970
414 Ga0501071_0502181 3300049587 Bacteria 930
415 Ga0501071_0792405 3300049587 Bacteria 730
416 Ga0501072_0001029 3300049588 Bacteria 20677
417 Ga0501072_0007464 3300049588 Bacteria 8296
418 Ga0501072_0008413 3300049588 Bacteria 7830
419 Ga0501072_0113481 3300049588 Unclassified 2157
420 Ga0501072_0502938 3300049588 Bacteria 958
421 Ga0501072_0759619 3300049588 Bacteria 760
422 Ga0501073_0211442 3300049589 Bacteria 1340
423 Ga0501074_0000129 3300049590 Bacteria 38737
424 Ga0501074_0036316 3300049590 Bacteria 3570
425 Ga0501074_0056226 3300049590 Bacteria 2836
426 Ga0501074_0412453 3300049590 Bacteria 958
427 Ga0501075_0000773 3300049591 Bacteria 19967
428 Ga0501075_0001851 3300049591 Bacteria 13970
429 Ga0501075_0041406 3300049591 Bacteria 3452
430 Ga0501075_0076066 3300049591 Bacteria 2539
431 Ga0501075_0314272 3300049591 Bacteria 1194
432 Ga0501076_0000560 3300049592 Bacteria 23710
433 Ga0501076_0004417 3300049592 Bacteria 9995
434 Ga0501076_0005365 3300049592 Bacteria 9207
435 Ga0501076_0039110 3300049592 Bacteria 3724
436 Ga0501076_0144582 3300049592 Bacteria 1933
437 Ga0501076_0519692 3300049592 Bacteria 981
438 Ga0501076_0591920 3300049592 Bacteria 915
439 Ga0501077_0002458 3300049593 Bacteria 11099
440 Ga0501077_0080149 3300049593 Unclassified 2069
441 Ga0501077_0116153 3300049593 Bacteria 1696
442 Ga0501077_0287399 3300049593 Bacteria 1047
443 Ga0501079_0003396 3300049741 Bacteria 11682
444 Ga0501079_0128414 3300049741 Unclassified 1972
445 Ga0501079_0200168 3300049741 Unclassified 1560
446 Ga0501080_0000672 3300049742 Bacteria 27233
447 Ga0501080_0004618 3300049742 Bacteria 12269
448 Ga0501080_0144781 3300049742 Bacteria 2197
449 Ga0501080_0241678 3300049742 Unclassified 1648
450 Ga0501080_0612691 3300049742 Unclassified 966
451 Ga0501081_0010471 3300049743 Bacteria 6050
452 Ga0501081_0026558 3300049743 Bacteria 3905
453 Ga0501081_0276534 3300049743 Bacteria 1229
454 Ga0501081_0301178 3300049743 Bacteria 1176
455 Ga0501081_0502995 3300049743 Bacteria 903
456 Ga0501083_0005743 3300049744 Bacteria 8782
457 Ga0501083_0168737 3300049744 Bacteria 1431
458 Ga0501035_0048921 3300049822 Bacteria 3790
459 Ga0501035_0092273 3300049822 Unclassified 2665
460 Ga0501044_0214574 3300049823 Bacteria 1877
461 Ga0501044_0867489 3300049823 Unclassified 779
462 Ga0501045_0000742 3300049824 Bacteria 20832
463 Ga0501045_0053149 3300049824 Unclassified 2960
464 Ga0501045_0055258 3300049824 Bacteria 2903
465 Ga0501045_0149077 3300049824 Bacteria 1740
466 Ga0501045_0589171 3300049824 Bacteria 824
467 nmdc:mga0yw44_802478_c1 3300050492 Bacteria 639
468 nmdc:mga05p37_1099609_c1 3300050507 Bacteria 832
469 nmdc:mga05p37_193490_c1 3300050507 Bacteria 2468
470 nmdc:mga05p37_299682_c1 3300050507 Bacteria 1910
471 nmdc:mga05p37_604876_c1 3300050507 Bacteria 1237
472 nmdc:mga05p37_6666_c1 3300050507 Bacteria 13619
473 nmdc:mga09592_7232_c1 3300050508 Bacteria 9019
474 nmdc:mga0qj67_20695_c1 3300050509 Bacteria 5039
475 nmdc:mga0qj67_552081_c1 3300050509 Bacteria 924
