F457926

General Info

Members Datasets Scaffolds Average Seq Length
515 357 422 353

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_438284_c1|nmdc:mga0n895_438284_c1_23_1237
Length 404
Sequence MRQDDGPGRKFSRPRALAKVRRQAIAPQPIPPYHAPDFFVRPSLRTRDMSDKGRPGLTYAQAGVDIDAGNAMVDLIKPLVRATARAGADAEIGGFGGLFDLKRAGFKDPVLVAATDGVGTKVKIAIDTGHHRTIGIDLVAMSVNDLVVQGAEPLFFLDYFACGRLDPQHGAAVVAGIADGCRQANCALIGGETAEMPGLYAGGDYDLAGFAVGAAERGTLLPRNDIAAGDALIGIASSGVHSNGYSLVRKVVETSGLLWGAPAPFDKSRSLGEALLTPTRIYVASCLAAIRNTGAVKALAHITGGGFPDNIPRVLPKGLGVTLDLARVPVLPVFKWLAATGAIAQPEMLRTFNCGIGMVAVVEPAKADAVAAELERAGETVVRLGEVTRAGDARVAYAGRLDLG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
8 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
9 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
10 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
11 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
12 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
13 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
14 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
15 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
16 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
17 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
18 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2643221607 Rhizobium sp. Root73 Isolate Unclassified
21 2643221618 Ensifer sp. Root231 Isolate Unclassified
22 2643221626 Ensifer sp. Root31 Isolate Unclassified
23 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
24 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
25 2643221651 Afipia sp. Root123D2 Isolate Unclassified
26 2643221655 Ensifer sp. Root1252 Isolate Unclassified
27 2643221659 Ensifer sp. Root127 Isolate Unclassified
28 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
29 2643221688 Rhizobium sp. Root482 Isolate Unclassified
30 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
31 2643221698 Ensifer sp. Root142 Isolate Unclassified
32 2643221712 Ensifer sp. Root258 Isolate Unclassified
33 2643221718 Rhizobium sp. Root268 Isolate Unclassified
34 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
35 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
36 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
37 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
38 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
39 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
40 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
41 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
42 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
43 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
44 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
45 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
46 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
47 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
48 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
49 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
50 2844163670 Ensifer sp. 1H6 Isolate Unclassified
51 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
52 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
53 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
54 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
55 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
56 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
57 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
58 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
59 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
60 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
61 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
62 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
63 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
64 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
65 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
66 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
67 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
68 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
69 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
70 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
71 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
72 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
73 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
74 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
75 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
76 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
77 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
78 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
79 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
80 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
81 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
82 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
83 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
84 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
85 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
86 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
87 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
88 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
89 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
90 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
337 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
338 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
340 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
350 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
355 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
356 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
357 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.94
Metatranscriptomes 0
Isolates 18.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 9.9
Rhizoplane 3.88
Rhizosphere 69.9
Stem 0
Stem Tuber 0
Unclassified 8.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10029420 3300003187 Bacteria 2175
2 Ga0055531_10002199 3300003794 Bacteria 13276
3 Ga0065712_10000554 3300005290 Bacteria 20924
4 Ga0065715_10004758 3300005293 Bacteria 7375
5 Ga0070676_10105337 3300005328 Bacteria 1748
6 Ga0068869_100088971 3300005334 Bacteria 2318
7 Ga0070666_10096786 3300005335 Bacteria 2032
8 Ga0070680_100094441 3300005336 Bacteria 2479
9 Ga0068868_100016508 3300005338 Bacteria 5484
10 Ga0068868_100187052 3300005338 Bacteria 1721
11 Ga0070661_100049299 3300005344 Bacteria 3082
12 Ga0070673_100021833 3300005364 Bacteria 4650
13 Ga0070667_100034404 3300005367 Bacteria 4238
14 Ga0070711_100019314 3300005439 Bacteria 4371
15 Ga0070694_100121083 3300005444 Bacteria 1878
16 Ga0070708_100190512 3300005445 Bacteria 1918
17 Ga0070663_100050837 3300005455 Bacteria 2950
18 Ga0070663_100153905 3300005455 Bacteria 1765
19 Ga0070678_100018897 3300005456 Bacteria 4477
20 Ga0070662_100007271 3300005457 Bacteria 7175
21 Ga0070681_10056548 3300005458 Bacteria 3904
22 Ga0070681_10118804 3300005458 Bacteria 2580
23 Ga0070679_100082859 3300005530 Bacteria 3197
24 Ga0070679_100117934 3300005530 Bacteria 2639
25 Ga0070693_100039971 3300005547 Bacteria 2631
26 Ga0070704_100221332 3300005549 Bacteria 1539
27 Ga0068855_100348942 3300005563 Bacteria 1630
28 Ga0070664_100121885 3300005564 Bacteria 2284
29 Ga0068856_100099748 3300005614 Bacteria 2895
