F457720

General Info

Members Datasets Scaffolds Average Seq Length
514 389 1028 116

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10007862|Ga0157379_100078629
Length 142
Sequence MSESDDSFELYDLRVEIVVPKDNQQRILCGAKEGDYFEVKGEMITMPENQGFSMYSLGKLINFANFHLATSIGIFLAAVLPLLAAKQRCRDKNDWMWTDALVACPDPNCPTKLRIVRTDLRVFKHGDTTVVPLEAKEVAVKE

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
137 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
220 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
225 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
226 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
227 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
228 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
229 2512875024
230 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
231 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
232 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
233 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
234 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
235 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
236 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
237 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
238 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
239 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
240 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
241 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
242 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
243 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
244 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
245 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
246 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
247 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
248 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
249 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
250 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
251 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
252 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
253 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
254 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
255 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
256 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
257 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
258 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
259 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
260 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
261 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
262 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
263 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
264 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
265 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
266 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
267 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
268 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
269 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
270 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
271 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
272 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
273 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
274 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
275 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
276 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
277 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
278 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
279 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
280 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
281 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
282 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
283 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
284 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
285 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
286 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
287 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
288 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
289 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
290 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
291 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
292 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
293 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
294 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
295 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
296 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
297 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
298 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
299 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
300 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
301 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
302 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
303 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
304 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
305 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
306 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
307 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
308 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
309 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
310 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
311 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
312 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
313 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
314 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
315 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
