F457381

General Info

Members Datasets Scaffolds Average Seq Length
512 277 1024 149

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10092204|Ga0070658_100922041
Length 172
Sequence VVLCRRNLYGVKRKQTTRRPMKKAXXXPATKLDQIRARLRSSTPILPIGVHLGFRVTAVRKGRVTIELDVRPHHANAIGTLHGGVLCDIADAAMALSHATNIAAEETFTTLELKINFLKPVWEGKLRAEGRVIKQGRTIGLTECDVFDEKGSLVAHATSTCMTLRGNEAKGR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.73
Rhizosphere 96.29
Stem 0
Stem Tuber 0
Unclassified 25.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10092204 3300005327 Bacteria 2498
2 JGI24747J21853_1012948 3300001978 Unclassified 856
3 JGI24743J22301_10006256 3300001991 Bacteria 2021
4 JGI26128J50194_1006590 3300003347 Bacteria 758
5 JGI26129J50193_1010430 3300003349 Bacteria 676
6 JGI25405J52794_10025671 3300003911 Bacteria 1208
7 Ga0065704_10423223 3300005289 Unclassified 730
8 Ga0065715_10136418 3300005293 Bacteria 1922
9 Ga0065707_10262742 3300005295 Bacteria 1093
10 Ga0070658_11064725 3300005327 Unclassified 703
11 Ga0070676_10028309 3300005328 Bacteria 3182
12 Ga0070683_100182271 3300005329 Bacteria 1993
13 Ga0070670_100221723 3300005331 Bacteria 1645
14 Ga0068869_100049617 3300005334 Bacteria 3039
15 Ga0070666_10113694 3300005335 Bacteria 1873
16 Ga0070680_100153174 3300005336 Unclassified 1936
17 Ga0070680_100478016 3300005336 Unclassified 1065
18 Ga0070682_100008051 3300005337 Bacteria 5936
19 Ga0068868_100020426 3300005338 Bacteria 4976
20 Ga0070660_100087160 3300005339 Unclassified 2457
21 Ga0070689_100066217 3300005340 Bacteria 2815
22 Ga0070689_100067085 3300005340 Bacteria 2796
23 Ga0070691_10123081 3300005341 Bacteria 1308
24 Ga0070687_100001840 3300005343 Bacteria 7678
25 Ga0070687_100035503 3300005343 Bacteria 2476
26 Ga0070661_100168682 3300005344 Bacteria 1661
27 Ga0070669_100005119 3300005353 Bacteria 9479
28 Ga0070675_100009409 3300005354 Bacteria 7603
29 Ga0070671_100365827 3300005355 Unclassified 1231
30 Ga0070674_100211449 3300005356 Unclassified 1503
31 Ga0070673_100387537 3300005364 Unclassified 1247
32 Ga0070659_100002666 3300005366 Bacteria 12691
33 Ga0070659_100078244 3300005366 Bacteria 2638
34 Ga0070709_10813392 3300005434 Unclassified 734
35 Ga0070709_11158549 3300005434 Bacteria 620
36 Ga0070710_10547688 3300005437 Bacteria 798
37 Ga0070711_100000674 3300005439 Bacteria 17876
38 Ga0070705_101455288 3300005440 Unclassified 573
39 Ga0070694_100056884 3300005444 Bacteria 2658
40 Ga0070694_100593872 3300005444 Unclassified 891
41 Ga0070708_100126723 3300005445 Bacteria 2361
42 Ga0070708_100269096 3300005445 Unclassified 1602
43 Ga0070708_100353701 3300005445 Bacteria 1384
44 Ga0070708_100478475 3300005445 Bacteria 1175
45 Ga0070708_100815561 3300005445 Unclassified 877
46 Ga0070708_100856207 3300005445 Bacteria 854
47 Ga0070708_101005836 3300005445 Bacteria 782
48 Ga0070663_100018203 3300005455 Unclassified 4599
49 Ga0070663_101211066 3300005455 Unclassified 664
50 Ga0070662_100002683 3300005457 Bacteria 10979
51 Ga0070662_100015410 3300005457 Bacteria 5120
52 Ga0070662_100019519 3300005457 Unclassified 4602
53 Ga0070681_10239774 3300005458 Bacteria 1727
54 Ga0068867_100003854 3300005459 Bacteria 10546
55 Ga0070685_10020596 3300005466 Bacteria 3569
56 Ga0070706_100012720 3300005467 Bacteria 7786
57 Ga0070706_100094363 3300005467 Bacteria 2776
58 Ga0070706_100151857 3300005467 Bacteria 2162
59 Ga0070706_100167209 3300005467 Bacteria 2053
60 Ga0070706_100169661 3300005467 Bacteria 2037
61 Ga0070706_100182362 3300005467 Bacteria 1960
62 Ga0070707_100000050 3300005468 Bacteria 102427
63 Ga0070707_100013117 3300005468 Bacteria 7746
64 Ga0070707_100169401 3300005468 Bacteria 2128
65 Ga0070698_100003437 3300005471 Bacteria 17412
66 Ga0070698_100029289 3300005471 Bacteria 5714
67 Ga0070698_100136460 3300005471 Bacteria 2407
68 Ga0070698_100252672 3300005471 Bacteria 1695
69 Ga0070698_101420719 3300005471 Bacteria 645
70 Ga0070699_100002495 3300005518 Bacteria 16526
71 Ga0070699_100010410 3300005518 Bacteria 8048
72 Ga0070699_100104125 3300005518 Bacteria 2489
73 Ga0070699_100259159 3300005518 Unclassified 1555
74 Ga0070699_100273406 3300005518 Bacteria 1513
75 Ga0070699_100305570 3300005518 Unclassified 1427
76 Ga0070699_100617065 3300005518 Bacteria 989
77 Ga0070699_100661012 3300005518 Bacteria 954
78 Ga0070699_100909890 3300005518 Bacteria 806
79 Ga0070699_101002876 3300005518 Bacteria 766
80 Ga0070699_101203794 3300005518 Archaea 695