30 Ga0068858_100149473 3300005842 Bacteria 2195
31 Ga0068860_100347823 3300005843 Bacteria 1458
32 Ga0081455_10000009 3300005937 Bacteria 249885
33 Ga0081455_10009327 3300005937 Bacteria 10102
34 Ga0081540_1005732 3300005983 Bacteria 9209
35 Ga0070717_10079851 3300006028 Bacteria 2744
36 Ga0075365_10011701 3300006038 Bacteria 5171
37 Ga0075365_10036541 3300006038 Bacteria 3183
38 Ga0075365_10065001 3300006038 Bacteria 2445
39 Ga0075368_10016370 3300006042 Bacteria 2763
40 Ga0075363_100028589 3300006048 Bacteria 2870
41 Ga0070712_100360829 3300006175 Bacteria 1191
42 Ga0075369_10009755 3300006186 Bacteria 3739
43 Ga0097621_100005465 3300006237 Bacteria 8946
44 Ga0097621_100027453 3300006237 Bacteria 4477
45 Ga0068871_100022650 3300006358 Bacteria 4847
46 Ga0068871_100052019 3300006358 Bacteria 3316
47 Ga0075428_100434723 3300006844 Bacteria 1406
48 Ga0075430_100000124 3300006846 Bacteria 48138
49 Ga0075434_100102348 3300006871 Bacteria 2872
50 Ga0099794_10054324 3300007265 Bacteria 1933
51 Ga0099795_10021551 3300007788 Bacteria 2115
52 Ga0099795_10027691 3300007788 Bacteria 1920
53 Ga0105240_10424815 3300009093 Bacteria 1492
54 Ga0105245_10006873 3300009098 Bacteria 9978
55 Ga0105245_10100120 3300009098 Bacteria 2681
56 Ga0114129_10006149 3300009147 Bacteria 17029
57 Ga0114129_10248523 3300009147 Bacteria 2388
58 Ga0114129_10474245 3300009147 Bacteria 1638
59 Ga0114129_10911033 3300009147 Bacteria 1113
60 Ga0105242_10024628 3300009176 Bacteria 4755
61 Ga0105242_10034403 3300009176 Bacteria 4061
62 Ga0105238_10062579 3300009551 Bacteria 3722
63 Ga0105238_10075902 3300009551 Bacteria 3353
64 Ga0105249_10106164 3300009553 Bacteria 2649
65 Ga0099796_10001977 3300010159 Bacteria 4358
66 Ga0105239_10115375 3300010375 Bacteria 2979
67 Ga0105239_10284477 3300010375 Bacteria 1862
68 Ga0105246_10017891 3300011119 Bacteria 4510
69 Ga0157370_10059665 3300013104 Bacteria 3625
70 Ga0171463_1001 3300013249 Bacteria 1406070
71 Ga0157374_10096903 3300013296 Bacteria 2821
72 Ga0157374_10184809 3300013296 Bacteria 2037
73 Ga0157378_10235303 3300013297 Bacteria 1747
74 Ga0157375_10007403 3300013308 Bacteria 9609
75 Ga0157379_10015888 3300014968 Bacteria 6617
76 Ga0157376_10098850 3300014969 Bacteria 2545
77 Ga0183363_1174 3300015690 Bacteria 14284
78 Ga0209025_1000580 3300025294 Bacteria 66332
79 Ga0209564_1000330 3300025295 Bacteria 92033
80 Ga0209051_1001611 3300025303 Bacteria 18403
81 Ga0209257_1001713 3300025304 Bacteria 24577
82 Ga0207692_10079915 3300025898 Bacteria 1746
83 Ga0207699_10085881 3300025906 Bacteria 1964
84 Ga0207699_10128480 3300025906 Bacteria 1649
85 Ga0207645_10116489 3300025907 Bacteria 1732
86 Ga0207645_10176511 3300025907 Bacteria 1401
87 Ga0207684_10196793 3300025910 Bacteria 1738
88 Ga0207707_10134752 3300025912 Bacteria 2159
89 Ga0207707_10181434 3300025912 Bacteria 1838
90 Ga0207695_10100665 3300025913 Bacteria 2885
91 Ga0207693_10012318 3300025915 Bacteria 6911
92 Ga0207660_10091645 3300025917 Bacteria 2255
93 Ga0207660_10215022 3300025917 Bacteria 1507
94 Ga0207660_10271371 3300025917 Bacteria 1344
95 Ga0207657_10033957 3300025919 Bacteria 4594
96 Ga0207652_10106788 3300025921 Bacteria 2479
97 Ga0207687_10023486 3300025927 Bacteria 4111
98 Ga0207664_10206313 3300025929 Bacteria 1699
99 Ga0207664_10300309 3300025929 Bacteria 1412
100 Ga0207644_10234807 3300025931 Bacteria 1458
101 Ga0207706_10009125 3300025933 Bacteria 9119
102 Ga0207706_10028541 3300025933 Bacteria 4983
103 Ga0207665_10090615 3300025939 Bacteria 2119
104 Ga0207689_10166665 3300025942 Bacteria 1815
105 Ga0207667_10060346 3300025949 Bacteria 3970
106 Ga0207667_10137425 3300025949 Bacteria 2516
107 Ga0207651_10081743 3300025960 Bacteria 2330
108 Ga0207712_10239841 3300025961 Bacteria 1460
109 Ga0207658_10113451 3300025986 Bacteria 2147
110 Ga0207677_10162898 3300026023 Bacteria 1735
111 Ga0207678_10012872 3300026067 Bacteria 7343
112 Ga0207702_10068145 3300026078 Bacteria 3056
113 Ga0207702_10077948 3300026078 Bacteria 2867
114 Ga0207648_10273491 3300026089 Bacteria 1509
115 Ga0207683_10042927 3300026121 Bacteria 3949
116 Ga0209179_1002003 3300027512 Bacteria 2654
117 Ga0209813_10015287 3300027866 Bacteria 2077
118 Ga0307515_10000070 3300028794 Bacteria 239322
119 Ga0265338_10113309 3300028800 Bacteria 2179
120 Ga0265332_10000227 3300031238 Bacteria 45207
121 Ga0265325_10036132 3300031241 Bacteria 2619
122 Ga0265340_10008035 3300031247 Bacteria 5717
123 Ga0265340_10009212 3300031247 Bacteria 5305
124 Ga0265339_10000761 3300031249 Bacteria 24928
125 Ga0265339_10031728 3300031249 Bacteria 2984
126 Ga0265331_10002951 3300031250 Bacteria 11214
127 Ga0265327_10015311 3300031251 Bacteria 4960
128 Ga0265316_10094044 3300031344 Bacteria 2284
129 Ga0307513_10017679 3300031456 Bacteria 8541
130 Ga0265313_10000116 3300031595 Bacteria 80097
131 Ga0265313_10038910 3300031595 Bacteria 2364
132 Ga0265314_10012686 3300031711 Bacteria 6856
133 Ga0265314_10084970 3300031711 Bacteria 2076
134 Ga0265342_10000137 3300031712 Bacteria 81963
135 Ga0265342_10043737 3300031712 Bacteria 2702
136 Ga0316576_10021648 3300031727 Bacteria 4451
137 Ga0316583_10001495 3300032133 Bacteria 7836
138 Ga0373934_0044170 3300035086 Bacteria 1761
139 Ga0373923_0000055 3300035111 Bacteria 17629
140 Ga0373936_0010830 3300035113 Bacteria 3444
141 Ga0373941_0010584 3300035115 Bacteria 2361
142 Ga0373945_0006417 3300035116 Bacteria 3794
143 Ga0373945_0011748 3300035116 Bacteria 2899
144 Ga0373953_0005545 3300035117 Bacteria 4104
145 Ga0373954_0006002 3300035118 Bacteria 5285
146 Ga0373954_0010914 3300035118 Bacteria 4016
147 Ga0373956_0003548 3300035119 Bacteria 6283
148 Ga0373956_0021300 3300035119 Bacteria 2766
149 Ga0373956_0033691 3300035119 Bacteria 2253
150 Ga0373957_0008660 3300035120 Bacteria 3306
151 Ga0373957_0027162 3300035120 Bacteria 2077
152 Ga0373957_0029646 3300035120 Bacteria 2000
153 Ga0373943_0001550 3300035170 Bacteria 10416
154 Ga0373943_0128372 3300035170 Bacteria 1354
155 Ga0373946_0007757 3300035171 Bacteria 3937
156 Ga0373955_0000120 3300035172 Bacteria 31334
157 Ga0373955_0040891 3300035172 Bacteria 2482
158 Ga0373955_0062564 3300035172 Bacteria 2058
159 Ga0373961_0001678 3300035241 Bacteria 6179
160 Ga0316574_0019240 3300035398 Bacteria 4025
161 Ga0373924_0000943 3300035410 Bacteria 9194
162 Ga0373935_0000045 3300035692 Bacteria 48915
163 Ga0373935_0034006 3300035692 Bacteria 3176
164 Ga0373935_0200529 3300035692 Bacteria 1378
165 Ga0373927_0004730 3300035695 Bacteria 9486
166 Ga0373927_0100750 3300035695 Bacteria 1878
167 Ga0373927_0110893 3300035695 Bacteria 1787
168 Ga0373933_0000732 3300035724 Bacteria 20150
169 Ga0373933_0001118 3300035724 Bacteria 15965
170 Ga0373933_0007863 3300035724 Bacteria 5823
171 Ga0373947_0002901 3300035725 Bacteria 10241
172 Ga0373937_0000369 3300036401 Bacteria 41814
173 Ga0373937_0006894 3300036401 Bacteria 9804
174 Ga0373937_0019714 3300036401 Bacteria 6040
175 Ga0373937_0121497 3300036401 Bacteria 2434
176 Ga0316584_0316841 3300036712 Bacteria 1126
177 Ga0373925_0000178 3300037068 Bacteria 69362
178 Ga0373925_0028410 3300037068 Bacteria 4098
179 Ga0395900_0058046 3300037418 Bacteria 3984
180 Ga0395900_0060164 3300037418 Bacteria 3910
181 Ga0436364_0790318 3300037853 Bacteria 1832
182 Ga0395901_0004712 3300038443 Bacteria 13766
183 Ga0436365_0843971 3300039437 Bacteria 2043
184 Ga0436365_1190710 3300039437 Bacteria 19594