316 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
317 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
318 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
319 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
320 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
321 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
322 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
323 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
324 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
325 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
326 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
327 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
328 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
329 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
330 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
331 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
332 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
333 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
334 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
335 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
336 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
337 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
338 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
339 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
340 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
341 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
342 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
343 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
344 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
345 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
346 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
347 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
348 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
349 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
350 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
351 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
352 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
353 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
354 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
355 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
356 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
357 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
358 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
359 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
360 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
361 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
362 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
363 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
364 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
365 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
366 3004167301 Mesorhizobium loti 582 Isolate Unclassified
367 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
368 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
369 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
370 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
371 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
372 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
373 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
374 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
375 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
376 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
377 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
378 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
379 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
380 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
381 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
382 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
383 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
384 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
385 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
386 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
387 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
388 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
389 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.7
Metatranscriptomes 0
Isolates 32.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.04
Nodule 26.46
Rhizoplane 3.7
Rhizosphere 43.19
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10007862 3300014968 Eukaryota 9238
2 JGI24740J21852_10014790 3300001979 Bacteria 2867
3 JGI24740J21852_10064824 3300001979 Bacteria 996
4 JGI25156J39149_1001407 3300002705 Bacteria 10250
5 JGI25162J39368_1000317 3300002737 Bacteria 42748
6 JGI25162J39368_1000475 3300002737 Bacteria 30839
7 JGI25157J39369_1000357 3300002741 Bacteria 31924
8 JGI25151J46595_10002774 3300003187 Bacteria 10164
9 JGI25406J46586_10008371 3300003203 Bacteria 4688
10 JGI25165J46597_1000033 3300003214 Bacteria 293030
11 JGI25165J46597_1000087 3300003214 Bacteria 170335
12 JGI25165J46597_1000432 3300003214 Bacteria 42748
13 JGI25165J46597_1001389 3300003214 Bacteria 13260
14 JGI25165J46597_1002216 3300003214 Bacteria 6811
15 rootH2_10062104 3300003320 Bacteria 3228
16 rootL2_10012352 3300003322 Bacteria 37933
17 Ga0055542_1000525 3300003762 Bacteria 34459
18 Ga0055529_1011998 3300003763 Bacteria 1112
19 Ga0065707_10632132 3300005295 Bacteria 673
20 Ga0070676_10296891 3300005328 Bacteria 1094
21 Ga0070670_100000464 3300005331 Bacteria 32824
22 Ga0068868_102046955 3300005338 Bacteria 544
23 Ga0070660_100136721 3300005339 Bacteria 1964
24 Ga0070669_100157270 3300005353 Bacteria 1764
25 Ga0070674_100008691 3300005356 Bacteria 6057