81 Ga0070699_101585877 3300005518 Unclassified 600
82 Ga0070679_100182908 3300005530 Bacteria 2068
83 Ga0070684_100009298 3300005535 Bacteria 7736
84 Ga0070684_100304928 3300005535 Bacteria 1462
85 Ga0070684_100366017 3300005535 Bacteria 1327
86 Ga0070684_101001475 3300005535 Unclassified 784
87 Ga0070697_100018675 3300005536 Bacteria 5470
88 Ga0070697_100026992 3300005536 Bacteria 4592
89 Ga0070697_100032136 3300005536 Bacteria 4222
90 Ga0070697_100043246 3300005536 Bacteria 3646
91 Ga0070697_100070003 3300005536 Bacteria 2875
92 Ga0070697_100146907 3300005536 Bacteria 1985
93 Ga0070697_100166926 3300005536 Unclassified 1861
94 Ga0070697_100258509 3300005536 Bacteria 1490
95 Ga0070697_100644097 3300005536 Bacteria 933
96 Ga0070697_100646849 3300005536 Unclassified 931
97 Ga0070697_100704675 3300005536 Unclassified 891
98 Ga0068853_100006343 3300005539 Bacteria 9387
99 Ga0068853_100116109 3300005539 Bacteria 2383
100 Ga0070672_100131384 3300005543 Bacteria 2058
101 Ga0070672_101130777 3300005543 Unclassified 696
102 Ga0070686_100001440 3300005544 Bacteria 13445
103 Ga0070686_100004656 3300005544 Bacteria 7566
104 Ga0070695_100011739 3300005545 Bacteria 5244
105 Ga0070695_100208810 3300005545 Unclassified 1400
106 Ga0070696_100319163 3300005546 Unclassified 1195
107 Ga0070696_100446022 3300005546 Unclassified 1020
108 Ga0070665_100087159 3300005548 Bacteria 3127
109 Ga0070704_100392938 3300005549 Bacteria 1181
110 Ga0070704_100606082 3300005549 Bacteria 963
111 Ga0070704_101333379 3300005549 Unclassified 657
112 Ga0068855_100229287 3300005563 Bacteria 2080
113 Ga0068855_100304257 3300005563 Bacteria 1765
114 Ga0068855_100514410 3300005563 Bacteria 1299
115 Ga0070664_100199625 3300005564 Bacteria 1784
116 Ga0068857_100193153 3300005577 Bacteria 1854
117 Ga0068857_100648008 3300005577 Bacteria 1001
118 Ga0068854_100004621 3300005578 Bacteria 8685
119 Ga0068854_100355855 3300005578 Unclassified 1200
120 Ga0068854_100433188 3300005578 Bacteria 1094
121 Ga0068854_100579220 3300005578 Unclassified 955
122 Ga0068856_100012826 3300005614 Bacteria 8110
123 Ga0068856_100067395 3300005614 Bacteria 3537
124 Ga0070702_100010550 3300005615 Bacteria 4557
125 Ga0070702_100147947 3300005615 Unclassified 1504
126 Ga0068852_100054256 3300005616 Bacteria 3454
127 Ga0068852_100379183 3300005616 Unclassified 1387
128 Ga0068864_100019391 3300005618 Bacteria 5688
129 Ga0068864_100182793 3300005618 Bacteria 1918
130 Ga0068864_100195582 3300005618 Bacteria 1855
131 Ga0068864_101214912 3300005618 Unclassified 753
132 Ga0068866_10012445 3300005718 Bacteria 3706
133 Ga0068861_100063942 3300005719 Bacteria 2830
134 Ga0068861_100192292 3300005719 Unclassified 1707
135 Ga0068851_10045214 3300005834 Bacteria 2225
136 Ga0068870_10047272 3300005840 Bacteria 2262
137 Ga0068860_101037714 3300005843 Bacteria 838
138 Ga0068862_100388222 3300005844 Bacteria 1304
139 Ga0081455_10000208 3300005937 Bacteria 74660
140 Ga0070717_10003286 3300006028 Bacteria 11565
141 Ga0070717_10056378 3300006028 Bacteria 3246
142 Ga0070717_10099335 3300006028 Bacteria 2469
143 Ga0070716_100437704 3300006173 Bacteria 950
144 Ga0070716_100845173 3300006173 Unclassified 712
145 Ga0070712_100095581 3300006175 Bacteria 2186
146 Ga0097621_100141888 3300006237 Bacteria 2053
147 Ga0068871_101323297 3300006358 Unclassified 678
148 Ga0075428_100003108 3300006844 Bacteria 18124
149 Ga0075428_100305243 3300006844 Bacteria 1711
150 Ga0075428_100439985 3300006844 Bacteria 1397
151 Ga0075428_101005861 3300006844 Unclassified 882
152 Ga0075430_100106022 3300006846 Bacteria 2345
153 Ga0075431_100019321 3300006847 Bacteria 6946
154 Ga0075431_100129844 3300006847 Bacteria 2600
155 Ga0075431_100150287 3300006847 Bacteria 2399
156 Ga0075431_100204244 3300006847 Bacteria 2021
157 Ga0075431_100357269 3300006847 Bacteria 1468
158 Ga0075431_100358295 3300006847 Unclassified 1466
159 Ga0075433_10023500 3300006852 Bacteria 5190
160 Ga0075433_10224621 3300006852 Unclassified 1668
161 Ga0075433_10390826 3300006852 Bacteria 1228
162 Ga0075433_10776699 3300006852 Bacteria 837
163 Ga0075434_100007466 3300006871 Bacteria 10115
164 Ga0075434_100043592 3300006871 Bacteria 4449
165 Ga0075434_100055542 3300006871 Bacteria 3935
166 Ga0075434_100114010 3300006871 Unclassified 2715
167 Ga0075434_100263422 3300006871 Unclassified 1743
168 Ga0075434_100274986 3300006871 Bacteria 1703
169 Ga0068865_100008484 3300006881 Bacteria 6353