185 Ga0436360_0590939 3300039438 Bacteria 2593
186 Ga0436361_0060530 3300039447 Bacteria 5319
187 Ga0451577_0104205 3300042876 Bacteria 2535
188 Ga0453683_0070214 3300044673 Bacteria 2190
189 Ga0453684_0001085 3300044712 Bacteria 86493
190 Ga0466970_0110567 3300044765 Bacteria 1500
191 Ga0466959_0088768 3300045049 Bacteria 2222
192 Ga0451576_0001069 3300045051 Bacteria 50249
193 Ga0466958_0008776 3300045836 Bacteria 5614
194 Ga0466967_0031363 3300045976 Bacteria 4474
195 Ga0466967_0089204 3300045976 Bacteria 2800
196 Ga0495592_0000118 3300046454 Bacteria 69831
197 Ga0495592_0027214 3300046454 Bacteria 4335
198 Ga0495603_0014328 3300046455 Bacteria 4794
199 Ga0495603_0057482 3300046455 Bacteria 2301
200 Ga0495629_0071550 3300046459 Bacteria 2420
201 Ga0495638_0032721 3300046460 Bacteria 3330
202 Ga0495641_0017940 3300046461 Bacteria 3667
203 Ga0495651_0000150 3300046462 Bacteria 51171
204 Ga0495651_0023199 3300046462 Bacteria 4825
205 Ga0495651_0032690 3300046462 Bacteria 4057
206 Ga0495653_0000138 3300046463 Bacteria 60857
207 Ga0495653_0059874 3300046463 Bacteria 2887
208 Ga0495582_0022676 3300046473 Bacteria 3436
209 Ga0495662_0001268 3300046476 Bacteria 12480
210 Ga0495662_0008513 3300046476 Bacteria 5042
211 Ga0495664_0000005 3300046477 Bacteria 439635
212 Ga0495594_0016432 3300046499 Bacteria 3899
213 Ga0495607_0019804 3300046501 Bacteria 4267
214 Ga0495608_0000083 3300046511 Bacteria 69238
215 Ga0495618_0000079 3300046514 Bacteria 69375
216 Ga0495618_0011917 3300046514 Bacteria 5276
217 Ga0495620_0038122 3300046515 Bacteria 2135
218 Ga0495628_0000033 3300046516 Bacteria 118203
219 Ga0495628_0003957 3300046516 Bacteria 13192
220 Ga0495630_0000490 3300046517 Bacteria 29272
221 Ga0495631_0020495 3300046518 Bacteria 3089
222 Ga0495652_0000001 3300046529 Bacteria 1045081
223 Ga0495654_0011563 3300046530 Bacteria 4773
224 Ga0495665_0083051 3300046531 Bacteria 1684
225 Ga0495640_0000010 3300046533 Bacteria 214167
226 Ga0495586_0178580 3300046535 Bacteria 1200
227 Ga0495587_0000090 3300046536 Bacteria 69871
228 Ga0495587_0000701 3300046536 Bacteria 22458
229 Ga0495645_0000005 3300046543 Bacteria 443917
230 Ga0495645_0063341 3300046543 Bacteria 2677
231 Ga0495667_0000079 3300046559 Bacteria 69267
232 Ga0495667_0002846 3300046559 Bacteria 11574
233 Ga0495634_0000166 3300046642 Bacteria 60485
234 Ga0495635_0000055 3300046663 Bacteria 69432
235 Ga0495635_0026694 3300046663 Bacteria 4017
236 Ga0495635_0029695 3300046663 Bacteria 3802
237 Ga0495657_0000124 3300046675 Bacteria 69346
238 Ga0495657_0015906 3300046675 Bacteria 5492
239 Ga0495657_0018398 3300046675 Bacteria 5059
240 Ga0495599_0000075 3300046678 Bacteria 69327
241 Ga0495599_0001008 3300046678 Bacteria 15828
242 Ga0495623_0000003 3300046679 Bacteria 147316
243 Ga0495623_0001363 3300046679 Bacteria 16553
244 Ga0495646_0000042 3300046680 Bacteria 69329
245 Ga0495646_0002430 3300046680 Bacteria 11428
246 Ga0495647_0007164 3300046681 Bacteria 3726
247 Ga0495658_0016330 3300046683 Bacteria 3821
248 Ga0495658_0111138 3300046683 Bacteria 1648
249 Ga0495613_0008989 3300046689 Bacteria 7413
250 Ga0495624_0013220 3300046690 Bacteria 5628
251 Ga0495624_0087039 3300046690 Bacteria 1929
252 Ga0495670_0019410 3300046691 Bacteria 3349
253 Ga0495600_0000052 3300046809 Bacteria 69430
254 Ga0495600_0006314 3300046809 Bacteria 7204
255 Ga0495600_0031804 3300046809 Bacteria 3421
256 Ga0495581_0012172 3300047315 Bacteria 4979
257 Ga0495581_0013986 3300047315 Bacteria 4655
258 Ga0495604_0000010 3300047317 Bacteria 312236
259 Ga0495604_0002172 3300047317 Bacteria 15754
260 Ga0495674_0000013 3300047319 Bacteria 248475
261 Ga0495674_0014511 3300047319 Bacteria 7371
262 Ga0495680_0000275 3300047322 Bacteria 57457
263 Ga0495680_0005445 3300047322 Bacteria 11978
264 Ga0495680_0094416 3300047322 Bacteria 2238
265 Ga0495675_0000297 3300047444 Bacteria 35718
266 Ga0495675_0000357 3300047444 Bacteria 31839
267 Ga0495684_0000008 3300047471 Bacteria 201370
268 Ga0495686_0107307 3300047472 Bacteria 1678
269 Ga0495593_0002605 3300047673 Bacteria 10842
270 Ga0495602_0000134 3300048088 Bacteria 69349
271 Ga0495602_0005080 3300048088 Bacteria 13792
272 Ga0495602_0225579 3300048088 Bacteria 1411
273 Ga0496100_0146167 3300048903 Bacteria 1681
274 Ga0496103_0092133 3300048906 Bacteria 1913
275 Ga0496104_0001371 3300048907 Bacteria 21073
276 Ga0496104_0013156 3300048907 Bacteria 7459
277 Ga0496104_0077110 3300048907 Bacteria 3175
278 Ga0496105_0051096 3300048908 Bacteria 3416
279 Ga0496105_0275609 3300048908 Bacteria 1357
280 Ga0496106_0118653 3300048909 Bacteria 2066
281 Ga0496108_0011807 3300048911 Bacteria 7106
282 Ga0496109_0068996 3300048912 Bacteria 3241
283 Ga0496109_0306090 3300048912 Bacteria 1499
284 Ga0496110_0048559 3300048913 Bacteria 3721
285 Ga0496112_0044407 3300048915 Bacteria 4354
286 Ga0496114_0015654 3300048917 Bacteria 6102
287 Ga0496115_0085669 3300048918 Bacteria 2570
288 Ga0496115_0093988 3300048918 Bacteria 2452
289 Ga0496119_0027648 3300048922 Bacteria 3892
290 Ga0496121_0004595 3300048924 Bacteria 18391
291 Ga0496122_0027216 3300048925 Bacteria 4895
292 Ga0496125_0002994 3300048928 Bacteria 21141
293 Ga0496125_0003669 3300048928 Bacteria 18344
294 Ga0496125_0021580 3300048928 Bacteria 6002
295 Ga0496126_0017274 3300048929 Bacteria 7189
296 Ga0496126_0162834 3300048929 Bacteria 1905
297 Ga0496126_0223711 3300048929 Bacteria 1579
298 Ga0501031_0023259 3300049568 Bacteria 4040
299 Ga0501032_0017340 3300049569 Bacteria 5055
300 Ga0501033_0049163 3300049570 Bacteria 3131
301 Ga0501033_0073959 3300049570 Bacteria 2501
302 Ga0501033_0089798 3300049570 Bacteria 2247
303 Ga0501034_0000244 3300049571 Bacteria 100222
304 Ga0501034_0001563 3300049571 Bacteria 29937
305 Ga0501034_0025890 3300049571 Bacteria 5974
306 Ga0501034_0063884 3300049571 Bacteria 3695
307 Ga0501034_0069395 3300049571 Bacteria 3535
308 Ga0501034_0203053 3300049571 Bacteria 1939
309 Ga0501036_0001718 3300049572 Bacteria 17015
310 Ga0501036_0002138 3300049572 Bacteria 15414
311 Ga0501036_0021852 3300049572 Bacteria 5380
312 Ga0501036_0032695 3300049572 Bacteria 4397
313 Ga0501036_0363503 3300049572 Bacteria 1208
314 Ga0501037_0072324 3300049573 Bacteria 2508
315 Ga0501038_0026057 3300049574 Bacteria 5207
316 Ga0501038_0097393 3300049574 Bacteria 2454
317 Ga0501038_0105575 3300049574 Bacteria 2339
318 Ga0501039_0038019 3300049575 Bacteria 3717
319 Ga0501039_0054897 3300049575 Bacteria 3084
320 Ga0501039_0283324 3300049575 Bacteria 1303
321 Ga0501042_0187912 3300049578 Bacteria 1490
322 Ga0501043_0005464 3300049579 Bacteria 10274
323 Ga0501043_0020698 3300049579 Bacteria 5160
324 Ga0501046_0036214 3300049580 Bacteria 3973
325 Ga0501046_0073478 3300049580 Bacteria 2653
326 Ga0501046_0245895 3300049580 Bacteria 1318
327 Ga0501047_0000010 3300049581 Bacteria 429357
328 Ga0501047_0033448 3300049581 Bacteria 4963
329 Ga0501047_0227363 3300049581 Bacteria 1720
330 Ga0501047_0293714 3300049581 Bacteria 1468
331 Ga0501048_0000436 3300049582 Bacteria 29275
332 Ga0501048_0021171 3300049582 Bacteria 4761
333 Ga0501048_0022222 3300049582 Bacteria 4642
334 Ga0501048_0105778 3300049582 Bacteria 1986
335 Ga0501067_0017905 3300049583 Bacteria 3923
336 Ga0501067_0029095 3300049583 Bacteria 3062
337 Ga0501067_0077210 3300049583 Bacteria 1845
338 Ga0501068_0017198 3300049584 Bacteria 4178