26 Ga0070674_100239030 3300005356 Bacteria 1421
27 Ga0070674_100276180 3300005356 Bacteria 1330
28 Ga0070694_101355810 3300005444 Bacteria 599
29 Ga0070678_100746201 3300005456 Bacteria 885
30 Ga0070707_100006470 3300005468 Bacteria 10884
31 Ga0070698_100296840 3300005471 Bacteria 1547
32 Ga0070699_100209959 3300005518 Bacteria 1733
33 Ga0068853_100573231 3300005539 Bacteria 1070
34 Ga0070665_100005792 3300005548 Bacteria 12679
35 Ga0070665_100035728 3300005548 Bacteria 4998
36 Ga0070665_100436547 3300005548 Bacteria 1319
37 Ga0070665_101554860 3300005548 Bacteria 670
38 Ga0068855_101265941 3300005563 Bacteria 765
39 Ga0068854_100988792 3300005578 Bacteria 744
40 Ga0068856_100114339 3300005614 Bacteria 2698
41 Ga0068866_10109261 3300005718 Bacteria 1540
42 Ga0068866_10594445 3300005718 Bacteria 746
43 Ga0068851_10874977 3300005834 Bacteria 562
44 Ga0068862_100062786 3300005844 Bacteria 3195
45 Ga0068862_101985348 3300005844 Bacteria 592
46 Ga0081455_10560203 3300005937 Bacteria 754
47 Ga0081540_1121321 3300005983 Bacteria 1084
48 Ga0075365_10226668 3300006038 Bacteria 1311
49 Ga0075363_100117847 3300006048 Bacteria 1480
50 Ga0075363_100427476 3300006048 Bacteria 780
51 Ga0075363_100574993 3300006048 Bacteria 674
52 Ga0075367_10104662 3300006178 Bacteria 1733
53 Ga0075367_10224855 3300006178 Bacteria 1175
54 Ga0075367_10243545 3300006178 Bacteria 1127
55 Ga0075367_10340827 3300006178 Bacteria 945
56 Ga0075367_10817202 3300006178 Bacteria 594
57 Ga0097621_101383689 3300006237 Bacteria 666
58 Ga0068871_101772091 3300006358 Bacteria 586
59 Ga0075428_100197465 3300006844 Bacteria 2176
60 Ga0068865_101217872 3300006881 Bacteria 667
61 Ga0075435_100671023 3300007076 Bacteria 900
62 Ga0105251_10618187 3300009011 Bacteria 515
63 Ga0105240_10016175 3300009093 Bacteria 10111
64 Ga0105240_10167066 3300009093 Bacteria 2609
65 Ga0105240_10501670 3300009093 Bacteria 1349
66 Ga0105240_10803647 3300009093 Bacteria 1019
67 Ga0105240_11041107 3300009093 Bacteria 873
68 Ga0105240_11530018 3300009093 Bacteria 699
69 Ga0105240_11721549 3300009093 Bacteria 654
70 Ga0105240_12636980 3300009093 Bacteria 519
71 Ga0111539_10086871 3300009094 Bacteria 3675
72 Ga0105245_10243676 3300009098 Bacteria 1744
73 Ga0105245_10655314 3300009098 Bacteria 1080
74 Ga0105245_12742651 3300009098 Bacteria 546
75 Ga0105243_10074354 3300009148 Bacteria 2756
76 Ga0105243_10712092 3300009148 Bacteria 980
77 Ga0105243_10728447 3300009148 Bacteria 970
78 Ga0105241_10431096 3300009174 Bacteria 1162
79 Ga0105241_10991755 3300009174 Bacteria 785
80 Ga0105241_11401795 3300009174 Bacteria 669
81 Ga0105242_12079054 3300009176 Bacteria 611
82 Ga0105237_10198100 3300009545 Bacteria 2008
83 Ga0105237_11368542 3300009545 Bacteria 714
84 Ga0105238_10290815 3300009551 Bacteria 1616
85 Ga0105238_12796896 3300009551 Bacteria 524
86 Ga0105238_13009171 3300009551 Bacteria 506
87 Ga0105249_10277213 3300009553 Bacteria 1673
88 Ga0105249_12740643 3300009553 Bacteria 565
89 Ga0105249_13002713 3300009553 Bacteria 542
90 Ga0105239_10496793 3300010375 Bacteria 1387
91 Ga0105239_10591667 3300010375 Bacteria 1265
92 Ga0105246_10862107 3300011119 Bacteria 809
93 Ga0157371_10472159 3300013102 Bacteria 924
94 Ga0157370_10656156 3300013104 Bacteria 959
95 Ga0157369_10865124 3300013105 Bacteria 928
96 Ga0157369_11568753 3300013105 Bacteria 670
97 Ga0157374_11094120 3300013296 Bacteria 817
98 Ga0157378_10394479 3300013297 Bacteria 1362
99 Ga0163162_12905759 3300013306 Bacteria 551
100 Ga0157372_10807863 3300013307 Bacteria 1090
101 Ga0157375_10727011 3300013308 Bacteria 1145
102 Ga0163163_10279540 3300014325 Bacteria 1721
103 Ga0163163_10321941 3300014325 Bacteria 1600
104 Ga0157380_10071444 3300014326 Bacteria 2807
105 Ga0182008_10132286 3300014497 Bacteria 1244
106 Ga0157379_10570168 3300014968 Bacteria 1054
107 Ga0157379_10641557 3300014968 Bacteria 994
108 Ga0157376_10634067 3300014969 Bacteria 1067
109 Ga0157376_11150126 3300014969 Bacteria 803
110 Ga0182006_1073222 3300015261 Bacteria 1265
111 Ga0182005_1060974 3300015265 Bacteria 1030
112 Ga0163161_11011929 3300017792 Bacteria 710
113 Ga0213872_10003862 3300021361 Bacteria 8140
114 Ga0207427_102184 3300025231 Bacteria 5549
115 Ga0209437_100042 3300025233 Bacteria 444095
116 Ga0209437_100341 3300025233 Bacteria 56114
117 Ga0209646_1003375 3300025246 Bacteria 3173
118 Ga0209026_1000005 3300025250 Bacteria 731387
119 Ga0209026_1020530 3300025250 Bacteria 1026
120 Ga0209148_1000057 3300025254 Bacteria 360463
121 Ga0209148_1007893 3300025254 Bacteria 2175
122 Ga0209759_1000111 3300025256 Bacteria 143545
123 Ga0209233_1000027 3300025261 Bacteria 652089
124 Ga0209233_1000103 3300025261 Bacteria 284123
125 Ga0209233_1000355 3300025261 Bacteria 42800
126 Ga0209233_1000425 3300025261 Bacteria 31099
127 Ga0209455_1000131 3300025272 Bacteria 160715
128 Ga0209455_1014598 3300025272 Bacteria 1769
129 Ga0207642_10649179 3300025899 Bacteria 661
130 Ga0207645_10104191 3300025907 Bacteria 1832
131 Ga0207654_10523437 3300025911 Bacteria 840
132 Ga0207695_10004986 3300025913 Bacteria 17866
133 Ga0207695_10203776 3300025913 Bacteria 1891
134 Ga0207695_10450479 3300025913 Bacteria 1170
135 Ga0207695_10615944 3300025913 Bacteria 967
136 Ga0207671_10140972 3300025914 Bacteria 1857
137 Ga0207671_10869647 3300025914 Bacteria 713
138 Ga0207657_10081170 3300025919 Bacteria 2725
139 Ga0207657_10382630 3300025919 Bacteria 1108
140 Ga0207646_10098071 3300025922 Bacteria 2626
141 Ga0207681_10137481 3300025923 Bacteria 1815
142 Ga0207694_10191399 3300025924 Bacteria 1662
143 Ga0207694_10756693 3300025924 Bacteria 820
144 Ga0207650_10000978 3300025925 Bacteria 21510
145 Ga0207690_10312678 3300025932 Bacteria 1232
146 Ga0207709_10404391 3300025935 Bacteria 1045