476 nmdc:mga06r32_13558_c1 3300050510 Bacteria 7387
477 nmdc:mga08y16_603379_c1 3300050511 Bacteria 1106
478 nmdc:mga08y16_982148_c1 3300050511 Bacteria 825
479 nmdc:mga0n895_163796_c1 3300050512 Bacteria 2255
480 nmdc:mga0n895_432216_c1 3300050512 Unclassified 1330
481 nmdc:mga0n895_604045_c1 3300050512 Bacteria 1099
482 nmdc:mga0n895_936262_c1 3300050512 Unclassified 850
483 nmdc:mga0rr50_441201_c1 3300050513 Unclassified 1103
484 nmdc:mga0a205_190229_c1 3300050515 Bacteria 1945
485 nmdc:mga0a205_286053_c1 3300050515 Unclassified 1524
486 nmdc:mga0a205_51822_c1 3300050515 Bacteria 3962
487 nmdc:mga0a205_527147_c1 3300050515 Bacteria 1037
488 nmdc:mga0a205_8792_c2 3300050515 Bacteria 5054
489 Ga0495601_0018109 3300053077 Bacteria 4283
490 Ga0495601_0112151 3300053077 Bacteria 1766
491 Ga0495612_0015473 3300053078 Bacteria 3059
492 Ga0495619_0020367 3300053085 Bacteria 4223
493 Ga0500562_008928 3300053108 Bacteria 2532
494 Ga0501084_0002553 3300054114 Bacteria 14666
495 Ga0501084_0012965 3300054114 Bacteria 6903
496 Ga0501084_0233046 3300054114 Unclassified 1554
497 Ga0501084_0314340 3300054114 Bacteria 1323
498 Ga0590071_014033 3300059421 Bacteria 1878
499 Ga0590071_022944 3300059421 Bacteria 1473
500 Ga0590074_009005 3300059423 Bacteria 1663
501 Ga0590075_012721 3300059424 Unclassified 2046
502 Ga0590077_014118 3300059426 Unclassified 1662
503 Ga0501082_0001091 3300060353 Bacteria 24037
504 Ga0501082_0067350 3300060353 Unclassified 3083
505 Ga0530510_0000448 3300061734 Bacteria 26668
506 Ga0530510_0019512 3300061734 Bacteria 4813
507 Ga0530510_0036742 3300061734 Unclassified 3530
508 Ga0530510_0062491 3300061734 Bacteria 2696
509 Ga0530510_0104260 3300061734 Bacteria 2075
510 Ga0530510_0147884 3300061734 Bacteria 1733
511 Ga0530510_0303118 3300061734 Bacteria 1196
512 2644167108 2643221629 Bacteria 5850260
513 2644349619 2643221662 Bacteria 5851492
514 2723641030 2721755702 Bacteria 4373124
515 2935410452 2935409751 Bacteria 4179611
516 3006395613 3006393351 Bacteria 6615579
517 Ga0496109_0420174
518 rootH1_10101548
519 rootH2_10189904
520 rootL2_10138112
521 rootH1_10256490
522 Ga0065707_10107585
523 Ga0070676_10035556
524 Ga0070683_100695387
525 Ga0070690_100105774
526 Ga0068869_100312861
527 Ga0070666_10227729
528 Ga0070680_100000008
529 Ga0070680_100458639
530 Ga0068868_100178273
531 Ga0070660_100082293
532 Ga0070689_100020660
533 Ga0070687_100042727
534 Ga0070687_100069693
535 Ga0070692_10002332
536 Ga0070668_100321107
537 Ga0070675_100080032
538 Ga0070675_100138771
539 Ga0070671_100254038
540 Ga0070674_100013375
541 Ga0070674_100223768
542 Ga0070659_100132796
543 Ga0070659_100271661
544 Ga0070705_100048020
545 Ga0070700_100018205
546 Ga0070694_100035993
547 Ga0070694_100081040
548 Ga0070694_100668233
549 Ga0070708_100000850
550 Ga0070708_100009613
551 Ga0070708_100091604
552 Ga0070708_100148642
553 Ga0070708_100193783
554 Ga0070708_100247970
555 Ga0070708_100563953
556 Ga0070678_100096870
557 Ga0070678_100116325
558 Ga0070662_100024849
559 Ga0070681_10099609