339 Ga0501068_0049018 3300049584 Bacteria 2550
340 Ga0501068_0075826 3300049584 Bacteria 2057
341 Ga0501069_0014660 3300049585 Bacteria 4192
342 Ga0501069_0044145 3300049585 Bacteria 2468
343 Ga0501070_0001087 3300049586 Bacteria 24420
344 Ga0501070_0004796 3300049586 Bacteria 11568
345 Ga0501070_0037608 3300049586 Bacteria 4040
346 Ga0501070_0130133 3300049586 Bacteria 2079
347 Ga0501071_0037698 3300049587 Bacteria 3453
348 Ga0501071_0177304 3300049587 Bacteria 1596
349 Ga0501072_0023070 3300049588 Bacteria 4832
350 Ga0501072_0052314 3300049588 Bacteria 3216
351 Ga0501072_0055381 3300049588 Bacteria 3126
352 Ga0501073_0025910 3300049589 Bacteria 4201
353 Ga0501073_0039920 3300049589 Bacteria 3324
354 Ga0501073_0064941 3300049589 Bacteria 2545
355 Ga0501073_0184614 3300049589 Bacteria 1443
356 Ga0501073_0230043 3300049589 Bacteria 1281
357 Ga0501074_0028715 3300049590 Bacteria 4031
358 Ga0501074_0053977 3300049590 Bacteria 2898
359 Ga0501075_0285972 3300049591 Bacteria 1256
360 Ga0501076_0086318 3300049592 Bacteria 2522
361 Ga0501079_0170392 3300049741 Bacteria 1697
362 Ga0501080_0000148 3300049742 Bacteria 50074
363 Ga0501080_0063098 3300049742 Bacteria 3448
364 Ga0501080_0087818 3300049742 Bacteria 2888
365 Ga0501081_0073238 3300049743 Bacteria 2389
366 Ga0501083_0000335 3300049744 Bacteria 29800
367 Ga0501083_0017507 3300049744 Bacteria 4996
368 Ga0501035_0000995 3300049822 Bacteria 29963
369 Ga0501035_0022329 3300049822 Bacteria 5810
370 Ga0501035_0264355 3300049822 Bacteria 1457
371 Ga0501044_0019538 3300049823 Bacteria 7245
372 Ga0501044_0028772 3300049823 Bacteria 5862
373 Ga0501044_0031504 3300049823 Bacteria 5580
374 Ga0501044_0052018 3300049823 Bacteria 4223
375 Ga0501044_0053670 3300049823 Bacteria 4146
376 Ga0501044_0116959 3300049823 Bacteria 2670
377 Ga0501044_0331206 3300049823 Bacteria 1445
378 nmdc:mga03n38_24099_c1 3300050490 Bacteria 2484
379 nmdc:mga06z11_5734_c1 3300050494 Bacteria 5002
380 nmdc:mga04h51_24510_c1 3300050495 Bacteria 1848
381 nmdc:mga05p37_35683_c1 3300050507 Bacteria 6098
382 nmdc:mga05p37_370732_c1 3300050507 Bacteria 1680
383 nmdc:mga05p37_7157_c1 3300050507 Bacteria 13157
384 nmdc:mga0qj67_53_c1 3300050509 Bacteria 83612
385 nmdc:mga0n895_438284_c1 3300050512 Bacteria 1320
386 nmdc:mga0n895_52301_c1 3300050512 Bacteria 4009
387 nmdc:mga0sz30_1197_c1 3300050516 Bacteria 9304
388 Ga0495601_0000003 3300053077 Bacteria 493642
389 Ga0495601_0003691 3300053077 Bacteria 8809
390 Ga0495601_0004110 3300053077 Bacteria 8382
391 Ga0495612_0000077 3300053078 Bacteria 44609
392 Ga0495612_0008298 3300053078 Bacteria 4215
393 Ga0495612_0013457 3300053078 Bacteria 3296
394 Ga0495595_0000094 3300053084 Bacteria 41985
395 Ga0495595_0000840 3300053084 Bacteria 11759
396 Ga0495595_0002861 3300053084 Bacteria 6802
397 Ga0495619_0000091 3300053085 Bacteria 69370
398 Ga0495619_0002549 3300053085 Bacteria 11928
399 Ga0495619_0004163 3300053085 Bacteria 9241
400 Ga0500581_030013 3300053089 Bacteria 2776
401 Ga0500566_0003767 3300053094 Bacteria 9052
402 Ga0500556_0000004 3300053104 Bacteria 666287
403 Ga0500562_044219 3300053108 Bacteria 1186
404 Ga0500593_019012 3300053117 Bacteria 3002
405 Ga0500595_004309 3300053119 Bacteria 6407
406 Ga0500607_055530 3300053121 Bacteria 2093
407 Ga0500608_000945 3300053122 Bacteria 10382
408 Ga0500642_0000037 3300053130 Bacteria 98684
409 Ga0500652_000240 3300053131 Bacteria 20632
410 Ga0500652_001278 3300053131 Bacteria 7979
411 Ga0500652_006986 3300053131 Bacteria 3669
412 Ga0500559_0000165 3300053136 Bacteria 52143
413 Ga0500568_0001069 3300053139 Bacteria 18534
414 Ga0500573_0109362 3300053140 Bacteria 1548
415 Ga0500604_0001821 3300053151 Bacteria 5941
416 Ga0500616_0000006 3300053153 Bacteria 944738
417 Ga0500616_0000014 3300053153 Bacteria 637918
418 Ga0500619_017571 3300053154 Bacteria 1993
419 Ga0500622_0007364 3300053156 Bacteria 6256
420 Ga0500636_0013446 3300053177 Bacteria 4806
421 Ga0500645_000033 3300053730 Bacteria 119279
422 Ga0501082_0273059 3300060353 Bacteria 1471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_370732_c1 nmdc:mga05p37_370732_c1_677_1663 302
2 3300005328 Ga0070676_10105337 Ga0070676_101053372 323
3 3300005334 Ga0068869_100088971 Ga0068869_1000889713 323
4 3300005338 Ga0068868_100016508 Ga0068868_1000165084 323
5 3300005563 Ga0068855_100348942 Ga0068855_1003489421 323
6 3300005842 Ga0068858_100149473 Ga0068858_1001494732 323
7 3300009093 Ga0105240_10424815 Ga0105240_104248152 323
8 3300010375 Ga0105239_10284477 Ga0105239_102844772 323
9 3300013296 Ga0157374_10184809 Ga0157374_101848092 323
10 3300025907 Ga0207645_10116489 Ga0207645_101164892 323
11 3300025910 Ga0207684_10196793 Ga0207684_101967931 323
12 3300025942 Ga0207689_10166665 Ga0207689_101666652 323
13 3300025949 Ga0207667_10137425 Ga0207667_101374252 323
14 3300025986 Ga0207658_10113451 Ga0207658_101134513 323
15 3300026078 Ga0207702_10068145 Ga0207702_100681453 323
16 3300048915 Ga0496112_0044407 Ga0496112_0044407_1333_2406 323
17 3300048929 Ga0496126_0162834 Ga0496126_0162834_122_1195 323
18 3300053119 Ga0500595_004309 Ga0500595_004309_4059_5132 323
19 3300005843 Ga0068860_100347823 Ga0068860_1003478232 329
20 3300048088 Ga0495602_0225579 Ga0495602_0225579_23_1021 329
21 3300006038 Ga0075365_10036541 Ga0075365_100365414 331
22 3300009147 Ga0114129_10474245 Ga0114129_104742452 331
23 3300035086 Ga0373934_0044170 Ga0373934_0044170_258_1328 331
24 3300035118 Ga0373954_0006002 Ga0373954_0006002_1002_2072 331
25 3300035119 Ga0373956_0033691 Ga0373956_0033691_526_1596 331
26 3300035172 Ga0373955_0040891 Ga0373955_0040891_1112_2182 331
27 3300035724 Ga0373933_0007863 Ga0373933_0007863_1367_2437 331
28 3300036401 Ga0373937_0006894 Ga0373937_0006894_2307_3377 331
29 3300046462 Ga0495651_0032690 Ga0495651_0032690_2238_3308 331
30 3300046663 Ga0495635_0026694 Ga0495635_0026694_531_1601 331
31 3300046675 Ga0495657_0018398 Ga0495657_0018398_720_1790 331
32 3300046809 Ga0495600_0031804 Ga0495600_0031804_207_1277 331
33 3300047322 Ga0495680_0094416 Ga0495680_0094416_745_1815 331
34 3300048908 Ga0496105_0275609 Ga0496105_0275609_21_1019 331
35 3300053077 Ga0495601_0004110 Ga0495601_0004110_2703_3773 331
36 3300053078 Ga0495612_0013457 Ga0495612_0013457_1039_2109 331
37 3300053084 Ga0495595_0002861 Ga0495595_0002861_2581_3651 331
38 3300053085 Ga0495619_0004163 Ga0495619_0004163_1681_2751 331
39 3300035120 Ga0373957_0027162 Ga0373957_0027162_764_1834 332
40 3300035241 Ga0373961_0001678 Ga0373961_0001678_4268_5329 332
41 3300039438 Ga0436360_0590939 Ga0436360_0590939_111_1184 332
42 3300039447 Ga0436361_0060530 Ga0436361_0060530_3913_4986 332
43 3300044765 Ga0466970_0110567 Ga0466970_0110567_170_1243 332
44 3300045049 Ga0466959_0088768 Ga0466959_0088768_1114_2187 332
45 3300049570 Ga0501033_0073959 Ga0501033_0073959_277_1350 332
46 3300049572 Ga0501036_0001718 Ga0501036_0001718_5340_6413 332
47 3300049574 Ga0501038_0026057 Ga0501038_0026057_3739_4812 332
48 3300049575 Ga0501039_0038019 Ga0501039_0038019_930_2003 332
49 3300049578 Ga0501042_0187912 Ga0501042_0187912_38_1111 332
50 3300049582 Ga0501048_0022222 Ga0501048_0022222_2147_3220 332
51 3300049583 Ga0501067_0029095 Ga0501067_0029095_725_1798 332
52 3300049584 Ga0501068_0017198 Ga0501068_0017198_1335_2408 332
53 3300049586 Ga0501070_0130133 Ga0501070_0130133_726_1799 332