147 Ga0207709_11709792 3300025935 Bacteria 523
148 Ga0207669_10049283 3300025937 Bacteria 2509
149 Ga0207669_10278582 3300025937 Bacteria 1260
150 Ga0207669_10331731 3300025937 Bacteria 1168
151 Ga0207704_11360872 3300025938 Bacteria 608
152 Ga0207667_10673681 3300025949 Bacteria 1038
153 Ga0207712_11437486 3300025961 Bacteria 617
154 Ga0207712_11919557 3300025961 Bacteria 530
155 Ga0207640_11443368 3300025981 Bacteria 617
156 Ga0207678_10117935 3300026067 Bacteria 2265
157 Ga0207702_10044295 3300026078 Bacteria 3740
158 Ga0207702_11999099 3300026078 Bacteria 570
159 Ga0207648_10033829 3300026089 Bacteria 4507
160 Ga0207648_10118890 3300026089 Bacteria 2323
161 Ga0207675_100961107 3300026118 Bacteria 872
162 Ga0207683_10857567 3300026121 Bacteria 843
163 Ga0209371_1030974 3300027312 Bacteria 1166
164 Ga0268266_10025066 3300028379 Bacteria 5076
165 Ga0268266_10099219 3300028379 Bacteria 2563
166 Ga0268266_10469418 3300028379 Bacteria 1198
167 Ga0268266_11269285 3300028379 Bacteria 712
168 Ga0268266_11540889 3300028379 Bacteria 640
169 Ga0268265_10122181 3300028380 Bacteria 2147
170 Ga0265334_10294164 3300028573 Unclassified 556
171 Ga0265318_10003503 3300028577 Bacteria 7866
172 Ga0307517_10000124 3300028786 Bacteria 115570
173 Ga0307515_10000130 3300028794 Bacteria 179263
174 Ga0307515_10026795 3300028794 Bacteria 9893
175 Ga0307515_10580565 3300028794 Bacteria 731
176 Ga0268256_1030163 3300030500 Bacteria 1317
177 Ga0307512_10345112 3300030522 Unclassified 660
178 Ga0265332_10076201 3300031238 Bacteria 1425
179 Ga0265320_10048525 3300031240 Bacteria 2071
180 Ga0265340_10057168 3300031247 Bacteria 1875
181 Ga0265331_10293994 3300031250 Bacteria 728
182 Ga0265327_10022592 3300031251 Bacteria 3753
183 Ga0265316_10084171 3300031344 Bacteria 2436
184 Ga0307513_10174731 3300031456 Bacteria 2020
185 Ga0307513_10213026 3300031456 Unclassified 1761
186 Ga0307513_10385961 3300031456 Bacteria 1139
187 Ga0307513_10407659 3300031456 Bacteria 1092
188 Ga0307513_10740119 3300031456 Bacteria 689
189 Ga0265313_10070727 3300031595 Bacteria 1607
190 Ga0265314_10014569 3300031711 Bacteria 6280
191 Ga0307410_10098203 3300031852 Bacteria 2094
192 Ga0307406_10482741 3300031901 Bacteria 1001
193 Ga0307412_10578393 3300031911 Bacteria 948
194 Ga0307409_100027283 3300031995 Bacteria 4045
195 Ga0307409_102900098 3300031995 Bacteria 506
196 Ga0307416_100660961 3300032002 Bacteria 1131
197 Ga0307411_10316054 3300032005 Bacteria 1259
198 Ga0307510_10529132 3300033180 Bacteria 623
199 Ga0395900_0012991 3300037418 Bacteria 8509
200 Ga0395900_0149943 3300037418 Bacteria 2383
201 Ga0395900_0998380 3300037418 Bacteria 757
202 Ga0395898_0654948 3300037466 Bacteria 993
203 Ga0395905_0015103 3300037471 Bacteria 7351
204 Ga0395905_0024284 3300037471 Bacteria 5721
205 Ga0395905_0032491 3300037471 Bacteria 4908
206 Ga0395905_0067028 3300037471 Bacteria 3362
207 Ga0395905_0128892 3300037471 Bacteria 2379
208 Ga0395905_0261321 3300037471 Bacteria 1616
209 Ga0395905_0265532 3300037471 Bacteria 1602
210 Ga0395901_0116685 3300038443 Bacteria 2804
211 Ga0395901_0337795 3300038443 Bacteria 1556
212 Ga0395901_0510317 3300038443 Bacteria 1223
213 Ga0436365_1046199 3300039437 Unclassified 1076
214 Ga0436361_0010669 3300039447 Bacteria 7179
215 Ga0436363_0531416 3300039450 Bacteria 1309
216 Ga0436363_1211656 3300039450 Bacteria 3220
217 Ga0436362_0927742 3300039453 Bacteria 1093
218 Ga0451789_1231662 3300041443 Bacteria 551
219 Ga0451795_0636575 3300041456 Bacteria 575
220 Ga0451851_0065769 3300041507 Bacteria 620
221 Ga0451855_1823835 3300041511 Bacteria 752
222 Ga0451853_1850283 3300041512 Bacteria 1118
223 Ga0466966_0206402 3300044684 Bacteria 1188
224 Ga0466963_0015215 3300044694 Bacteria 4759
225 Ga0466964_0569545 3300044706 Bacteria 617
226 Ga0466971_0130626 3300044719 Bacteria 1166
227 Ga0466970_0000068 3300044765 Bacteria 41262
228 Ga0466958_0015706 3300045836 Bacteria 4346
229 Ga0466967_1260539 3300045976 Bacteria 736
230 Ga0495592_0199088 3300046454 Bacteria 1353
231 Ga0495638_0024559 3300046460 Bacteria 3928
232 Ga0495638_0255999 3300046460 Bacteria 963
233 Ga0495638_0280918 3300046460 Bacteria 905
234 Ga0495638_0503349 3300046460 Bacteria 610
235 Ga0495638_0574047 3300046460 Bacteria 557
236 Ga0495641_0010635 3300046461 Eukaryota 5311
237 Ga0495662_0079076 3300046476 Bacteria 1598
238 Ga0495664_0165378 3300046477 Bacteria 1342
239 Ga0495596_0111180 3300046500 Bacteria 1064
240 Ga0495606_0009701 3300046507 Bacteria 8102
241 Ga0495608_0010937 3300046511 Eukaryota 6325
242 Ga0495618_0112918 3300046514 Eukaryota 1739
243 Ga0495620_0185651 3300046515 Bacteria 803
244 Ga0495628_0097783 3300046516 Eukaryota 2267
245 Ga0495628_0286596 3300046516 Bacteria 1222
246 Ga0495648_0280611 3300046524 Bacteria 790
247 Ga0495652_0001601 3300046529 Eukaryota 24733
248 Ga0495587_0059763 3300046536 Bacteria 2236
249 Ga0495667_0989327 3300046559 Eukaryota 513
250 Ga0495668_0062889 3300046616 Bacteria 2045
251 Ga0495625_0063590 3300046660 Bacteria 2605
252 Ga0495625_0445737 3300046660 Bacteria 801
253 Ga0495635_0132098 3300046663 Eukaryota 1702
254 Ga0495657_0017539 3300046675 Eukaryota 5195
255 Ga0495624_0107077 3300046690 Bacteria 1720
256 Ga0495670_0546270 3300046691 Bacteria 630
257 Ga0495600_0077054 3300046809 Eukaryota 2177
258 Ga0495604_0236132 3300047317 Bacteria 1252
259 Ga0495676_0072161 3300047321 Eukaryota 2652
260 Ga0495680_0037648 3300047322 Eukaryota 3874
261 Ga0495686_0040938 3300047472 Bacteria 2952
262 Ga0495686_0095413 3300047472 Bacteria 1801
263 Ga0495593_0612598 3300047673 Eukaryota 546
264 Ga0495602_0001753 3300048088 Eukaryota 21658
265 Ga0495602_0893204 3300048088 Bacteria 592
266 Ga0496100_0608122 3300048903 Bacteria 849
267 Ga0496102_0923280 3300048905 Bacteria 794