560 Ga0068867_101128637
561 Ga0070685_10054311
562 Ga0070685_10414336
563 Ga0070706_100010360
564 Ga0070706_100011227
565 Ga0070706_100049622
566 Ga0070706_100070342
567 Ga0070706_100098865
568 Ga0070706_100368329
569 Ga0070707_100001121
570 Ga0070707_100004788
571 Ga0070707_100005272
572 Ga0070707_100009237
573 Ga0070707_100023134
574 Ga0070707_100083769
575 Ga0070707_100104003
576 Ga0070707_100237552
577 Ga0070707_100470771
578 Ga0070698_100038564
579 Ga0070698_100047642
580 Ga0070698_100098591
581 Ga0070698_100117610
582 Ga0070698_100213439
583 Ga0070698_100347005
584 Ga0070699_100022475
585 Ga0070699_100057239
586 Ga0070699_100187305
587 Ga0070699_100251963
588 Ga0070679_100053994
589 Ga0070679_100721215
590 Ga0070684_100058757
591 Ga0070697_100006267
592 Ga0070697_100019865
593 Ga0070697_100092511
594 Ga0070697_100320606
595 Ga0070697_100927968
596 Ga0068853_101196161
597 Ga0070686_100025150
598 Ga0070686_100216641
599 Ga0070686_100388219
600 Ga0070695_100034940
601 Ga0070695_100225378
602 Ga0070695_100229809
603 Ga0070696_100006701
604 Ga0070696_100027828
605 Ga0070696_100138130
606 Ga0070693_100016753
607 Ga0070693_100720972
608 Ga0070704_100024596
609 Ga0070704_100051679
610 Ga0068855_100876297
611 Ga0070664_100231768
612 Ga0070664_100607047
613 Ga0070664_100859008
614 Ga0068857_100431627
615 Ga0068857_100493322
616 Ga0068854_100334675
617 Ga0068856_100143784
618 Ga0068856_101471217
619 Ga0070702_100002044
620 Ga0070702_100235477
621 Ga0068864_100009827
622 Ga0068864_100429043
623 Ga0068861_100397462
624 Ga0068851_10111754
625 Ga0068870_10018561
626 Ga0068858_100241603
627 Ga0068858_100277975
628 Ga0068860_100026480
629 Ga0068860_100049435
630 Ga0068860_100958193
631 Ga0068862_100608148
632 Ga0081538_10135918
633 Ga0081539_10007974
634 Ga0097621_100205736
635 Ga0068871_100081466
636 Ga0075428_100000179
637 Ga0075428_100026694
638 Ga0075428_100066419
639 Ga0075428_100111223
640 Ga0075428_100480986
641 Ga0075428_101754162
642 Ga0075430_100011058
643 Ga0075430_100122424
644 Ga0075433_10027975
645 Ga0075433_10095348
646 Ga0075433_10149617
647 Ga0075433_10186478
648 Ga0075433_10401700
649 Ga0075433_10453020
650 Ga0075433_10492236
651 Ga0075434_100123700
652 Ga0075434_100475401
653 Ga0075429_100003086
654 Ga0068865_100005205
655 Ga0075435_100410347
656 Ga0075435_100416542
657 Ga0105244_10087922
658 Ga0111539_10007016
659 Ga0111539_10085538
660 Ga0111539_10499728
661 Ga0111539_10651760
662 Ga0105245_10026760
663 Ga0105245_10083060
664 Ga0105245_10119906
665 Ga0105245_10698164
666 Ga0114129_10008152
667 Ga0114129_10337934
668 Ga0114129_10472342
669 Ga0114129_10554598
670 Ga0114129_10631879
671 Ga0114129_10928679
672 Ga0105243_10011398
673 Ga0105243_10908762
674 Ga0105241_10157925
675 Ga0105248_10022352
676 Ga0105248_10262790
677 Ga0105248_10295531
678 Ga0105248_10344922
679 Ga0105249_10008942
680 Ga0105249_10013362
681 Ga0105249_10276446
682 Ga0105239_10007492
683 Ga0105246_10006263
684 Ga0105246_10120809
685 Ga0105246_10790251
686 Ga0105246_11100851