54 3300049587 Ga0501071_0037698 Ga0501071_0037698_1345_2418 332
55 3300049588 Ga0501072_0052314 Ga0501072_0052314_1797_2870 332
56 3300049589 Ga0501073_0184614 Ga0501073_0184614_294_1367 332
57 3300049822 Ga0501035_0264355 Ga0501035_0264355_215_1288 332
58 3300049823 Ga0501044_0031504 Ga0501044_0031504_1009_2082 332
59 3300032133 Ga0316583_10001495 Ga0316583_100014954 333
60 3300045976 Ga0466967_0089204 Ga0466967_0089204_1218_2285 333
61 3300046690 Ga0495624_0087039 Ga0495624_0087039_14_1024 333
62 3300031711 Ga0265314_10012686 Ga0265314_100126865 334
63 3300031727 Ga0316576_10021648 Ga0316576_100216482 334
64 3300035398 Ga0316574_0019240 Ga0316574_0019240_753_1772 334
65 3300036712 Ga0316584_0316841 Ga0316584_0316841_57_1076 334
66 3300039437 Ga0436365_0843971 Ga0436365_0843971_393_1433 337
67 3300005937 Ga0081455_10009327 Ga0081455_1000932710 338
68 3300006871 Ga0075434_100102348 Ga0075434_1001023483 340
69 3300013296 Ga0157374_10096903 Ga0157374_100969032 340
70 3300045051 Ga0451576_0001069 Ga0451576_0001069_47308_48339 340
71 3300048917 Ga0496114_0015654 Ga0496114_0015654_1091_2170 340
72 3300050512 nmdc:mga0n895_52301_c1 nmdc:mga0n895_52301_c1_1903_2967 340
73 3300037068 Ga0373925_0028410 Ga0373925_0028410_541_1626 341
74 3300042876 Ga0451577_0104205 Ga0451577_0104205_1260_2300 342
75 3300044712 Ga0453684_0001085 Ga0453684_0001085_5320_6360 342
76 3300044673 Ga0453683_0070214 Ga0453683_0070214_757_1803 343
77 3300005445 Ga0070708_100190512 Ga0070708_1001905122 344
78 3300050507 nmdc:mga05p37_35683_c1 nmdc:mga05p37_35683_c1_1406_2473 346
79 3300007265 Ga0099794_10054324 Ga0099794_100543241 347
80 iso_pu_bacteria 2891088606 2891089893 347
81 iso_pu_bacteria 2513237087 2513591085 348
82 3300005457 Ga0070662_100007271 Ga0070662_1000072713 349
83 3300006844 Ga0075428_100434723 Ga0075428_1004347232 349
84 3300009147 Ga0114129_10248523 Ga0114129_102485232 349
85 3300025933 Ga0207706_10009125 Ga0207706_100091256 349
86 3300035115 Ga0373941_0010584 Ga0373941_0010584_1077_2132 349
87 3300048903 Ga0496100_0146167 Ga0496100_0146167_264_1325 349
88 3300049589 Ga0501073_0230043 Ga0501073_0230043_20_1123 349
89 3300049571 Ga0501034_0063884 Ga0501034_0063884_55_1131 350
90 3300049574 Ga0501038_0097393 Ga0501038_0097393_629_1705 350
91 iso_pu_bacteria 2513237141 2513889188 350
92 iso_pu_bacteria 2602042107 2603859526 350
93 iso_pu_bacteria 2643221651 2644288754 350
94 iso_pu_bacteria 2857524615 2857529070 350
95 iso_pu_bacteria 2893066018 2893070512 350
96 iso_pu_bacteria 2919073203 2919076470 350
97 3300006028 Ga0070717_10079851 Ga0070717_100798512 351
98 3300031251 Ga0265327_10015311 Ga0265327_100153115 351
99 3300039437 Ga0436365_1190710 Ga0436365_1190710_17670_18731 351
100 3300045976 Ga0466967_0031363 Ga0466967_0031363_60_1127 351
101 3300049568 Ga0501031_0023259 Ga0501031_0023259_1225_2286 351
102 3300049569 Ga0501032_0017340 Ga0501032_0017340_2745_3806 351
103 3300049570 Ga0501033_0089798 Ga0501033_0089798_81_1142 351
104 3300049571 Ga0501034_0000244 Ga0501034_0000244_27287_28348 351
105 3300049571 Ga0501034_0001563 Ga0501034_0001563_20737_21798 351
106 3300049571 Ga0501034_0069395 Ga0501034_0069395_2367_3428 351
107 3300049571 Ga0501034_0203053 Ga0501034_0203053_132_1193 351
108 3300049572 Ga0501036_0002138 Ga0501036_0002138_8509_9570 351
109 3300049572 Ga0501036_0032695 Ga0501036_0032695_2567_3628 351
110 3300049573 Ga0501037_0072324 Ga0501037_0072324_910_1971 351
111 3300049574 Ga0501038_0105575 Ga0501038_0105575_432_1493 351
112 3300049575 Ga0501039_0054897 Ga0501039_0054897_1652_2713 351
113 3300049579 Ga0501043_0005464 Ga0501043_0005464_4688_5749 351
114 3300049579 Ga0501043_0020698 Ga0501043_0020698_3881_4942 351
115 3300049580 Ga0501046_0036214 Ga0501046_0036214_2138_3199 351
116 3300049580 Ga0501046_0073478 Ga0501046_0073478_112_1173 351
117 3300049581 Ga0501047_0000010 Ga0501047_0000010_319371_320432 351
118 3300049581 Ga0501047_0293714 Ga0501047_0293714_39_1100 351
119 3300049582 Ga0501048_0000436 Ga0501048_0000436_14796_15857 351
120 3300049582 Ga0501048_0021171 Ga0501048_0021171_989_2050 351
121 3300049583 Ga0501067_0017905 Ga0501067_0017905_25_1086 351
122 3300049583 Ga0501067_0077210 Ga0501067_0077210_742_1803 351
123 3300049584 Ga0501068_0049018 Ga0501068_0049018_10_1071 351
124 3300049584 Ga0501068_0075826 Ga0501068_0075826_85_1146 351
125 3300049586 Ga0501070_0004796 Ga0501070_0004796_12_1073 351
126 3300049587 Ga0501071_0177304 Ga0501071_0177304_320_1381 351
127 3300049588 Ga0501072_0055381 Ga0501072_0055381_399_1460 351
128 3300049589 Ga0501073_0025910 Ga0501073_0025910_2004_3065 351
129 3300049589 Ga0501073_0039920 Ga0501073_0039920_2134_3195 351
130 3300049590 Ga0501074_0028715 Ga0501074_0028715_1866_2927 351
131 3300049590 Ga0501074_0053977 Ga0501074_0053977_240_1301 351
132 3300049591 Ga0501075_0285972 Ga0501075_0285972_132_1193 351
133 3300049592 Ga0501076_0086318 Ga0501076_0086318_976_2037 351
134 3300049741 Ga0501079_0170392 Ga0501079_0170392_552_1613 351
135 3300049742 Ga0501080_0000148 Ga0501080_0000148_31120_32181 351
136 3300049742 Ga0501080_0087818 Ga0501080_0087818_1747_2808 351
137 3300049743 Ga0501081_0073238 Ga0501081_0073238_1105_2166 351
138 3300049744 Ga0501083_0000335 Ga0501083_0000335_10874_11935 351
139 3300049744 Ga0501083_0017507 Ga0501083_0017507_2490_3551 351
140 3300049823 Ga0501044_0019538 Ga0501044_0019538_5773_6834 351
141 3300049823 Ga0501044_0116959 Ga0501044_0116959_747_1808 351
142 3300049823 Ga0501044_0331206 Ga0501044_0331206_120_1181 351
143 3300060353 Ga0501082_0273059 Ga0501082_0273059_74_1135 351
144 iso_pu_bacteria 2775507049 2776912873 351
145 3300005983 Ga0081540_1005732 Ga0081540_10057328 352
146 3300037853 Ga0436364_0790318 Ga0436364_0790318_296_1366 352
147 iso_pu_bacteria 2508501122 2509108570 352
148 iso_pu_bacteria 2509276019 2509374403 352
149 iso_pu_bacteria 2512875026 2512972184 352
150 iso_pu_bacteria 2513237089 2513603263 352
151 iso_pu_bacteria 2513237156 2513983869 352
152 iso_pu_bacteria 2513237159 2514001932 352
153 iso_pu_bacteria 2513237160 2514004718 352
154 iso_pu_bacteria 2517487022 2517569150 352
155 iso_pu_bacteria 2558860100 2558863430 352
156 iso_pu_bacteria 2558860983 2561466097 352
157 iso_pu_bacteria 2582581283 2585165615 352
158 iso_pu_bacteria 2582581306 2585266111 352
159 iso_pu_bacteria 2582581865 2585387112 352
160 iso_pu_bacteria 2582581866 2585392768 352
161 iso_pu_bacteria 2599185156 2599333704 352
162 iso_pu_bacteria 2599185352 2600191989 352
163 iso_pu_bacteria 2643221607 2644046508 352
164 iso_pu_bacteria 2643221618 2644108936 352
165 iso_pu_bacteria 2643221626 2644151458 352
166 iso_pu_bacteria 2643221636 2644200861 352
167 iso_pu_bacteria 2643221637 2644206146 352
168 iso_pu_bacteria 2643221655 2644311592 352
169 iso_pu_bacteria 2643221659 2644329850 352
170 iso_pu_bacteria 2643221686 2644479298 352
171 iso_pu_bacteria 2643221688 2644493348 352
172 iso_pu_bacteria 2643221689 2644502345 352
173 iso_pu_bacteria 2643221698 2644546524 352
174 iso_pu_bacteria 2643221712 2644617391 352
175 iso_pu_bacteria 2643221718 2644649793 352
176 iso_pu_bacteria 2657244999 2657683212 352
177 iso_pu_bacteria 2751185821 2753460860 352
178 iso_pu_bacteria 2791355082 2792584215 352
179 iso_pu_bacteria 2791355091 2792622631 352
180 iso_pu_bacteria 2791355092 2792628448 352
181 iso_pu_bacteria 2791355094 2792638293 352