268 Ga0496106_0318123 3300048909 Bacteria 1249
269 Ga0496106_0988387 3300048909 Bacteria 662
270 Ga0496110_0054325 3300048913 Bacteria 3523
271 Ga0496110_0308357 3300048913 Bacteria 1442
272 Ga0496110_1342564 3300048913 Bacteria 624
273 Ga0496110_1433641 3300048913 Bacteria 600
274 Ga0496111_0000707 3300048914 Bacteria 17688
275 Ga0496111_0367779 3300048914 Bacteria 1064
276 Ga0496112_0386802 3300048915 Bacteria 1339
277 Ga0496113_0723812 3300048916 Bacteria 793
278 Ga0496113_1538884 3300048916 Bacteria 513
279 Ga0496114_0236456 3300048917 Bacteria 1606
280 Ga0496115_0266804 3300048918 Bacteria 1407
281 Ga0496117_0244094 3300048920 Bacteria 984
282 Ga0496117_0285815 3300048920 Bacteria 881
283 Ga0496117_0616890 3300048920 Bacteria 505
284 Ga0496118_0247569 3300048921 Bacteria 1015
285 Ga0496118_0484536 3300048921 Bacteria 619
286 Ga0496119_0002306 3300048922 Bacteria 21071
287 Ga0496120_0046580 3300048923 Bacteria 2505
288 Ga0496120_0151861 3300048923 Bacteria 1163
289 Ga0496121_0017153 3300048924 Bacteria 7417
290 Ga0496121_0315043 3300048924 Bacteria 1056
291 Ga0496121_0805097 3300048924 Bacteria 552
292 Ga0496121_0900692 3300048924 Bacteria 509
293 Ga0496122_0232358 3300048925 Bacteria 1047
294 Ga0496122_0379842 3300048925 Bacteria 725
295 Ga0496123_0017795 3300048926 Bacteria 5693
296 Ga0496123_0041510 3300048926 Bacteria 3188
297 Ga0496125_0118553 3300048928 Bacteria 1895
298 Ga0496126_0049769 3300048929 Bacteria 3824
299 Ga0496126_0469006 3300048929 Bacteria 1011
300 Ga0501032_0321874 3300049569 Bacteria 998
301 Ga0501034_0615779 3300049571 Bacteria 990
302 Ga0501047_0432565 3300049581 Bacteria 1147
303 Ga0501047_0604722 3300049581 Bacteria 918
304 Ga0501069_0579094 3300049585 Bacteria 673
305 Ga0501071_0712963 3300049587 Bacteria 773
306 Ga0501280_001525 3300049776 Bacteria 4229
307 Ga0501035_0544305 3300049822 Bacteria 951
308 Ga0501035_1188512 3300049822 Bacteria 592
309 nmdc:mga03n38_210706_c1 3300050490 Bacteria 1010
310 nmdc:mga03n38_782098_c1 3300050490 Bacteria 555
311 nmdc:mga03n38_79638_c1 3300050490 Bacteria 1537
312 nmdc:mga0yw44_14287_c1 3300050492 Bacteria 4212
313 nmdc:mga0yw44_778779_c1 3300050492 Bacteria 650
314 nmdc:mga0yw44_941950_c1 3300050492 Bacteria 585
315 nmdc:mga06z11_212755_c1 3300050494 Bacteria 1127
316 nmdc:mga04h51_479356_c1 3300050495 Bacteria 529
317 nmdc:mga08y16_60533_c1 3300050511 Bacteria 3954
318 nmdc:mga0sz30_169693_c1 3300050516 Bacteria 967
319 Ga0495601_0093494 3300053077 Bacteria 1937
320 Ga0500610_0253538 3300053079 Bacteria 809
321 Ga0500643_014130 3300053087 Bacteria 2788
322 Ga0500644_0003128 3300053088 Bacteria 4098
323 Ga0500592_061299 3300053116 Bacteria 616
324 Ga0500595_030734 3300053119 Bacteria 1807
325 Ga0500652_213430 3300053131 Bacteria 779
326 Ga0500658_0068870 3300053134 Bacteria 1489
327 Ga0500658_0297556 3300053134 Bacteria 742
328 Ga0500658_0459190 3300053134 Bacteria 579
329 Ga0500559_0004272 3300053136 Bacteria 6835
330 Ga0500568_0000692 3300053139 Bacteria 24290
331 Ga0500568_0055106 3300053139 Bacteria 1553
332 Ga0500568_0120681 3300053139 Bacteria 977
333 Ga0500604_0007578 3300053151 Bacteria 2876
334 Ga0500604_0236193 3300053151 Bacteria 632
335 Ga0500604_0257049 3300053151 Bacteria 605
336 Ga0500616_0035209 3300053153 Bacteria 2724
337 Ga0500620_000148 3300053155 Bacteria 14078
338 Ga0500622_0002146 3300053156 Bacteria 14643
339 Ga0500627_0123984 3300053158 Bacteria 1166
340 Ga0500627_0153066 3300053158 Bacteria 1041
341 Ga0500627_0239946 3300053158 Bacteria 804
342 Ga0500627_0242269 3300053158 Bacteria 800
343 Ga0500630_287383 3300053159 Bacteria 544
344 Ga0500636_0372624 3300053177 Bacteria 673
345 Ga0500611_039421 3300053727 Bacteria 1029
346 Ga0500611_095964 3300053727 Bacteria 761
347 Ga0500611_113683 3300053727 Bacteria 714
348 Ga0466962_0071046 3300061719 Bacteria 1663
349 2503203923 2503198000 Bacteria 6884444
350 2509369281 2509276018 Bacteria 6910194
351 2509398267 2509276022 Bacteria 6200534
352 2510316830 2510065059 Bacteria 6847884
353 2512929263 2512875016 Bacteria 6529530
354 2512964075 2512875024 Bacteria 7195110
355 2514034182 2513237164 Bacteria 7563725
356 2535518427 2534681796 Bacteria 7146037
357 2588514818 2588253730 Bacteria 6881675
358 2597815580 2597489875 Bacteria 7010078
359 2599940307 2599185301 Bacteria 6161860
360 2617381161 2617270742 Bacteria 6808054
361 2643986321 2643221595 Bacteria 6565519
362 2644152553 2643221627 Bacteria 6761570
363 2671116709 2667528174 Bacteria 6435400
364 2688600633 2687453392 Bacteria 6880454
365 2738945132 2738541317 Bacteria 5340176
366 2756672753 2756170246 Bacteria 7451806
367 2792745786 2791355123 Bacteria 8049106
368 2819607680 2818991448 Bacteria 6772224
369 2841735322 2841734538 Bacteria 6784580
370 2844005210 2844002411 Bacteria 7168230
371 2844015974 2844009547 Bacteria 6728125
372 2856330236 2856328259 Bacteria 6528202
373 2857354558 2857349434 Bacteria 7926032
374 2869168943 2869162929 Bacteria 6399702
375 2869171667 2869169390 Bacteria 6659796
376 2869241139 2869234852 Bacteria 6654993
377 2869246124 2869242130 Bacteria 6609239
378 2869255686 2869249662 Bacteria 6868783
379 2869259548 2869256925 Bacteria 6981691
380 2869269555 2869264136 Bacteria 6880765
381 2869273596 2869271264 Bacteria 6908218
382 2869284030 2869278585 Bacteria 7077053
383 2871442090 2871435913 Bacteria 6880295
384 2871454464 2871451962 Bacteria 7336357
385 2871460517 2871459585 Bacteria 6866887
386 2871473016 2871466892 Bacteria 6923287
387 2871479162 2871474448 Bacteria 6806570
388 2871485569 2871481445 Bacteria 6700002
389 2874111240 2874109183 Bacteria 6517025
390 2874121004 2874116593 Bacteria 6674494
391 2874132187 2874131515 Bacteria 6820270
392 2874144649 2874139085 Bacteria 7021506