687 Ga0157374_10278444
688 Ga0157378_10067238
689 Ga0157378_10087735
690 Ga0157378_10960180
691 Ga0163162_10031587
692 Ga0163162_10063592
693 Ga0157375_10009449
694 Ga0157375_10279789
695 Ga0157375_10380779
696 Ga0163163_10089124
697 Ga0163163_10135798
698 Ga0163163_10206012
699 Ga0157380_10231147
700 Ga0157380_10358414
701 Ga0157377_10001281
702 Ga0157377_10080409
703 Ga0157377_10165442
704 Ga0157377_10311852
705 Ga0157377_10365791
706 Ga0157377_10911418
707 Ga0157379_10026068
708 Ga0157379_10341537
709 Ga0157379_11083773
710 Ga0157379_11195332
711 Ga0157376_10238757
712 Ga0207688_10016535
713 Ga0207688_10134861
714 Ga0207680_10313546
715 Ga0207680_10412097
716 Ga0207645_10102211
717 Ga0207643_10008132
718 Ga0207684_10005293
719 Ga0207684_10026002
720 Ga0207684_10287778
721 Ga0207684_10300626
722 Ga0207663_10904771
723 Ga0207660_10000001
724 Ga0207660_10545124
725 Ga0207660_11085018
726 Ga0207662_10006928
727 Ga0207662_10093515
728 Ga0207657_10051432
729 Ga0207649_10039133
730 Ga0207652_10186606
731 Ga0207652_11194298
732 Ga0207646_10004384
733 Ga0207646_10007900
734 Ga0207646_10008075
735 Ga0207646_10009882
736 Ga0207646_10026215
737 Ga0207646_10038181
738 Ga0207646_10048627
739 Ga0207646_10084381
740 Ga0207646_10129008
741 Ga0207646_10849501
742 Ga0207681_10299133
743 Ga0207659_10047938
744 Ga0207659_10083597
745 Ga0207659_10745235
746 Ga0207690_10067126
747 Ga0207686_10017711
748 Ga0207709_10314103
749 Ga0207670_10231174
750 Ga0207669_10315478
751 Ga0207665_10401036
752 Ga0207711_10560113
753 Ga0207711_10903857
754 Ga0207689_10116537
755 Ga0207689_10173237
756 Ga0207661_10369923
757 Ga0207679_10135208
758 Ga0207679_10220733
759 Ga0207679_10771102
760 Ga0207679_11092229
761 Ga0207667_10812966
762 Ga0207712_10105767
763 Ga0207640_10166106
764 Ga0207640_11012207
765 Ga0207677_10143282
766 Ga0207677_10386724
767 Ga0207677_10468917
768 Ga0207677_10544288
769 Ga0207703_10104524
770 Ga0207703_10215974
771 Ga0207703_10405687
772 Ga0207708_10002298
773 Ga0207708_10272258
774 Ga0207702_10158689
775 Ga0207648_10011437
776 Ga0207676_10048787
777 Ga0207676_10622850
778 Ga0207674_10224073
779 Ga0207674_10368960
780 Ga0207674_10533569
781 Ga0207675_100136532
782 Ga0207675_101044801
783 Ga0207683_10193895
784 Ga0207698_10479747
785 Ga0209983_1030049
786 Ga0209974_10021911
787 Ga0207428_10268764
788 Ga0268264_11650479
789 Ga0307408_100149747
790 Ga0316576_10015876
791 Ga0307405_10436162
792 Ga0307413_10372220
793 Ga0307409_100763301
794 Ga0307414_11064186
795 Ga0307411_10312090
796 Ga0307415_100771706
797 Ga0307510_10166807
798 Ga0373960_0127023
799 Ga0373935_0161002
800 Ga0373947_0710023
801 Ga0316582_0532038
802 Ga0373925_0528954
803 Ga0395905_1175250
804 Ga0436365_1014753
805 Ga0439466_0134482
806 Ga0439465_0063385
807 Ga0451849_1019919
808 Ga0439441_011331
809 Ga0450920_019040
810 Ga0439446_0104160
811 Ga0451577_0633070
812 Ga0453684_1411839
813 Ga0495603_0278809
814 Ga0495629_0500106
815 Ga0495641_0249967
816 Ga0495653_0065951
817 Ga0495582_0201035