170 Ga0075436_100007102 3300006914 Bacteria 7664
171 Ga0075436_100022925 3300006914 Bacteria 4289
172 Ga0075436_100097474 3300006914 Unclassified 2045
173 Ga0075436_100151523 3300006914 Unclassified 1632
174 Ga0075436_100235533 3300006914 Bacteria 1301
175 Ga0075436_100971445 3300006914 Bacteria 637
176 Ga0097620_102031266 3300006931 Bacteria 635
177 Ga0075435_100000051 3300007076 Bacteria 59038
178 Ga0075435_100006302 3300007076 Bacteria 8379
179 Ga0075435_100013820 3300007076 Bacteria 6018
180 Ga0075435_100046095 3300007076 Bacteria 3495
181 Ga0075435_100086629 3300007076 Bacteria 2580
182 Ga0075435_100229544 3300007076 Unclassified 1577
183 Ga0099794_10000928 3300007265 Bacteria 9896
184 Ga0099794_10171820 3300007265 Bacteria 1105
185 Ga0099795_10531651 3300007788 Unclassified 552
186 Ga0105240_10125190 3300009093 Bacteria 3090
187 Ga0105240_10504303 3300009093 Bacteria 1345
188 Ga0105240_11397131 3300009093 Bacteria 736
189 Ga0111539_10055749 3300009094 Bacteria 4699
190 Ga0111539_10160895 3300009094 Unclassified 2626
191 Ga0111539_10840582 3300009094 Unclassified 1068
192 Ga0105245_10090667 3300009098 Bacteria 2812
193 Ga0105245_10091336 3300009098 Bacteria 2802
194 Ga0105245_10807116 3300009098 Unclassified 977
195 Ga0105247_10009761 3300009101 Bacteria 5821
196 Ga0114129_10014630 3300009147 Bacteria 11179
197 Ga0114129_10143182 3300009147 Bacteria 3276
198 Ga0114129_10153466 3300009147 Bacteria 3151
199 Ga0114129_10233436 3300009147 Bacteria 2477
200 Ga0114129_11009622 3300009147 Archaea 1047
201 Ga0114129_11273046 3300009147 Unclassified 913
202 Ga0114129_11473404 3300009147 Unclassified 837
203 Ga0114129_11740762 3300009147 Unclassified 759
204 Ga0114129_12217173 3300009147 Bacteria 661
205 Ga0105243_10575976 3300009148 Bacteria 1080
206 Ga0105241_10087737 3300009174 Bacteria 2449
207 Ga0105241_10089093 3300009174 Unclassified 2431
208 Ga0105241_10141904 3300009174 Bacteria 1957
209 Ga0105241_10624246 3300009174 Unclassified 976
210 Ga0105242_10003389 3300009176 Bacteria 12406
211 Ga0105248_10169097 3300009177 Bacteria 2464
212 Ga0105248_10755323 3300009177 Unclassified 1097
213 Ga0105248_11276275 3300009177 Unclassified 831
214 Ga0105238_10175705 3300009551 Bacteria 2118
215 Ga0105249_10039963 3300009553 Bacteria 4260
216 Ga0105239_10231297 3300010375 Bacteria 2074
217 Ga0105239_10595645 3300010375 Unclassified 1261
218 Ga0105239_11225565 3300010375 Bacteria 865
219 Ga0105246_10015894 3300011119 Bacteria 4760
220 Ga0105246_10190138 3300011119 Bacteria 1588
221 Ga0157315_1008082 3300012508 Unclassified 870
222 Ga0157373_10002380 3300013100 Bacteria 14283
223 Ga0157373_10077482 3300013100 Bacteria 2345
224 Ga0157373_10120628 3300013100 Unclassified 1843
225 Ga0157371_10002907 3300013102 Bacteria 16015
226 Ga0157370_10006933 3300013104 Bacteria 12382
227 Ga0157369_10001003 3300013105 Bacteria 35669
228 Ga0157369_10018225 3300013105 Bacteria 7874
229 Ga0157369_10021280 3300013105 Bacteria 7253
230 Ga0157374_10005580 3300013296 Bacteria 10593
231 Ga0157374_10069083 3300013296 Bacteria 3326
232 Ga0157374_10140347 3300013296 Bacteria 2345
233 Ga0157372_10139142 3300013307 Unclassified 2796
234 Ga0157372_10257809 3300013307 Bacteria 2025
235 Ga0157372_10782370 3300013307 Bacteria 1109
236 Ga0157375_10055998 3300013308 Bacteria 3890
237 Ga0163163_10278786 3300014325 Bacteria 1723
238 Ga0163163_12097382 3300014325 Bacteria 625
239 Ga0157380_10027507 3300014326 Unclassified 4325
240 Ga0182008_10050339 3300014497 Bacteria 2067
241 Ga0157377_10001555 3300014745 Bacteria 9979
242 Ga0157376_10014359 3300014969 Bacteria 5943
243 Ga0182006_1171976 3300015261 Unclassified 725
244 Ga0163161_10007569 3300017792 Bacteria 7509
245 Ga0197907_10788264 3300020069 Unclassified 748
246 Ga0206354_10499979 3300020081 Bacteria 1901
247 Ga0206354_11045861 3300020081 Unclassified 852
248 Ga0213871_10125279 3300021441 Bacteria 768
249 Ga0207697_10002780 3300025315 Bacteria 8929
250 Ga0207656_10090925 3300025321 Bacteria 1385
251 Ga0207682_10004106 3300025893 Bacteria 6177
252 Ga0207688_10057032 3300025901 Bacteria 2195
253 Ga0207647_10002672 3300025904 Bacteria 13456
254 Ga0207699_10436596 3300025906 Unclassified 937
255 Ga0207645_10001560 3300025907 Bacteria 18746
256 Ga0207643_10000639 3300025908 Bacteria 21958
257 Ga0207705_10149124 3300025909 Bacteria 1751
258 Ga0207684_10006757 3300025910 Bacteria 10411
259 Ga0207684_10026638 3300025910 Bacteria 4929