182 iso_pu_bacteria 2802428858 2802717794 352
183 iso_pu_bacteria 2802428859 2802723277 352
184 iso_pu_bacteria 2802428860 2802733140 352
185 iso_pu_bacteria 2802428862 2802743512 352
186 iso_pu_bacteria 2802428863 2802750775 352
187 iso_pu_bacteria 2802429268 2804751400 352
188 iso_pu_bacteria 2838074704 2838076495 352
189 iso_pu_bacteria 2842521101 2842526295 352
190 iso_pu_bacteria 2842922631 2842924858 352
191 iso_pu_bacteria 2844163670 2844168459 352
192 iso_pu_bacteria 2847417321 2847418162 352
193 iso_pu_bacteria 2848992105 2848993137 352
194 iso_pu_bacteria 2850079185 2850080531 352
195 iso_pu_bacteria 2855872281 2855878884 352
196 iso_pu_bacteria 2896384573 2896386695 352
197 iso_pu_bacteria 2915980308 2915986274 352
198 iso_pu_bacteria 2916048683 2916049614 352
199 iso_pu_bacteria 2916061851 2916062702 352
200 iso_pu_bacteria 2916076590 2916076778 352
201 iso_pu_bacteria 2920760137 2920762821 352
202 iso_pu_bacteria 2920822456 2920823899 352
203 iso_pu_bacteria 2921250672 2921251055 352
204 iso_pu_bacteria 2937029754 2937029765 352
205 iso_pu_bacteria 2937036028 2937036791 352
206 iso_pu_bacteria 2937078374 2937082871 352
207 iso_pu_bacteria 2937084907 2937090525 352
208 iso_pu_bacteria 2941499720 2941500159 352
209 iso_pu_bacteria 2957375807 2957379924 352
210 iso_pu_bacteria 2957437181 2957438992 352
211 iso_pu_bacteria 2960591022 2960595674 352
212 iso_pu_bacteria 2960610863 2960611908 352
213 iso_pu_bacteria 2960624210 2960630671 352
214 iso_pu_bacteria 2960631154 2960633124 352
215 iso_pu_bacteria 2960680706 2960684263 352
216 iso_pu_bacteria 2960687367 2960689070 352
217 iso_pu_bacteria 2960693952 2960696791 352
218 iso_pu_bacteria 2967686174 2967687135 352
219 iso_pu_bacteria 2967728569 2967734633 352
220 iso_pu_bacteria 2970026789 2970032654 352
221 iso_pu_bacteria 2970122695 2970124357 352
222 iso_pu_bacteria 2970143518 2970144474 352
223 iso_pu_bacteria 2970177841 2970178479 352
224 iso_pu_bacteria 2977516862 2977517874 352
225 iso_pu_bacteria 2977530762 2977536954 352
226 iso_pu_bacteria 2989771324 2989772116 352
227 iso_pu_bacteria 643692032 643825138 352
228 iso_pu_bacteria 8003999396 8004000284 352
229 iso_pu_bacteria 8005658619 8005659929 352
230 iso_pu_bacteria 8049293176 8049293973 352
231 3300005336 Ga0070680_100094441 Ga0070680_1000944411 353
232 3300005530 Ga0070679_100082859 Ga0070679_1000828593 353
233 3300005530 Ga0070679_100117934 Ga0070679_1001179342 353
234 3300006038 Ga0075365_10065001 Ga0075365_100650012 353
235 3300006846 Ga0075430_100000124 Ga0075430_1000001249 353
236 3300009147 Ga0114129_10911033 Ga0114129_109110331 353
237 3300025917 Ga0207660_10271371 Ga0207660_102713711 353
238 3300025921 Ga0207652_10106788 Ga0207652_101067883 353
239 3300031250 Ga0265331_10002951 Ga0265331_100029518 353
240 3300031595 Ga0265313_10038910 Ga0265313_100389101 353
241 3300037418 Ga0395900_0058046 Ga0395900_0058046_897_1967 353
242 3300038443 Ga0395901_0004712 Ga0395901_0004712_2712_3782 353
243 3300045836 Ga0466958_0008776 Ga0466958_0008776_158_1228 353
244 3300048907 Ga0496104_0013156 Ga0496104_0013156_4851_5921 353
245 3300048907 Ga0496104_0077110 Ga0496104_0077110_1910_2980 353
246 3300048908 Ga0496105_0051096 Ga0496105_0051096_233_1303 353
247 3300048909 Ga0496106_0118653 Ga0496106_0118653_816_1886 353
248 3300048912 Ga0496109_0306090 Ga0496109_0306090_187_1257 353
249 3300049570 Ga0501033_0049163 Ga0501033_0049163_716_1792 353
250 3300049572 Ga0501036_0363503 Ga0501036_0363503_32_1108 353
251 3300049575 Ga0501039_0283324 Ga0501039_0283324_37_1113 353
252 3300049823 Ga0501044_0052018 Ga0501044_0052018_2424_3593 353
253 3300050509 nmdc:mga0qj67_53_c1 nmdc:mga0qj67_53_c1_20430_21497 353
254 3300005290 Ga0065712_10000554 Ga0065712_100005543 354
255 3300005293 Ga0065715_10004758 Ga0065715_100047585 354
256 3300005335 Ga0070666_10096786 Ga0070666_100967863 354
257 3300005338 Ga0068868_100187052 Ga0068868_1001870522 354
258 3300005344 Ga0070661_100049299 Ga0070661_1000492993 354
259 3300005367 Ga0070667_100034404 Ga0070667_1000344043 354
260 3300005439 Ga0070711_100019314 Ga0070711_1000193143 354
261 3300005444 Ga0070694_100121083 Ga0070694_1001210832 354
262 3300005455 Ga0070663_100050837 Ga0070663_1000508374 354
263 3300005455 Ga0070663_100153905 Ga0070663_1001539052 354
264 3300005456 Ga0070678_100018897 Ga0070678_1000188972 354
265 3300005458 Ga0070681_10056548 Ga0070681_100565485 354
266 3300005458 Ga0070681_10118804 Ga0070681_101188043 354
267 3300005547 Ga0070693_100039971 Ga0070693_1000399711 354
268 3300005549 Ga0070704_100221332 Ga0070704_1002213322 354
269 3300005564 Ga0070664_100121885 Ga0070664_1001218853 354
270 3300005614 Ga0068856_100099748 Ga0068856_1000997481 354
271 3300005937 Ga0081455_10000009 Ga0081455_1000000997 354
272 3300006038 Ga0075365_10011701 Ga0075365_100117014 354
273 3300006175 Ga0070712_100360829 Ga0070712_1003608291 354
274 3300006186 Ga0075369_10009755 Ga0075369_100097553 354
275 3300006237 Ga0097621_100005465 Ga0097621_1000054654 354
276 3300006358 Ga0068871_100052019 Ga0068871_1000520192 354
277 3300007788 Ga0099795_10021551 Ga0099795_100215512 354
278 3300007788 Ga0099795_10027691 Ga0099795_100276912 354
279 3300009098 Ga0105245_10100120 Ga0105245_101001202 354
280 3300009176 Ga0105242_10024628 Ga0105242_100246284 354
281 3300009551 Ga0105238_10062579 Ga0105238_100625794 354
282 3300009551 Ga0105238_10075902 Ga0105238_100759023 354
283 3300009553 Ga0105249_10106164 Ga0105249_101061643 354
284 3300010159 Ga0099796_10001977 Ga0099796_100019774 354
285 3300010375 Ga0105239_10115375 Ga0105239_101153752 354
286 3300011119 Ga0105246_10017891 Ga0105246_100178913 354
287 3300013104 Ga0157370_10059665 Ga0157370_100596653 354
288 3300013297 Ga0157378_10235303 Ga0157378_102353031 354
289 3300013308 Ga0157375_10007403 Ga0157375_100074035 354
290 3300014968 Ga0157379_10015888 Ga0157379_100158884 354
291 3300014969 Ga0157376_10098850 Ga0157376_100988503 354
292 3300025898 Ga0207692_10079915 Ga0207692_100799152 354
293 3300025906 Ga0207699_10085881 Ga0207699_100858812 354
294 3300025906 Ga0207699_10128480 Ga0207699_101284801 354
295 3300025907 Ga0207645_10176511 Ga0207645_101765112 354
296 3300025912 Ga0207707_10134752 Ga0207707_101347522 354
297 3300025912 Ga0207707_10181434 Ga0207707_101814342 354
298 3300025913 Ga0207695_10100665 Ga0207695_101006653 354
299 3300025915 Ga0207693_10012318 Ga0207693_100123183 354
300 3300025917 Ga0207660_10091645 Ga0207660_100916452 354
301 3300025917 Ga0207660_10215022 Ga0207660_102150222 354
302 3300025919 Ga0207657_10033957 Ga0207657_100339573 354
303 3300025929 Ga0207664_10206313 Ga0207664_102063132 354
304 3300025929 Ga0207664_10300309 Ga0207664_103003091 354
305 3300025931 Ga0207644_10234807 Ga0207644_102348072 354
306 3300025933 Ga0207706_10028541 Ga0207706_100285412 354
307 3300025939 Ga0207665_10090615 Ga0207665_100906153 354
308 3300025949 Ga0207667_10060346 Ga0207667_100603464 354
309 3300025960 Ga0207651_10081743 Ga0207651_100817432 354
310 3300025961 Ga0207712_10239841 Ga0207712_102398412 354
311 3300026023 Ga0207677_10162898 Ga0207677_101628981 354
312 3300026067 Ga0207678_10012872 Ga0207678_100128725 354
313 3300026078 Ga0207702_10077948 Ga0207702_100779481 354
314 3300026089 Ga0207648_10273491 Ga0207648_102734911 354
315 3300026121 Ga0207683_10042927 Ga0207683_100429273 354