818 Ga0495607_0296822
819 Ga0495608_0531228
820 Ga0495618_0053289
821 Ga0495586_0431968
822 Ga0495587_0074747
823 Ga0495634_0082120
824 Ga0495604_0242690
825 Ga0495674_0082039
826 Ga0495676_0373496
827 Ga0495676_0633384
828 Ga0495680_0079805
829 Ga0495684_0370998
830 Ga0495602_0457465
831 Ga0496100_0097622
832 Ga0496101_0017466
833 Ga0496101_0250539
834 Ga0496102_0160072
835 Ga0496102_0288978
836 Ga0496103_0124074
837 Ga0496104_0010068
838 Ga0496104_0028357
839 Ga0496104_0100633
840 Ga0496104_0122496
841 Ga0496104_0680795
842 Ga0496105_0006969
843 Ga0496105_0081356
844 Ga0496105_0491742
845 Ga0496106_0118589
846 Ga0496106_0242855
847 Ga0496106_0460453
848 Ga0496107_0086783
849 Ga0496107_0170475
850 Ga0496107_0272107
851 Ga0496107_0491464
852 Ga0496108_0005939
853 Ga0496108_0083635
854 Ga0496108_0154172
855 Ga0496109_0009280
856 Ga0496109_0067794
857 Ga0496109_0121645
858 Ga0496109_0133528
859 Ga0496109_0380129
860 Ga0496110_0024139
861 Ga0496110_0058585
862 Ga0496110_0251807
863 Ga0496110_0509823
864 Ga0496110_0731217
865 Ga0496111_0010763
866 Ga0496111_0019748
867 Ga0496111_0232525
868 Ga0496112_0000069
869 Ga0496112_0006768
870 Ga0496112_0030260
871 Ga0496112_0086810
872 Ga0496112_0126191
873 Ga0496112_0273259
874 Ga0496113_0022293
875 Ga0496113_0055711
876 Ga0496113_0246198
877 Ga0496113_0272019
878 Ga0496113_0575868
879 Ga0496114_0002654
880 Ga0496114_0131691
881 Ga0496114_0502361
882 Ga0496117_0422115
883 Ga0501031_0002165
884 Ga0501032_0035575
885 Ga0501033_0554573
886 Ga0501034_0095188
887 Ga0501036_0002502
888 Ga0501036_0005075
889 Ga0501036_0160917
890 Ga0501037_0030738
891 Ga0501038_0001735
892 Ga0501038_0182225
893 Ga0501038_0208795
894 Ga0501038_0361639
895 Ga0501039_0001299
896 Ga0501039_0352625
897 Ga0501039_0778181
898 Ga0501040_0000326
899 Ga0501040_0053508
900 Ga0501040_0072012
901 Ga0501040_0123858
902 Ga0501040_0297828
903 Ga0501041_0003115
904 Ga0501041_0563060
905 Ga0501042_0000230
906 Ga0501042_0015787
907 Ga0501042_0110141
908 Ga0501042_0565669
909 Ga0501043_0055842
910 Ga0501046_0007260
911 Ga0501046_0326285
912 Ga0501048_0003596
913 Ga0501048_0259566
914 Ga0501067_0008487
915 Ga0501067_0325661
916 Ga0501067_0510249
917 Ga0501068_0118122
918 Ga0501068_0410865
919 Ga0501068_0499117
920 Ga0501069_0017032
921 Ga0501069_0058811
922 Ga0501069_0281918
923 Ga0501069_0425179
924 Ga0501070_0032732
925 Ga0501070_0095327
926 Ga0501071_0002472
927 Ga0501071_0003239
928 Ga0501071_0421984
929 Ga0501071_0463705
930 Ga0501071_0502181
931 Ga0501071_0792405
932 Ga0501072_0001029
933 Ga0501072_0007464
934 Ga0501072_0008413
935 Ga0501072_0113481
936 Ga0501072_0502938
937 Ga0501072_0759619
938 Ga0501073_0211442
939 Ga0501074_0000129
940 Ga0501074_0036316
941 Ga0501074_0056226
942 Ga0501074_0412453
943 Ga0501075_0000773
944 Ga0501075_0001851
945 Ga0501075_0041406
946 Ga0501075_0076066
947 Ga0501075_0314272
948 Ga0501076_0000560
949 Ga0501076_0004417
950 Ga0501076_0005365
951 Ga0501076_0039110
952 Ga0501076_0144582
953 Ga0501076_0519692
954 Ga0501076_0591920