260 Ga0207684_10094813 3300025910 Bacteria 2546
261 Ga0207684_10100277 3300025910 Bacteria 2474
262 Ga0207684_10122496 3300025910 Bacteria 2230
263 Ga0207684_11105031 3300025910 Bacteria 660
264 Ga0207695_10320351 3300025913 Bacteria 1440
265 Ga0207695_10660441 3300025913 Bacteria 926
266 Ga0207660_10897641 3300025917 Bacteria 723
267 Ga0207662_10003901 3300025918 Bacteria 7770
268 Ga0207662_10027438 3300025918 Bacteria 3286
269 Ga0207657_10001261 3300025919 Bacteria 27065
270 Ga0207657_10005688 3300025919 Bacteria 13006
271 Ga0207649_10158055 3300025920 Bacteria 1568
272 Ga0207652_10745414 3300025921 Bacteria 872
273 Ga0207646_10000037 3300025922 Bacteria 196362
274 Ga0207646_10037698 3300025922 Bacteria 4357
275 Ga0207646_10045159 3300025922 Bacteria 3955
276 Ga0207646_10544614 3300025922 Bacteria 1044
277 Ga0207646_10771810 3300025922 Bacteria 857
278 Ga0207681_10640794 3300025923 Unclassified 880
279 Ga0207694_10146809 3300025924 Unclassified 1899
280 Ga0207694_10240161 3300025924 Bacteria 1480
281 Ga0207650_10000177 3300025925 Bacteria 75244
282 Ga0207650_10040788 3300025925 Bacteria 3399
283 Ga0207659_10071638 3300025926 Bacteria 2531
284 Ga0207687_10049613 3300025927 Bacteria 2919
285 Ga0207700_10002698 3300025928 Bacteria 10229
286 Ga0207644_10192432 3300025931 Unclassified 1604
287 Ga0207644_10903988 3300025931 Unclassified 740
288 Ga0207690_10402101 3300025932 Unclassified 1092
289 Ga0207690_10745309 3300025932 Unclassified 807
290 Ga0207706_10002495 3300025933 Bacteria 17927
291 Ga0207706_10050747 3300025933 Unclassified 3666
292 Ga0207706_10363744 3300025933 Bacteria 1257
293 Ga0207706_10703718 3300025933 Unclassified 863
294 Ga0207670_10011311 3300025936 Bacteria 5174
295 Ga0207670_10066416 3300025936 Bacteria 2478
296 Ga0207669_10251467 3300025937 Unclassified 1316
297 Ga0207665_10218441 3300025939 Unclassified 1396
298 Ga0207665_10862196 3300025939 Archaea 717
299 Ga0207691_10001447 3300025940 Bacteria 23651
300 Ga0207711_10157713 3300025941 Unclassified 2052
301 Ga0207711_10180516 3300025941 Bacteria 1919
302 Ga0207711_10238366 3300025941 Unclassified 1668
303 Ga0207689_10002307 3300025942 Bacteria 17863
304 Ga0207689_10157922 3300025942 Bacteria 1869
305 Ga0207661_10016213 3300025944 Bacteria 5494
306 Ga0207661_10031498 3300025944 Bacteria 4098
307 Ga0207679_10000143 3300025945 Bacteria 59141
308 Ga0207679_10723538 3300025945 Unclassified 904
309 Ga0207667_10031734 3300025949 Bacteria 5701
310 Ga0207667_11292411 3300025949 Bacteria 706
311 Ga0207651_10043637 3300025960 Bacteria 2994
312 Ga0207668_10059933 3300025972 Bacteria 2669
313 Ga0207640_10004709 3300025981 Bacteria 7409
314 Ga0207640_10232365 3300025981 Unclassified 1419
315 Ga0207640_10791981 3300025981 Unclassified 820
316 Ga0207658_10005160 3300025986 Bacteria 8995
317 Ga0207658_10295432 3300025986 Bacteria 1394
318 Ga0207677_10020934 3300026023 Bacteria 3985
319 Ga0207703_11424508 3300026035 Unclassified 667
320 Ga0207639_10017818 3300026041 Bacteria 5037
321 Ga0207678_10001668 3300026067 Bacteria 20376
322 Ga0207678_10926136 3300026067 Unclassified 771
323 Ga0207708_10337425 3300026075 Unclassified 1233
324 Ga0207702_10071365 3300026078 Bacteria 2990
325 Ga0207702_10187998 3300026078 Bacteria 1906
326 Ga0207641_10003028 3300026088 Bacteria 15142
327 Ga0207641_11375059 3300026088 Unclassified 707
328 Ga0207648_10003457 3300026089 Bacteria 16564
329 Ga0207676_10001159 3300026095 Bacteria 19817
330 Ga0207676_10011008 3300026095 Bacteria 6457
331 Ga0207676_10936926 3300026095 Unclassified 851
332 Ga0207676_11910967 3300026095 Unclassified 592
333 Ga0207674_10000195 3300026116 Bacteria 75067
334 Ga0207674_10498715 3300026116 Bacteria 1176
335 Ga0207674_10744573 3300026116 Unclassified 946
336 Ga0207674_11128874 3300026116 Unclassified 753
337 Ga0207675_100165589 3300026118 Unclassified 2111
338 Ga0207675_100283608 3300026118 Bacteria 1610
339 Ga0207683_10003688 3300026121 Bacteria 13306
340 Ga0207683_10856109 3300026121 Bacteria 844
341 Ga0207698_10260595 3300026142 Unclassified 1592
342 Ga0207698_11255616 3300026142 Bacteria 755
343 Ga0209969_1000819 3300027360 Bacteria 4180
344 Ga0209967_1011141 3300027364 Bacteria 1258
345 Ga0209996_1011764 3300027395 Bacteria 1171
346 Ga0209995_1000526 3300027471 Bacteria 5798
347 Ga0209968_1001120 3300027526 Bacteria 4084
348 Ga0209999_1002816 3300027543 Bacteria 3080
349 Ga0209970_1014279 3300027614 Bacteria 1319
350 Ga0209983_1003507 3300027665 Bacteria 3342