316 3300027512 Ga0209179_1002003 Ga0209179_10020032 354
317 3300028800 Ga0265338_10113309 Ga0265338_101133092 354
318 3300031241 Ga0265325_10036132 Ga0265325_100361323 354
319 3300031249 Ga0265339_10000761 Ga0265339_1000076111 354
320 3300031249 Ga0265339_10031728 Ga0265339_100317283 354
321 3300031344 Ga0265316_10094044 Ga0265316_100940442 354
322 3300031595 Ga0265313_10000116 Ga0265313_1000011653 354
323 3300031712 Ga0265342_10043737 Ga0265342_100437373 354
324 3300035111 Ga0373923_0000055 Ga0373923_0000055_15788_16882 354
325 3300035113 Ga0373936_0010830 Ga0373936_0010830_2144_3238 354
326 3300035116 Ga0373945_0006417 Ga0373945_0006417_389_1483 354
327 3300035116 Ga0373945_0011748 Ga0373945_0011748_840_1910 354
328 3300035117 Ga0373953_0005545 Ga0373953_0005545_970_2064 354
329 3300035118 Ga0373954_0010914 Ga0373954_0010914_534_1628 354
330 3300035119 Ga0373956_0003548 Ga0373956_0003548_2614_3684 354
331 3300035119 Ga0373956_0021300 Ga0373956_0021300_1075_2169 354
332 3300035120 Ga0373957_0008660 Ga0373957_0008660_1319_2413 354
333 3300035120 Ga0373957_0029646 Ga0373957_0029646_317_1387 354
334 3300035170 Ga0373943_0001550 Ga0373943_0001550_6199_7293 354
335 3300035170 Ga0373943_0128372 Ga0373943_0128372_27_1097 354
336 3300035171 Ga0373946_0007757 Ga0373946_0007757_2287_3381 354
337 3300035172 Ga0373955_0000120 Ga0373955_0000120_8645_9739 354
338 3300035172 Ga0373955_0062564 Ga0373955_0062564_374_1444 354
339 3300035410 Ga0373924_0000943 Ga0373924_0000943_7492_8586 354
340 3300035692 Ga0373935_0000045 Ga0373935_0000045_20156_21250 354
341 3300035692 Ga0373935_0034006 Ga0373935_0034006_1688_2836 354
342 3300035692 Ga0373935_0200529 Ga0373935_0200529_98_1168 354
343 3300035695 Ga0373927_0004730 Ga0373927_0004730_7021_8115 354
344 3300035695 Ga0373927_0100750 Ga0373927_0100750_242_1390 354
345 3300035695 Ga0373927_0110893 Ga0373927_0110893_191_1261 354
346 3300035724 Ga0373933_0000732 Ga0373933_0000732_18761_19855 354
347 3300035724 Ga0373933_0001118 Ga0373933_0001118_12468_13538 354
348 3300035725 Ga0373947_0002901 Ga0373947_0002901_8772_9866 354
349 3300036401 Ga0373937_0000369 Ga0373937_0000369_13058_14152 354
350 3300036401 Ga0373937_0019714 Ga0373937_0019714_1638_2708 354
351 3300036401 Ga0373937_0121497 Ga0373937_0121497_1012_2097 354
352 3300037068 Ga0373925_0000178 Ga0373925_0000178_40603_41697 354
353 3300037418 Ga0395900_0060164 Ga0395900_0060164_200_1279 354
354 3300046454 Ga0495592_0000118 Ga0495592_0000118_27650_28744 354
355 3300046454 Ga0495592_0027214 Ga0495592_0027214_319_1389 354
356 3300046455 Ga0495603_0014328 Ga0495603_0014328_1723_2871 354
357 3300046455 Ga0495603_0057482 Ga0495603_0057482_502_1572 354
358 3300046459 Ga0495629_0071550 Ga0495629_0071550_210_1280 354
359 3300046460 Ga0495638_0032721 Ga0495638_0032721_1777_2850 354
360 3300046461 Ga0495641_0017940 Ga0495641_0017940_1310_2380 354
361 3300046462 Ga0495651_0000150 Ga0495651_0000150_19192_20286 354
362 3300046462 Ga0495651_0023199 Ga0495651_0023199_2380_3450 354
363 3300046463 Ga0495653_0000138 Ga0495653_0000138_19189_20283 354
364 3300046463 Ga0495653_0059874 Ga0495653_0059874_1295_2365 354
365 3300046473 Ga0495582_0022676 Ga0495582_0022676_1258_2352 354
366 3300046476 Ga0495662_0001268 Ga0495662_0001268_7681_8775 354
367 3300046476 Ga0495662_0008513 Ga0495662_0008513_3479_4549 354
368 3300046477 Ga0495664_0000005 Ga0495664_0000005_27688_28782 354
369 3300046499 Ga0495594_0016432 Ga0495594_0016432_635_1783 354
370 3300046501 Ga0495607_0019804 Ga0495607_0019804_2199_3272 354
371 3300046511 Ga0495608_0000083 Ga0495608_0000083_27690_28784 354
372 3300046514 Ga0495618_0000079 Ga0495618_0000079_27686_28780 354
373 3300046514 Ga0495618_0011917 Ga0495618_0011917_2408_3478 354
374 3300046515 Ga0495620_0038122 Ga0495620_0038122_761_1834 354
375 3300046516 Ga0495628_0000033 Ga0495628_0000033_76022_77116 354
376 3300046516 Ga0495628_0003957 Ga0495628_0003957_12048_13118 354
377 3300046517 Ga0495630_0000490 Ga0495630_0000490_6891_7985 354
378 3300046518 Ga0495631_0020495 Ga0495631_0020495_1423_2496 354
379 3300046529 Ga0495652_0000001 Ga0495652_0000001_40603_41697 354
380 3300046530 Ga0495654_0011563 Ga0495654_0011563_3232_4305 354
381 3300046531 Ga0495665_0083051 Ga0495665_0083051_148_1218 354
382 3300046533 Ga0495640_0000010 Ga0495640_0000010_40818_41912 354
383 3300046535 Ga0495586_0178580 Ga0495586_0178580_118_1188 354
384 3300046536 Ga0495587_0000090 Ga0495587_0000090_27690_28784 354
385 3300046536 Ga0495587_0000701 Ga0495587_0000701_7504_8574 354
386 3300046543 Ga0495645_0000005 Ga0495645_0000005_27659_28753 354
387 3300046543 Ga0495645_0063341 Ga0495645_0063341_1093_2163 354
388 3300046559 Ga0495667_0000079 Ga0495667_0000079_40603_41697 354
389 3300046559 Ga0495667_0002846 Ga0495667_0002846_2221_3291 354
390 3300046642 Ga0495634_0000166 Ga0495634_0000166_31704_32798 354
391 3300046663 Ga0495635_0000055 Ga0495635_0000055_40671_41765 354
392 3300046663 Ga0495635_0029695 Ga0495635_0029695_2407_3477 354
393 3300046675 Ga0495657_0000124 Ga0495657_0000124_40594_41688 354
394 3300046675 Ga0495657_0015906 Ga0495657_0015906_1441_2511 354
395 3300046678 Ga0495599_0000075 Ga0495599_0000075_27659_28753 354
396 3300046678 Ga0495599_0001008 Ga0495599_0001008_7905_8975 354
397 3300046679 Ga0495623_0000003 Ga0495623_0000003_75973_77067 354
398 3300046679 Ga0495623_0001363 Ga0495623_0001363_14996_16066 354
399 3300046680 Ga0495646_0000042 Ga0495646_0000042_27661_28755 354
400 3300046680 Ga0495646_0002430 Ga0495646_0002430_2491_3561 354
401 3300046681 Ga0495647_0007164 Ga0495647_0007164_224_1294 354
402 3300046683 Ga0495658_0016330 Ga0495658_0016330_2042_3112 354
403 3300046683 Ga0495658_0111138 Ga0495658_0111138_174_1322 354
404 3300046689 Ga0495613_0008989 Ga0495613_0008989_1036_2130 354
405 3300046690 Ga0495624_0013220 Ga0495624_0013220_1493_2587 354
406 3300046691 Ga0495670_0019410 Ga0495670_0019410_315_1388 354
407 3300046809 Ga0495600_0000052 Ga0495600_0000052_40678_41772 354
408 3300046809 Ga0495600_0006314 Ga0495600_0006314_3432_4502 354
409 3300047315 Ga0495581_0012172 Ga0495581_0012172_1767_2861 354
410 3300047315 Ga0495581_0013986 Ga0495581_0013986_588_1658 354
411 3300047317 Ga0495604_0000010 Ga0495604_0000010_270431_271525 354
412 3300047317 Ga0495604_0002172 Ga0495604_0002172_13592_14662 354
413 3300047319 Ga0495674_0000013 Ga0495674_0000013_40603_41697 354
414 3300047319 Ga0495674_0014511 Ga0495674_0014511_2380_3450 354
415 3300047322 Ga0495680_0000275 Ga0495680_0000275_27639_28733 354
416 3300047322 Ga0495680_0005445 Ga0495680_0005445_8284_9354 354
417 3300047444 Ga0495675_0000297 Ga0495675_0000297_6949_8043 354
418 3300047444 Ga0495675_0000357 Ga0495675_0000357_5419_6489 354
419 3300047471 Ga0495684_0000008 Ga0495684_0000008_40603_41697 354
420 3300047472 Ga0495686_0107307 Ga0495686_0107307_257_1330 354
421 3300047673 Ga0495593_0002605 Ga0495593_0002605_7452_8546 354
422 3300048088 Ga0495602_0000134 Ga0495602_0000134_27668_28762 354
423 3300048088 Ga0495602_0005080 Ga0495602_0005080_4707_5777 354
424 3300048906 Ga0496103_0092133 Ga0496103_0092133_70_1140 354
425 3300048907 Ga0496104_0001371 Ga0496104_0001371_117_1187 354
426 3300048911 Ga0496108_0011807 Ga0496108_0011807_484_1554 354
427 3300048912 Ga0496109_0068996 Ga0496109_0068996_73_1143 354