955 Ga0501077_0002458
956 Ga0501077_0080149
957 Ga0501077_0116153
958 Ga0501077_0287399
959 Ga0501079_0003396
960 Ga0501079_0128414
961 Ga0501079_0200168
962 Ga0501080_0000672
963 Ga0501080_0004618
964 Ga0501080_0144781
965 Ga0501080_0241678
966 Ga0501080_0612691
967 Ga0501081_0010471
968 Ga0501081_0026558
969 Ga0501081_0276534
970 Ga0501081_0301178
971 Ga0501081_0502995
972 Ga0501083_0005743
973 Ga0501083_0168737
974 Ga0501035_0048921
975 Ga0501035_0092273
976 Ga0501044_0214574
977 Ga0501044_0867489
978 Ga0501045_0000742
979 Ga0501045_0053149
980 Ga0501045_0055258
981 Ga0501045_0149077
982 Ga0501045_0589171
983 nmdc:mga0yw44_802478_c1
984 nmdc:mga05p37_1099609_c1
985 nmdc:mga05p37_193490_c1
986 nmdc:mga05p37_299682_c1
987 nmdc:mga05p37_604876_c1
988 nmdc:mga05p37_6666_c1
989 nmdc:mga09592_7232_c1
990 nmdc:mga0qj67_20695_c1
991 nmdc:mga0qj67_552081_c1
992 nmdc:mga06r32_13558_c1
993 nmdc:mga08y16_603379_c1
994 nmdc:mga08y16_982148_c1
995 nmdc:mga0n895_163796_c1
996 nmdc:mga0n895_432216_c1
997 nmdc:mga0n895_604045_c1
998 nmdc:mga0n895_936262_c1
999 nmdc:mga0rr50_441201_c1
1000 nmdc:mga0a205_190229_c1
1001 nmdc:mga0a205_286053_c1
1002 nmdc:mga0a205_51822_c1
1003 nmdc:mga0a205_527147_c1
1004 nmdc:mga0a205_8792_c2
1005 Ga0495601_0018109
1006 Ga0495601_0112151
1007 Ga0495612_0015473
1008 Ga0495619_0020367
1009 Ga0500562_008928
1010 Ga0501084_0002553
1011 Ga0501084_0012965
1012 Ga0501084_0233046
1013 Ga0501084_0314340
1014 Ga0590071_014033
1015 Ga0590071_022944
1016 Ga0590074_009005
1017 Ga0590075_012721
1018 Ga0590077_014118
1019 Ga0501082_0001091
1020 Ga0501082_0067350
1021 Ga0530510_0000448
1022 Ga0530510_0019512
1023 Ga0530510_0036742
1024 Ga0530510_0062491
1025 Ga0530510_0104260
1026 Ga0530510_0147884
1027 Ga0530510_0303118
1028 2644167108
1029 2644349619
1030 2723641030
1031 2935410452
1032 3006395613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

37

222

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8309 2 189
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8197 1 191
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8155 2 191
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8153 1 191
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8137 2 189
ID Description Score Start End Superfamily
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8186 3 189 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8056 3 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8052 1 188 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.801 1 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8006 1 188 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A561V8S8-F1-model_v4 Dihydrofolate reductase 0.9766 1 201 GO:0008703
GO:0009231
AF-A0A561V8S8-F1-model_v4 Dihydrofolate reductase 0.9718 1 201 GO:0008703
GO:0009231
AF-A0A1S6J4V2-F1-model_v4 Deaminase 0.9684 2 198 GO:0008703
GO:0009231
AF-A0A6C1C1J3-F1-model_v4 deleted 0.9679 1 198
AF-A0A542U969-F1-model_v4 RibD domain-containing protein 0.9673 2 199 GO:0008703
GO:0009231

Map