351 Ga0209588_1050130 3300027671 Bacteria 1351
352 Ga0209971_1000031 3300027682 Bacteria 50315
353 Ga0209966_1000020 3300027695 Bacteria 68386
354 Ga0209998_10000024 3300027717 Bacteria 64123
355 Ga0209974_10009769 3300027876 Bacteria 3252
356 Ga0207428_10028705 3300027907 Bacteria 4620
357 Ga0207428_10097852 3300027907 Bacteria 2271
358 Ga0268266_10003235 3300028379 Bacteria 16447
359 Ga0268266_10213480 3300028379 Bacteria 1771
360 Ga0268266_10596101 3300028379 Unclassified 1061
361 Ga0268265_10010967 3300028380 Bacteria 6120
362 Ga0268264_10112259 3300028381 Bacteria 2389
363 Ga0268264_10997612 3300028381 Bacteria 844
364 Ga0265762_1001102 3300030760 Bacteria 4860
365 Ga0307409_101043717 3300031995 Unclassified 837
366 Ga0307416_101195075 3300032002 Unclassified 866
367 Ga0307415_100688471 3300032126 Unclassified 921
368 Ga0316212_1000829 3300033547 Bacteria 4000
369 Ga0373930_0018331 3300034816 Bacteria 1344
370 Ga0373948_0049372 3300034817 Unclassified 900
371 Ga0373959_0001464 3300034820 Bacteria 3770
372 Ga0373938_0000524 3300034957 Bacteria 6232
373 Ga0373928_0010312 3300035084 Bacteria 1835
374 Ga0373929_0001741 3300035085 Bacteria 4091
375 Ga0373949_0026594 3300035090 Bacteria 1356
376 Ga0373949_0030222 3300035090 Bacteria 1287
377 Ga0373951_0011661 3300035091 Bacteria 1975
378 Ga0373952_0000806 3300035092 Bacteria 5635
379 Ga0373932_0025789 3300035112 Bacteria 1594
380 Ga0373939_0000138 3300035114 Bacteria 20969
381 Ga0373941_0000086 3300035115 Bacteria 15129
382 Ga0373960_0008180 3300035121 Bacteria 2499
383 Ga0373942_0001119 3300035207 Bacteria 7120
384 Ga0373961_0006481 3300035241 Bacteria 2810
385 Ga0373962_0014123 3300035242 Bacteria 2031
386 Ga0373931_0002913 3300035691 Bacteria 7634
387 Ga0373933_0249035 3300035724 Bacteria 1144
388 Ga0373937_1251851 3300036401 Bacteria 690
389 Ga0395900_0006116 3300037418 Bacteria 12551
390 Ga0395898_0004956 3300037466 Bacteria 14452
391 Ga0395898_1252723 3300037466 Unclassified 672
392 Ga0395905_0116356 3300037471 Bacteria 2513
393 Ga0395905_0261199 3300037471 Unclassified 1617
394 Ga0395905_0374369 3300037471 Bacteria 1318
395 Ga0395905_0890661 3300037471 Bacteria 793
396 Ga0436364_0910392 3300037853 Bacteria 658
397 Ga0395901_0000893 3300038443 Bacteria 32764
398 Ga0395901_0689782 3300038443 Bacteria 1020
399 Ga0242422_00891 3300038699 Unclassified 2023
400 Ga0436365_0524461 3300039437 Bacteria 1620
401 Ga0436365_1738066 3300039437 Bacteria 103785
402 Ga0436360_0729932 3300039438 Bacteria 1461
403 Ga0436361_0068265 3300039447 Unclassified 603
404 Ga0436363_0606919 3300039450 Unclassified 546
405 Ga0439431_0258607 3300041997 Unclassified 518
406 Ga0439448_0018809 3300042005 Unclassified 2121
407 Ga0439435_0021051 3300042436 Unclassified 1689
408 Ga0439460_0034586 3300042461 Unclassified 1457
409 Ga0451577_0106161 3300042876 Bacteria 2510
410 Ga0451577_0108922 3300042876 Bacteria 2477
411 Ga0439440_0009259 3300042993 Unclassified 2039
412 Ga0453683_0002445 3300044673 Bacteria 14394
413 Ga0453683_0129805 3300044673 Bacteria 1587
414 Ga0453684_1121112 3300044712 Bacteria 830
415 Ga0451576_0010342 3300045051 Bacteria 10713
416 Ga0451576_0110810 3300045051 Bacteria 2856
417 Ga0451576_1085668 3300045051 Bacteria 838
418 Ga0451576_1921342 3300045051 Unclassified 610
419 Ga0495669_0597777 3300046684 Unclassified 537
420 Ga0496100_0088097 3300048903 Bacteria 2112
421 Ga0496101_0475260 3300048904 Unclassified 987
422 Ga0496102_0212725 3300048905 Bacteria 1823
423 Ga0496102_0231649 3300048905 Bacteria 1741
424 Ga0496103_0046092 3300048906 Bacteria 2691
425 Ga0496106_0058178 3300048909 Bacteria 2926
426 Ga0496106_0191571 3300048909 Unclassified 1626
427 Ga0496106_0737713 3300048909 Unclassified 784
428 Ga0496107_0046578 3300048910 Bacteria 3121
429 Ga0496107_0529349 3300048910 Unclassified 874
430 Ga0496108_0000689 3300048911 Bacteria 26147
431 Ga0496109_0001300 3300048912 Bacteria 20670
432 Ga0496110_0043918 3300048913 Bacteria 3902
433 Ga0496115_0428869 3300048918 Bacteria 1070
434 Ga0501032_0228077 3300049569 Unclassified 1211
435 Ga0501033_0072748 3300049570 Bacteria 2524
436 Ga0501036_0272373 3300049572 Bacteria 1417
437 Ga0501038_0038405 3300049574 Bacteria 4193
438 Ga0501039_0006276 3300049575 Bacteria 9027
439 Ga0501040_0002281 3300049576 Bacteria 12329
440 Ga0501041_0034373 3300049577 Bacteria 3068
441 Ga0501042_0022078 3300049578 Bacteria 4443
442 Ga0501043_0093359 3300049579 Bacteria 2366