393 2874164306 2874162495 Bacteria 6174670
394 2876367181 2876363079 Bacteria 6544991
395 2876391196 2876386047 Bacteria 6698674
396 2876404089 2876399893 Bacteria 6927900
397 2876406932 2876406927 Bacteria 6191900
398 2876423733 2876420981 Bacteria 6687741
399 2878736719 2878730984 Bacteria 6380721
400 2878743976 2878738818 Bacteria 7136951
401 2878779428 2878774303 Bacteria 6108671
402 2878785175 2878781027 Bacteria 6834456
403 2878795402 2878788777 Bacteria 6567085
404 2881158200 2881155292 Bacteria 6461656
405 2881860462 2881853255 Bacteria 6698367
406 2882637074 2882632389 Bacteria 8154593
407 2885315597 2885312484 Bacteria 6415165
408 2885344874 2885342637 Bacteria 7011821
409 2885354554 2885350715 Bacteria 6787678
410 2888349320 2888343758 Bacteria 6611049
411 2889011626 2889010040 Bacteria 6749192
412 2899805172 2899803654 Bacteria 5577784
413 2903453351 2903448605 Bacteria 7357801
414 2903526672 2903521522 Bacteria 6525694
415 2903530709 2903528002 Bacteria 6586099
416 2906367442 2906363423 Bacteria 6856682
417 2906373080 2906370794 Bacteria 6881062
418 2906384516 2906378014 Bacteria 6911440
419 2906390869 2906386501 Bacteria 5977019
420 2906396751 2906393657 Bacteria 6790866
421 2906403711 2906401398 Bacteria 6693206
422 2906412240 2906408224 Bacteria 6162342
423 2906430216 2906427513 Bacteria 6375796
424 2913309758 2913308742 Bacteria 5350706
425 2919414152 2919408235 Bacteria 6149349
426 2922153290 2922151315 Bacteria 6902399
427 2922175475 2922172374 Bacteria 6167644
428 2922183303 2922178524 Bacteria 6025201
429 2924713027 2924710171 Bacteria 6752351
430 2924719506 2924718760 Bacteria 6331356
431 2924743887 2924741084 Bacteria 6661321
432 2924752014 2924748358 Bacteria 6154725
433 2924781893 2924776078 Bacteria 7492003
434 2937822898 2937822353 Bacteria 7290551
435 2937842137 2937836603 Bacteria 6811263
436 2937850299 2937848649 Bacteria 6983481
437 2937868703 2937861824 Bacteria 6660327
438 2937869177 2937868953 Bacteria 6639878
439 2937884778 2937877337 Bacteria 7246526
440 2937978051 2937972304 Bacteria 7532020
441 2937987534 2937980651 Bacteria 6517427
442 2958040419 2958034702 Bacteria 6989922
443 2958055267 2958041894 Bacteria 13082850
444 2958065080 2958064165 Bacteria 7158582
445 2958075681 2958071322 Bacteria 6815895
446 2958092087 2958084443 Bacteria 7312792
447 2958097121 2958092219 Bacteria 6861151
448 2958114639 2958108152 Bacteria 6681128
449 2958138566 2958137437 Bacteria 6050276
450 2958150634 2958144490 Bacteria 6677056
451 2958162607 2958158011 Bacteria 6058449
452 2961135196 2961127735 Bacteria 7196641
453 2961137492 2961136820 Bacteria 6775228
454 2961190553 2961183825 Bacteria 6688536
455 2963649974 2963644680 Bacteria 6530403
456 2965027027 2965025482 Bacteria 6532201
457 2965045899 2965040258 Bacteria 6855979
458 2965049431 2965047637 Bacteria 6623551
459 2965095833 2965089291 Bacteria 6866420
460 2965108880 2965102966 Bacteria 6800987
461 2965118802 2965110997 Bacteria 6693150
462 2968021955 2968016561 Bacteria 7022047
463 2968086715 2968083720 Bacteria 7351627
464 2968141250 2968138860 Bacteria 6605449
465 2970474545 2970469710 Bacteria 6969209
466 2970491854 2970489779 Bacteria 6517260
467 2970514701 2970510686 Bacteria 7006402
468 2970538356 2970532167 Bacteria 6553173
469 2970546265 2970540015 Bacteria 6977556
470 2970549731 2970547951 Bacteria 6931819
471 2970598642 2970593180 Bacteria 7073582
472 2970626426 2970619444 Bacteria 6986144
473 2970628624 2970627176 Bacteria 6680862
474 2977855673 2977851361 Bacteria 6694324
475 2977913827 2977907340 Bacteria 6577984
476 2977921343 2977915119 Bacteria 6829656
477 2977928004 2977922695 Bacteria 6956781
478 2977941180 2977935797 Bacteria 6252826
479 2977946338 2977942078 Bacteria 7570577
480 2977957294 2977950692 Bacteria 6893264
481 2977992858 2977986579 Bacteria 6581278
482 2979767279 2979764755 Bacteria 6610066
483 2979779205 2979772303 Bacteria 6618277
484 2979795023 2979793036 Bacteria 6808957
485 2987643160 2987636660 Bacteria 8088555
486 2987648031 2987645492 Bacteria 6117018
487 2987675220 2987673487 Bacteria 6884027
488 2996353954 2996348954 Bacteria 7239054
489 2996391254 2996386984 Bacteria 6978667
490 3000141064 3000135777 Bacteria 6891109
491 3004171514 3004167301 Bacteria 8330599
492 3004202614 3004195979 Bacteria 6776956
493 3004206708 3004203850 Bacteria 7307914
494 3004213604 3004211236 Bacteria 7417683
495 3004223195 3004218560 Bacteria 7421728
496 3004239107 3004232784 Bacteria 6662140
497 3004251166 3004248173 Bacteria 6563236
498 3004270262 3004268573 Bacteria 7043476
499 3004280622 3004275668 Bacteria 7114440
500 3004292847 3004289098 Bacteria 6135450
501 3004338773 3004334049 Bacteria 8449246
502 637079020 637000159 Bacteria 7596297
503 649875085 649633066 Bacteria 6690028
504 8004303596 8004300914 Bacteria 6132239
505 8004316552 8004312739 Bacteria 7444653
506 8004365919 8004361976 Bacteria 6858373
507 8004636858 8004633249 Bacteria 6723080
508 8004643655 8004640170 Bacteria 6723001
509 8004733796 8004727605 Bacteria 6643904
510 8005486289 8005484373 Bacteria 6297373
511 8005549345 8005542996 Bacteria 7077758
512 8005650751 8005645114 Bacteria 6950293
513 8005683510 8005682033 Bacteria 6726518
514 8024489076 8024486573 Bacteria 6540512
515 Ga0157379_10007862
516 JGI24740J21852_10014790
517 JGI24740J21852_10064824
518 JGI25156J39149_1001407
519 JGI25162J39368_1000317
520 JGI25162J39368_1000475
521 JGI25157J39369_1000357
522 JGI25151J46595_10002774
523 JGI25406J46586_10008371
524 JGI25165J46597_1000033
525 JGI25165J46597_1000087
526 JGI25165J46597_1000432
527 JGI25165J46597_1001389
528 JGI25165J46597_1002216
529 rootH2_10062104
530 rootL2_10012352
531 Ga0055542_1000525
532 Ga0055529_1011998
533 Ga0065707_10632132