428 3300048913 Ga0496110_0048559 Ga0496110_0048559_1383_2453 354
429 3300048918 Ga0496115_0085669 Ga0496115_0085669_93_1166 354
430 3300048918 Ga0496115_0093988 Ga0496115_0093988_71_1141 354
431 3300048922 Ga0496119_0027648 Ga0496119_0027648_438_1511 354
432 3300048924 Ga0496121_0004595 Ga0496121_0004595_15962_17035 354
433 3300048925 Ga0496122_0027216 Ga0496122_0027216_3367_4440 354
434 3300048928 Ga0496125_0002994 Ga0496125_0002994_12748_13821 354
435 3300048928 Ga0496125_0003669 Ga0496125_0003669_14280_15353 354
436 3300048928 Ga0496125_0021580 Ga0496125_0021580_3774_4847 354
437 3300048929 Ga0496126_0017274 Ga0496126_0017274_3988_5061 354
438 3300048929 Ga0496126_0223711 Ga0496126_0223711_306_1379 354
439 3300049571 Ga0501034_0025890 Ga0501034_0025890_1583_2656 354
440 3300049572 Ga0501036_0021852 Ga0501036_0021852_964_2037 354
441 3300049580 Ga0501046_0245895 Ga0501046_0245895_132_1205 354
442 3300049581 Ga0501047_0033448 Ga0501047_0033448_413_1486 354
443 3300049585 Ga0501069_0014660 Ga0501069_0014660_2576_3649 354
444 3300049585 Ga0501069_0044145 Ga0501069_0044145_548_1621 354
445 3300049586 Ga0501070_0001087 Ga0501070_0001087_23072_24145 354
446 3300049586 Ga0501070_0037608 Ga0501070_0037608_2648_3721 354
447 3300049588 Ga0501072_0023070 Ga0501072_0023070_2590_3663 354
448 3300049589 Ga0501073_0064941 Ga0501073_0064941_81_1154 354
449 3300049742 Ga0501080_0063098 Ga0501080_0063098_2033_3106 354
450 3300049822 Ga0501035_0000995 Ga0501035_0000995_18665_19738 354
451 3300049822 Ga0501035_0022329 Ga0501035_0022329_4443_5516 354
452 3300049823 Ga0501044_0028772 Ga0501044_0028772_91_1164 354
453 3300049823 Ga0501044_0053670 Ga0501044_0053670_1254_2327 354
454 3300050512 nmdc:mga0n895_438284_c1 nmdc:mga0n895_438284_c1_23_1237 354
455 3300050516 nmdc:mga0sz30_1197_c1 nmdc:mga0sz30_1197_c1_1851_2924 354
456 3300053077 Ga0495601_0000003 Ga0495601_0000003_40817_41911 354
457 3300053077 Ga0495601_0003691 Ga0495601_0003691_6854_7924 354
458 3300053078 Ga0495612_0000077 Ga0495612_0000077_27674_28768 354
459 3300053078 Ga0495612_0008298 Ga0495612_0008298_112_1182 354
460 3300053084 Ga0495595_0000094 Ga0495595_0000094_27680_28774 354
461 3300053084 Ga0495595_0000840 Ga0495595_0000840_2407_3477 354
462 3300053085 Ga0495619_0000091 Ga0495619_0000091_27674_28768 354
463 3300053085 Ga0495619_0002549 Ga0495619_0002549_862_1932 354
464 3300053089 Ga0500581_030013 Ga0500581_030013_551_1624 354
465 3300053094 Ga0500566_0003767 Ga0500566_0003767_7015_8088 354
466 3300053104 Ga0500556_0000004 Ga0500556_0000004_535394_536467 354
467 3300053108 Ga0500562_044219 Ga0500562_044219_48_1115 354
468 3300053121 Ga0500607_055530 Ga0500607_055530_399_1472 354
469 3300053122 Ga0500608_000945 Ga0500608_000945_6829_7902 354
470 3300053130 Ga0500642_0000037 Ga0500642_0000037_81616_82689 354
471 3300053131 Ga0500652_001278 Ga0500652_001278_3218_4291 354
472 3300053131 Ga0500652_006986 Ga0500652_006986_2520_3593 354
473 3300053136 Ga0500559_0000165 Ga0500559_0000165_18728_19801 354
474 3300053139 Ga0500568_0001069 Ga0500568_0001069_4496_5569 354
475 3300053140 Ga0500573_0109362 Ga0500573_0109362_86_1159 354
476 3300053151 Ga0500604_0001821 Ga0500604_0001821_4450_5523 354
477 3300053153 Ga0500616_0000006 Ga0500616_0000006_669664_670737 354
478 3300053153 Ga0500616_0000014 Ga0500616_0000014_509600_510673 354
479 3300053154 Ga0500619_017571 Ga0500619_017571_800_1873 354
480 3300053156 Ga0500622_0007364 Ga0500622_0007364_4303_5376 354
481 3300053177 Ga0500636_0013446 Ga0500636_0013446_2654_3727 354
482 3300053730 Ga0500645_000033 Ga0500645_000033_24922_25995 354
483 3300005364 Ga0070673_100021833 Ga0070673_1000218336 355
484 3300006042 Ga0075368_10016370 Ga0075368_100163703 355
485 3300006048 Ga0075363_100028589 Ga0075363_1000285892 355
486 3300006237 Ga0097621_100027453 Ga0097621_1000274532 355
487 3300006358 Ga0068871_100022650 Ga0068871_1000226502 355
488 3300009098 Ga0105245_10006873 Ga0105245_1000687314 355
489 3300009147 Ga0114129_10006149 Ga0114129_100061497 355
490 3300009176 Ga0105242_10034403 Ga0105242_100344032 355
491 3300025927 Ga0207687_10023486 Ga0207687_100234865 355
492 3300027866 Ga0209813_10015287 Ga0209813_100152872 355
493 3300031238 Ga0265332_10000227 Ga0265332_1000022731 355
494 3300031247 Ga0265340_10008035 Ga0265340_100080356 355
495 3300031247 Ga0265340_10009212 Ga0265340_100092124 355
496 3300031711 Ga0265314_10084970 Ga0265314_100849702 355
497 3300031712 Ga0265342_10000137 Ga0265342_1000013774 355
498 3300049582 Ga0501048_0105778 Ga0501048_0105778_91_1167 355
499 3300050490 nmdc:mga03n38_24099_c1 nmdc:mga03n38_24099_c1_805_1890 355
500 3300050494 nmdc:mga06z11_5734_c1 nmdc:mga06z11_5734_c1_3164_4249 355
501 3300050495 nmdc:mga04h51_24510_c1 nmdc:mga04h51_24510_c1_186_1271 355
502 3300050507 nmdc:mga05p37_7157_c1 nmdc:mga05p37_7157_c1_7603_8679 355
503 3300053117 Ga0500593_019012 Ga0500593_019012_987_2063 355
504 3300053131 Ga0500652_000240 Ga0500652_000240_1347_2453 355
505 3300003187 JGI25151J46595_10029420 JGI25151J46595_100294203 356
506 3300003794 Ga0055531_10002199 Ga0055531_100021994 356
507 3300013249 Ga0171463_1001 Ga0171463_1001166 356
508 3300015690 Ga0183363_1174 Ga0183363_117410 356
509 3300025294 Ga0209025_1000580 Ga0209025_100058035 356
510 3300025295 Ga0209564_1000330 Ga0209564_10003308 356
511 3300025303 Ga0209051_1001611 Ga0209051_10016114 356
512 3300025304 Ga0209257_1001713 Ga0209257_100171315 356
513 3300028794 Ga0307515_10000070 Ga0307515_10000070128 356
514 3300031456 Ga0307513_10017679 Ga0307513_100176793 356
515 3300049581 Ga0501047_0227363 Ga0501047_0227363_20_1117 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

103

215

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

227

398

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cli-assembly2.cif.gz_C x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution 0.9689 7 350
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9687 19 351
2v9y-assembly1.cif.gz_A human aminoimidazole ribonucleotide synthetase 0.9674 50 351
5vk4-assembly1.cif.gz_B crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9672 19 351
5vk4-assembly1.cif.gz_A crystal structure of a phosphoribosylformylglycinamidine cyclo-ligase from neisseria gonorrhoeae bound to amppnp and magnesium 0.9657 19 351
ID Description Score Start End Superfamily
af_G3V918_434_598_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9788 8 170 3.30.1330.10
af_P07244_618_801_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.972 173 351 3.90.650.10
2v9yB02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9616 178 351 3.90.650.10
af_G3V918_434_598_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9613 8 170 3.30.1330.10
af_Q2FZI8_168_339_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9602 176 348 3.90.650.10
ID Description Score Start End GO Terms
AF-W1L8Y0-F1-model_v4 deleted 0.9959 93 356
AF-A0A531J1C3-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9925 62 262 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-A0A259A3L4-F1-model_v4 Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) 0.9893 45 268 GO:0004637
GO:0004641
GO:0005524
GO:0005829
GO:0006189
GO:0046084
AF-W1L8Y0-F1-model_v4 deleted 0.9884 93 356
AF-A0A440E3E9-F1-model_v4 deleted 0.9879 35 356

Feature Viewer

pLDDT pTM Quality
92.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map