443 Ga0501046_0000607 3300049580 Bacteria 35214
444 Ga0501046_0459772 3300049580 Bacteria 915
445 Ga0501047_0053799 3300049581 Bacteria 3894
446 Ga0501067_0327527 3300049583 Bacteria 853
447 Ga0501068_0068188 3300049584 Bacteria 2168
448 Ga0501068_0177681 3300049584 Bacteria 1345
449 Ga0501069_0058008 3300049585 Bacteria 2159
450 Ga0501070_0025641 3300049586 Bacteria 4945
451 Ga0501072_0049358 3300049588 Bacteria 3313
452 Ga0501073_0004686 3300049589 Bacteria 10276
453 Ga0501073_0662468 3300049589 Bacteria 720
454 Ga0501074_0007780 3300049590 Bacteria 7758
455 Ga0501074_0088465 3300049590 Bacteria 2218
456 Ga0501074_1140211 3300049590 Unclassified 547
457 Ga0501075_0005460 3300049591 Bacteria 8691
458 Ga0501076_0053357 3300049592 Bacteria 3203
459 Ga0501077_0134496 3300049593 Unclassified 1568
460 Ga0501217_026373 3300049661 Bacteria 1404
461 Ga0501079_0000976 3300049741 Bacteria 19702
462 Ga0501080_0046004 3300049742 Bacteria 4065
463 Ga0501080_0131268 3300049742 Bacteria 2319
464 Ga0501081_0017810 3300049743 Bacteria 4708
465 Ga0501081_0911785 3300049743 Bacteria 663
466 Ga0501083_0058995 3300049744 Bacteria 2567
467 Ga0501083_0071395 3300049744 Unclassified 2308
468 Ga0501045_0003234 3300049824 Bacteria 11126
469 Ga0501045_0201339 3300049824 Unclassified 1483
470 nmdc:mga05p37_1090256_c1 3300050507 Bacteria 837
471 nmdc:mga05p37_1153359_c1 3300050507 Bacteria 806
472 nmdc:mga05p37_1195207_c1 3300050507 Bacteria 786
473 nmdc:mga05p37_133931_c1 3300050507 Bacteria 3040
474 nmdc:mga05p37_1580043_c1 3300050507 Bacteria 648
475 nmdc:mga05p37_479355_c1 3300050507 Bacteria 1433
476 nmdc:mga05p37_594168_c1 3300050507 Unclassified 1251
477 nmdc:mga09592_1558590_c1 3300050508 Bacteria 536
478 nmdc:mga09592_965702_c1 3300050508 Unclassified 714
479 nmdc:mga0qj67_172933_c1 3300050509 Bacteria 1754
480 nmdc:mga06r32_159581_c1 3300050510 Bacteria 2237
481 nmdc:mga06r32_162149_c1 3300050510 Bacteria 2218
482 nmdc:mga06r32_268647_c1 3300050510 Unclassified 1693
483 nmdc:mga06r32_345464_c1 3300050510 Bacteria 1472
484 nmdc:mga06r32_54016_c1 3300050510 Unclassified 3851
485 nmdc:mga06r32_722177_c1 3300050510 Bacteria 961
486 nmdc:mga06r32_85049_c1 3300050510 Bacteria 3084
487 nmdc:mga08y16_64803_c1 3300050511 Unclassified 3815
488 nmdc:mga08y16_814776_c1 3300050511 Unclassified 925
489 nmdc:mga08y16_945711_c1 3300050511 Unclassified 845
490 nmdc:mga0n895_1329251_c1 3300050512 Unclassified 689
491 nmdc:mga0n895_137297_c1 3300050512 Unclassified 2472
492 nmdc:mga0n895_362992_c1 3300050512 Bacteria 1466
493 nmdc:mga0n895_41798_c1 3300050512 Bacteria 4458
494 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
495 nmdc:mga0n895_50053_c1 3300050512 Bacteria 4096
496 nmdc:mga0n895_80538_c1 3300050512 Bacteria 3245
497 nmdc:mga0rr50_168177_c1 3300050513 Unclassified 1784
498 nmdc:mga0rr50_221644_c1 3300050513 Unclassified 1562
499 nmdc:mga0rr50_43462_c1 3300050513 Unclassified 3289
500 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
501 nmdc:mga08x19_137781_c1 3300050514 Unclassified 1646
502 nmdc:mga08x19_228025_c1 3300050514 Unclassified 1282
503 nmdc:mga08x19_48137_c1 3300050514 Bacteria 2730
504 nmdc:mga08x19_5253_c1 3300050514 Bacteria 7664
505 nmdc:mga0a205_196177_c1 3300050515 Bacteria 1910
506 nmdc:mga0a205_30717_c1 3300050515 Bacteria 5146
507 nmdc:mga0a205_311286_c1 3300050515 Bacteria 1447
508 nmdc:mga0a205_697575_c1 3300050515 Bacteria 865
509 Ga0501084_0010953 3300054114 Bacteria 7511
510 Ga0501082_0001321 3300060353 Bacteria 21707
511 Ga0501082_0012651 3300060353 Bacteria 7253
512 Ga0530510_0062847 3300061734 Bacteria 2688
513 Ga0070658_10092204
514 JGI24747J21853_1012948
515 JGI24743J22301_10006256
516 JGI26128J50194_1006590
517 JGI26129J50193_1010430
518 JGI25405J52794_10025671
519 Ga0065704_10423223
520 Ga0065715_10136418
521 Ga0065707_10262742
522 Ga0070658_11064725
523 Ga0070676_10028309
524 Ga0070683_100182271
525 Ga0070670_100221723
526 Ga0068869_100049617
527 Ga0070666_10113694
528 Ga0070680_100153174
529 Ga0070680_100478016
530 Ga0070682_100008051
531 Ga0068868_100020426
532 Ga0070660_100087160
533 Ga0070689_100066217
534 Ga0070689_100067085
535 Ga0070691_10123081
536 Ga0070687_100001840
537 Ga0070687_100035503
538 Ga0070661_100168682
539 Ga0070669_100005119
540 Ga0070675_100009409
541 Ga0070671_100365827
542 Ga0070674_100211449
543 Ga0070673_100387537
544 Ga0070659_100002666
545 Ga0070659_100078244