534 Ga0070676_10296891
535 Ga0070670_100000464
536 Ga0068868_102046955
537 Ga0070660_100136721
538 Ga0070669_100157270
539 Ga0070674_100008691
540 Ga0070674_100239030
541 Ga0070674_100276180
542 Ga0070694_101355810
543 Ga0070678_100746201
544 Ga0070707_100006470
545 Ga0070698_100296840
546 Ga0070699_100209959
547 Ga0068853_100573231
548 Ga0070665_100005792
549 Ga0070665_100035728
550 Ga0070665_100436547
551 Ga0070665_101554860
552 Ga0068855_101265941
553 Ga0068854_100988792
554 Ga0068856_100114339
555 Ga0068866_10109261
556 Ga0068866_10594445
557 Ga0068851_10874977
558 Ga0068862_100062786
559 Ga0068862_101985348
560 Ga0081455_10560203
561 Ga0081540_1121321
562 Ga0075365_10226668
563 Ga0075363_100117847
564 Ga0075363_100427476
565 Ga0075363_100574993
566 Ga0075367_10104662
567 Ga0075367_10224855
568 Ga0075367_10243545
569 Ga0075367_10340827
570 Ga0075367_10817202
571 Ga0097621_101383689
572 Ga0068871_101772091
573 Ga0075428_100197465
574 Ga0068865_101217872
575 Ga0075435_100671023
576 Ga0105251_10618187
577 Ga0105240_10016175
578 Ga0105240_10167066
579 Ga0105240_10501670
580 Ga0105240_10803647
581 Ga0105240_11041107
582 Ga0105240_11530018
583 Ga0105240_11721549
584 Ga0105240_12636980
585 Ga0111539_10086871
586 Ga0105245_10243676
587 Ga0105245_10655314
588 Ga0105245_12742651
589 Ga0105243_10074354
590 Ga0105243_10712092
591 Ga0105243_10728447
592 Ga0105241_10431096
593 Ga0105241_10991755
594 Ga0105241_11401795
595 Ga0105242_12079054
596 Ga0105237_10198100
597 Ga0105237_11368542
598 Ga0105238_10290815
599 Ga0105238_12796896
600 Ga0105238_13009171
601 Ga0105249_10277213
602 Ga0105249_12740643
603 Ga0105249_13002713
604 Ga0105239_10496793
605 Ga0105239_10591667
606 Ga0105246_10862107
607 Ga0157371_10472159
608 Ga0157370_10656156
609 Ga0157369_10865124
610 Ga0157369_11568753
611 Ga0157374_11094120
612 Ga0157378_10394479
613 Ga0163162_12905759
614 Ga0157372_10807863
615 Ga0157375_10727011
616 Ga0163163_10279540
617 Ga0163163_10321941
618 Ga0157380_10071444
619 Ga0182008_10132286
620 Ga0157379_10570168
621 Ga0157379_10641557
622 Ga0157376_10634067
623 Ga0157376_11150126
624 Ga0182006_1073222
625 Ga0182005_1060974
626 Ga0163161_11011929
627 Ga0213872_10003862
628 Ga0207427_102184
629 Ga0209437_100042
630 Ga0209437_100341
631 Ga0209646_1003375
632 Ga0209026_1000005
633 Ga0209026_1020530
634 Ga0209148_1000057
635 Ga0209148_1007893
636 Ga0209759_1000111
637 Ga0209233_1000027
638 Ga0209233_1000103
639 Ga0209233_1000355
640 Ga0209233_1000425
641 Ga0209455_1000131
642 Ga0209455_1014598
643 Ga0207642_10649179
644 Ga0207645_10104191
645 Ga0207654_10523437
646 Ga0207695_10004986
647 Ga0207695_10203776
648 Ga0207695_10450479
649 Ga0207695_10615944
650 Ga0207671_10140972
651 Ga0207671_10869647
652 Ga0207657_10081170
653 Ga0207657_10382630
654 Ga0207646_10098071
655 Ga0207681_10137481
656 Ga0207694_10191399
657 Ga0207694_10756693
658 Ga0207650_10000978
659 Ga0207690_10312678
660 Ga0207709_10404391
661 Ga0207709_11709792
662 Ga0207669_10049283
663 Ga0207669_10278582
664 Ga0207669_10331731
665 Ga0207704_11360872
666 Ga0207667_10673681
667 Ga0207712_11437486
668 Ga0207712_11919557
669 Ga0207640_11443368
670 Ga0207678_10117935
671 Ga0207702_10044295
672 Ga0207702_11999099
673 Ga0207648_10033829
674 Ga0207648_10118890
675 Ga0207675_100961107
676 Ga0207683_10857567
677 Ga0209371_1030974
678 Ga0268266_10025066
679 Ga0268266_10099219
680 Ga0268266_10469418
681 Ga0268266_11269285
682 Ga0268266_11540889
683 Ga0268265_10122181
684 Ga0265334_10294164
685 Ga0265318_10003503
686 Ga0307517_10000124
687 Ga0307515_10000130
688 Ga0307515_10026795
689 Ga0307515_10580565
690 Ga0268256_1030163
691 Ga0307512_10345112
692 Ga0265332_10076201
693 Ga0265320_10048525
694 Ga0265340_10057168
695 Ga0265331_10293994
696 Ga0265327_10022592
697 Ga0265316_10084171
698 Ga0307513_10174731
699 Ga0307513_10213026
700 Ga0307513_10385961
701 Ga0307513_10407659
702 Ga0307513_10740119
703 Ga0265313_10070727
704 Ga0265314_10014569
705 Ga0307410_10098203
706 Ga0307406_10482741
707 Ga0307412_10578393
708 Ga0307409_100027283
709 Ga0307409_102900098
710 Ga0307416_100660961
711 Ga0307411_10316054
712 Ga0307510_10529132
713 Ga0395900_0012991
714 Ga0395900_0149943
715 Ga0395900_0998380
716 Ga0395898_0654948
717 Ga0395905_0015103
718 Ga0395905_0024284
719 Ga0395905_0032491
720 Ga0395905_0067028
721 Ga0395905_0128892
722 Ga0395905_0261321
723 Ga0395905_0265532
724 Ga0395901_0116685
725 Ga0395901_0337795
726 Ga0395901_0510317
727 Ga0436365_1046199
728 Ga0436361_0010669
729 Ga0436363_0531416
730 Ga0436363_1211656
731 Ga0436362_0927742
732 Ga0451789_1231662
733 Ga0451795_0636575
734 Ga0451851_0065769
735 Ga0451855_1823835
736 Ga0451853_1850283
737 Ga0466966_0206402
738 Ga0466963_0015215
739 Ga0466964_0569545
740 Ga0466971_0130626
741 Ga0466970_0000068
742 Ga0466958_0015706
743 Ga0466967_1260539
744 Ga0495592_0199088
745 Ga0495638_0024559
746 Ga0495638_0255999
747 Ga0495638_0280918
748 Ga0495638_0503349
749 Ga0495638_0574047
750 Ga0495641_0010635
751 Ga0495662_0079076
752 Ga0495664_0165378
753 Ga0495596_0111180
754 Ga0495606_0009701
755 Ga0495608_0010937
756 Ga0495618_0112918
757 Ga0495620_0185651
758 Ga0495628_0097783
759 Ga0495628_0286596
760 Ga0495648_0280611
761 Ga0495652_0001601
762 Ga0495587_0059763
763 Ga0495667_0989327
764 Ga0495668_0062889
765 Ga0495625_0063590
766 Ga0495625_0445737
767 Ga0495635_0132098
768 Ga0495657_0017539
769 Ga0495624_0107077
770 Ga0495670_0546270
771 Ga0495600_0077054
772 Ga0495604_0236132
773 Ga0495676_0072161
774 Ga0495680_0037648
775 Ga0495686_0040938
776 Ga0495686_0095413
777 Ga0495593_0612598
778 Ga0495602_0001753
779 Ga0495602_0893204
780 Ga0496100_0608122
781 Ga0496102_0923280
782 Ga0496106_0318123
783 Ga0496106_0988387
784 Ga0496110_0054325