546 Ga0070709_10813392
547 Ga0070709_11158549
548 Ga0070710_10547688
549 Ga0070711_100000674
550 Ga0070705_101455288
551 Ga0070694_100056884
552 Ga0070694_100593872
553 Ga0070708_100126723
554 Ga0070708_100269096
555 Ga0070708_100353701
556 Ga0070708_100478475
557 Ga0070708_100815561
558 Ga0070708_100856207
559 Ga0070708_101005836
560 Ga0070663_100018203
561 Ga0070663_101211066
562 Ga0070662_100002683
563 Ga0070662_100015410
564 Ga0070662_100019519
565 Ga0070681_10239774
566 Ga0068867_100003854
567 Ga0070685_10020596
568 Ga0070706_100012720
569 Ga0070706_100094363
570 Ga0070706_100151857
571 Ga0070706_100167209
572 Ga0070706_100169661
573 Ga0070706_100182362
574 Ga0070707_100000050
575 Ga0070707_100013117
576 Ga0070707_100169401
577 Ga0070698_100003437
578 Ga0070698_100029289
579 Ga0070698_100136460
580 Ga0070698_100252672
581 Ga0070698_101420719
582 Ga0070699_100002495
583 Ga0070699_100010410
584 Ga0070699_100104125
585 Ga0070699_100259159
586 Ga0070699_100273406
587 Ga0070699_100305570
588 Ga0070699_100617065
589 Ga0070699_100661012
590 Ga0070699_100909890
591 Ga0070699_101002876
592 Ga0070699_101203794
593 Ga0070699_101585877
594 Ga0070679_100182908
595 Ga0070684_100009298
596 Ga0070684_100304928
597 Ga0070684_100366017
598 Ga0070684_101001475
599 Ga0070697_100018675
600 Ga0070697_100026992
601 Ga0070697_100032136
602 Ga0070697_100043246
603 Ga0070697_100070003
604 Ga0070697_100146907
605 Ga0070697_100166926
606 Ga0070697_100258509
607 Ga0070697_100644097
608 Ga0070697_100646849
609 Ga0070697_100704675
610 Ga0068853_100006343
611 Ga0068853_100116109
612 Ga0070672_100131384
613 Ga0070672_101130777
614 Ga0070686_100001440
615 Ga0070686_100004656
616 Ga0070695_100011739
617 Ga0070695_100208810
618 Ga0070696_100319163
619 Ga0070696_100446022
620 Ga0070665_100087159
621 Ga0070704_100392938
622 Ga0070704_100606082
623 Ga0070704_101333379
624 Ga0068855_100229287
625 Ga0068855_100304257
626 Ga0068855_100514410
627 Ga0070664_100199625
628 Ga0068857_100193153
629 Ga0068857_100648008
630 Ga0068854_100004621
631 Ga0068854_100355855
632 Ga0068854_100433188
633 Ga0068854_100579220
634 Ga0068856_100012826
635 Ga0068856_100067395
636 Ga0070702_100010550
637 Ga0070702_100147947
638 Ga0068852_100054256
639 Ga0068852_100379183
640 Ga0068864_100019391
641 Ga0068864_100182793
642 Ga0068864_100195582
643 Ga0068864_101214912
644 Ga0068866_10012445
645 Ga0068861_100063942
646 Ga0068861_100192292
647 Ga0068851_10045214
648 Ga0068870_10047272
649 Ga0068860_101037714
650 Ga0068862_100388222
651 Ga0081455_10000208
652 Ga0070717_10003286
653 Ga0070717_10056378
654 Ga0070717_10099335
655 Ga0070716_100437704
656 Ga0070716_100845173
657 Ga0070712_100095581
658 Ga0097621_100141888
659 Ga0068871_101323297
660 Ga0075428_100003108
661 Ga0075428_100305243
662 Ga0075428_100439985
663 Ga0075428_101005861
664 Ga0075430_100106022
665 Ga0075431_100019321
666 Ga0075431_100129844
667 Ga0075431_100150287
668 Ga0075431_100204244
669 Ga0075431_100357269
670 Ga0075431_100358295
671 Ga0075433_10023500
672 Ga0075433_10224621
673 Ga0075433_10390826
674 Ga0075433_10776699
675 Ga0075434_100007466
676 Ga0075434_100043592
677 Ga0075434_100055542
678 Ga0075434_100114010
679 Ga0075434_100263422
680 Ga0075434_100274986
681 Ga0068865_100008484
682 Ga0075436_100007102
683 Ga0075436_100022925
684 Ga0075436_100097474
685 Ga0075436_100151523
686 Ga0075436_100235533
687 Ga0075436_100971445
688 Ga0097620_102031266
689 Ga0075435_100000051
690 Ga0075435_100006302
691 Ga0075435_100013820
692 Ga0075435_100046095
693 Ga0075435_100086629
694 Ga0075435_100229544
695 Ga0099794_10000928
696 Ga0099794_10171820
697 Ga0099795_10531651
698 Ga0105240_10125190
699 Ga0105240_10504303
700 Ga0105240_11397131
701 Ga0111539_10055749
702 Ga0111539_10160895
703 Ga0111539_10840582
704 Ga0105245_10090667
705 Ga0105245_10091336
706 Ga0105245_10807116
707 Ga0105247_10009761
708 Ga0114129_10014630
709 Ga0114129_10143182
710 Ga0114129_10153466
711 Ga0114129_10233436
712 Ga0114129_11009622
713 Ga0114129_11273046
714 Ga0114129_11473404
715 Ga0114129_11740762
716 Ga0114129_12217173
717 Ga0105243_10575976
718 Ga0105241_10087737
719 Ga0105241_10089093
720 Ga0105241_10141904
721 Ga0105241_10624246
722 Ga0105242_10003389
723 Ga0105248_10169097
724 Ga0105248_10755323
725 Ga0105248_11276275
726 Ga0105238_10175705
727 Ga0105249_10039963
728 Ga0105239_10231297
729 Ga0105239_10595645
730 Ga0105239_11225565
731 Ga0105246_10015894
732 Ga0105246_10190138