785 Ga0496110_0308357
786 Ga0496110_1342564
787 Ga0496110_1433641
788 Ga0496111_0000707
789 Ga0496111_0367779
790 Ga0496112_0386802
791 Ga0496113_0723812
792 Ga0496113_1538884
793 Ga0496114_0236456
794 Ga0496115_0266804
795 Ga0496117_0244094
796 Ga0496117_0285815
797 Ga0496117_0616890
798 Ga0496118_0247569
799 Ga0496118_0484536
800 Ga0496119_0002306
801 Ga0496120_0046580
802 Ga0496120_0151861
803 Ga0496121_0017153
804 Ga0496121_0315043
805 Ga0496121_0805097
806 Ga0496121_0900692
807 Ga0496122_0232358
808 Ga0496122_0379842
809 Ga0496123_0017795
810 Ga0496123_0041510
811 Ga0496125_0118553
812 Ga0496126_0049769
813 Ga0496126_0469006
814 Ga0501032_0321874
815 Ga0501034_0615779
816 Ga0501047_0432565
817 Ga0501047_0604722
818 Ga0501069_0579094
819 Ga0501071_0712963
820 Ga0501280_001525
821 Ga0501035_0544305
822 Ga0501035_1188512
823 nmdc:mga03n38_210706_c1
824 nmdc:mga03n38_782098_c1
825 nmdc:mga03n38_79638_c1
826 nmdc:mga0yw44_14287_c1
827 nmdc:mga0yw44_778779_c1
828 nmdc:mga0yw44_941950_c1
829 nmdc:mga06z11_212755_c1
830 nmdc:mga04h51_479356_c1
831 nmdc:mga08y16_60533_c1
832 nmdc:mga0sz30_169693_c1
833 Ga0495601_0093494
834 Ga0500610_0253538
835 Ga0500643_014130
836 Ga0500644_0003128
837 Ga0500592_061299
838 Ga0500595_030734
839 Ga0500652_213430
840 Ga0500658_0068870
841 Ga0500658_0297556
842 Ga0500658_0459190
843 Ga0500559_0004272
844 Ga0500568_0000692
845 Ga0500568_0055106
846 Ga0500568_0120681
847 Ga0500604_0007578
848 Ga0500604_0236193
849 Ga0500604_0257049
850 Ga0500616_0035209
851 Ga0500620_000148
852 Ga0500622_0002146
853 Ga0500627_0123984
854 Ga0500627_0153066
855 Ga0500627_0239946
856 Ga0500627_0242269
857 Ga0500630_287383
858 Ga0500636_0372624
859 Ga0500611_039421
860 Ga0500611_095964
861 Ga0500611_113683
862 Ga0466962_0071046
863 2503203923
864 2509369281
865 2509398267
866 2510316830
867 2512929263
868 2512964075
869 2514034182
870 2535518427
871 2588514818
872 2597815580
873 2599940307
874 2617381161
875 2643986321
876 2644152553
877 2671116709
878 2688600633
879 2738945132
880 2756672753
881 2792745786
882 2819607680
883 2841735322
884 2844005210
885 2844015974
886 2856330236
887 2857354558
888 2869168943
889 2869171667
890 2869241139
891 2869246124
892 2869255686
893 2869259548
894 2869269555
895 2869273596
896 2869284030
897 2871442090
898 2871454464
899 2871460517
900 2871473016
901 2871479162
902 2871485569
903 2874111240
904 2874121004
905 2874132187
906 2874144649
907 2874164306
908 2876367181
909 2876391196
910 2876404089
911 2876406932
912 2876423733
913 2878736719
914 2878743976
915 2878779428
916 2878785175
917 2878795402
918 2881158200
919 2881860462
920 2882637074
921 2885315597
922 2885344874
923 2885354554
924 2888349320
925 2889011626
926 2899805172
927 2903453351
928 2903526672
929 2903530709
930 2906367442
931 2906373080
932 2906384516
933 2906390869
934 2906396751
935 2906403711
936 2906412240
937 2906430216
938 2913309758
939 2919414152
940 2922153290
941 2922175475
942 2922183303
943 2924713027
944 2924719506
945 2924743887
946 2924752014
947 2924781893
948 2937822898
949 2937842137
950 2937850299
951 2937868703
952 2937869177
953 2937884778
954 2937978051
955 2937987534
956 2958040419
957 2958055267
958 2958065080
959 2958075681
960 2958092087
961 2958097121
962 2958114639
963 2958138566
964 2958150634
965 2958162607
966 2961135196
967 2961137492
968 2961190553
969 2963649974
970 2965027027
971 2965045899
972 2965049431
973 2965095833
974 2965108880
975 2965118802
976 2968021955
977 2968086715
978 2968141250
979 2970474545
980 2970491854
981 2970514701
982 2970538356
983 2970546265
984 2970549731
985 2970598642
986 2970626426
987 2970628624
988 2977855673
989 2977913827
990 2977921343
991 2977928004
992 2977941180
993 2977946338
994 2977957294
995 2977992858
996 2979767279
997 2979779205
998 2979795023
999 2987643160
1000 2987648031
1001 2987675220
1002 2996353954
1003 2996391254
1004 3000141064
1005 3004171514
1006 3004202614
1007 3004206708
1008 3004213604
1009 3004223195
1010 3004239107
1011 3004251166
1012 3004270262
1013 3004280622
1014 3004292847
1015 3004338773
1016 637079020
1017 649875085
1018 8004303596
1019 8004316552
1020 8004365919
1021 8004636858
1022 8004643655
1023 8004733796
1024 8005486289
1025 8005549345
1026 8005650751
1027 8005683510
1028 8024489076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vg3-assembly1.cif.gz_A cryo-em structure of arabidopsis dcl3 in complex with a 30-bp rna 0.4975 7 107
7vg2-assembly1.cif.gz_A cryo-em structure of arabidopsis dcl3 in complex with a 40-bp rna 0.4509 1 107
7kjp-assembly1.cif.gz_B disulfide stabilized norovirus gi.1 vlp shell region 0.3594 9 101
3g89-assembly2.cif.gz_B t. thermophilus 16s rrna g527 methyltransferase in complex with adomet and amp in space group p61 0.3561 78 114
5guh-assembly1.cif.gz_A crystal structure of silkworm piwi-clade argonaute siwi bound to pirna 0.3424 8 100
ID Description Score Start End Superfamily
af_P71229_1_152_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.4917 11 99 3.30.450.40
3gu0A02 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.4704 10 97 3.10.50.30
af_A0A1D6JEA5_54_179_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.4453 1 112 2.30.29.30
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.4446 73 106 3.90.79.10
af_Q5APP1_101_256_2.60.40.2690 Mainly Beta;Sandwich;Immunoglobulin-like; 0.4231 68 99 2.60.40.2690
ID Description Score Start End GO Terms
AF-D8PZ41-F1-model_v4 TIGR04076 family protein 0.9729 9 103
AF-D8PZ41-F1-model_v4 TIGR04076 family protein 0.9533 9 103
AF-A0A6A7Y1E4-F1-model_v4 TIGR04076 family protein 0.9524 5 115
AF-A0A2V1BLU1-F1-model_v4 TIGR04076 family protein 0.9471 5 113
AF-A0A292ECK8-F1-model_v4 TIGR04076 family protein 0.9458 3 115

Map