733 Ga0157315_1008082
734 Ga0157373_10002380
735 Ga0157373_10077482
736 Ga0157373_10120628
737 Ga0157371_10002907
738 Ga0157370_10006933
739 Ga0157369_10001003
740 Ga0157369_10018225
741 Ga0157369_10021280
742 Ga0157374_10005580
743 Ga0157374_10069083
744 Ga0157374_10140347
745 Ga0157372_10139142
746 Ga0157372_10257809
747 Ga0157372_10782370
748 Ga0157375_10055998
749 Ga0163163_10278786
750 Ga0163163_12097382
751 Ga0157380_10027507
752 Ga0182008_10050339
753 Ga0157377_10001555
754 Ga0157376_10014359
755 Ga0182006_1171976
756 Ga0163161_10007569
757 Ga0197907_10788264
758 Ga0206354_10499979
759 Ga0206354_11045861
760 Ga0213871_10125279
761 Ga0207697_10002780
762 Ga0207656_10090925
763 Ga0207682_10004106
764 Ga0207688_10057032
765 Ga0207647_10002672
766 Ga0207699_10436596
767 Ga0207645_10001560
768 Ga0207643_10000639
769 Ga0207705_10149124
770 Ga0207684_10006757
771 Ga0207684_10026638
772 Ga0207684_10094813
773 Ga0207684_10100277
774 Ga0207684_10122496
775 Ga0207684_11105031
776 Ga0207695_10320351
777 Ga0207695_10660441
778 Ga0207660_10897641
779 Ga0207662_10003901
780 Ga0207662_10027438
781 Ga0207657_10001261
782 Ga0207657_10005688
783 Ga0207649_10158055
784 Ga0207652_10745414
785 Ga0207646_10000037
786 Ga0207646_10037698
787 Ga0207646_10045159
788 Ga0207646_10544614
789 Ga0207646_10771810
790 Ga0207681_10640794
791 Ga0207694_10146809
792 Ga0207694_10240161
793 Ga0207650_10000177
794 Ga0207650_10040788
795 Ga0207659_10071638
796 Ga0207687_10049613
797 Ga0207700_10002698
798 Ga0207644_10192432
799 Ga0207644_10903988
800 Ga0207690_10402101
801 Ga0207690_10745309
802 Ga0207706_10002495
803 Ga0207706_10050747
804 Ga0207706_10363744
805 Ga0207706_10703718
806 Ga0207670_10011311
807 Ga0207670_10066416
808 Ga0207669_10251467
809 Ga0207665_10218441
810 Ga0207665_10862196
811 Ga0207691_10001447
812 Ga0207711_10157713
813 Ga0207711_10180516
814 Ga0207711_10238366
815 Ga0207689_10002307
816 Ga0207689_10157922
817 Ga0207661_10016213
818 Ga0207661_10031498
819 Ga0207679_10000143
820 Ga0207679_10723538
821 Ga0207667_10031734
822 Ga0207667_11292411
823 Ga0207651_10043637
824 Ga0207668_10059933
825 Ga0207640_10004709
826 Ga0207640_10232365
827 Ga0207640_10791981
828 Ga0207658_10005160
829 Ga0207658_10295432
830 Ga0207677_10020934
831 Ga0207703_11424508
832 Ga0207639_10017818
833 Ga0207678_10001668
834 Ga0207678_10926136
835 Ga0207708_10337425
836 Ga0207702_10071365
837 Ga0207702_10187998
838 Ga0207641_10003028
839 Ga0207641_11375059
840 Ga0207648_10003457
841 Ga0207676_10001159
842 Ga0207676_10011008
843 Ga0207676_10936926
844 Ga0207676_11910967
845 Ga0207674_10000195
846 Ga0207674_10498715
847 Ga0207674_10744573
848 Ga0207674_11128874
849 Ga0207675_100165589
850 Ga0207675_100283608
851 Ga0207683_10003688
852 Ga0207683_10856109
853 Ga0207698_10260595
854 Ga0207698_11255616
855 Ga0209969_1000819
856 Ga0209967_1011141
857 Ga0209996_1011764
858 Ga0209995_1000526
859 Ga0209968_1001120
860 Ga0209999_1002816
861 Ga0209970_1014279
862 Ga0209983_1003507
863 Ga0209588_1050130
864 Ga0209971_1000031
865 Ga0209966_1000020
866 Ga0209998_10000024
867 Ga0209974_10009769
868 Ga0207428_10028705
869 Ga0207428_10097852
870 Ga0268266_10003235
871 Ga0268266_10213480
872 Ga0268266_10596101
873 Ga0268265_10010967
874 Ga0268264_10112259
875 Ga0268264_10997612
876 Ga0265762_1001102
877 Ga0307409_101043717
878 Ga0307416_101195075
879 Ga0307415_100688471
880 Ga0316212_1000829
881 Ga0373930_0018331
882 Ga0373948_0049372
883 Ga0373959_0001464
884 Ga0373938_0000524
885 Ga0373928_0010312
886 Ga0373929_0001741
887 Ga0373949_0026594
888 Ga0373949_0030222
889 Ga0373951_0011661
890 Ga0373952_0000806
891 Ga0373932_0025789
892 Ga0373939_0000138
893 Ga0373941_0000086
894 Ga0373960_0008180
895 Ga0373942_0001119
896 Ga0373961_0006481
897 Ga0373962_0014123
898 Ga0373931_0002913
899 Ga0373933_0249035
900 Ga0373937_1251851
901 Ga0395900_0006116
902 Ga0395898_0004956
903 Ga0395898_1252723
904 Ga0395905_0116356
905 Ga0395905_0261199
906 Ga0395905_0374369
907 Ga0395905_0890661
908 Ga0436364_0910392
909 Ga0395901_0000893
910 Ga0395901_0689782
911 Ga0242422_00891
912 Ga0436365_0524461
913 Ga0436365_1738066
914 Ga0436360_0729932
915 Ga0436361_0068265
916 Ga0436363_0606919
917 Ga0439431_0258607
918 Ga0439448_0018809
919 Ga0439435_0021051
920 Ga0439460_0034586
921 Ga0451577_0106161
922 Ga0451577_0108922
923 Ga0439440_0009259
924 Ga0453683_0002445
925 Ga0453683_0129805
926 Ga0453684_1121112
927 Ga0451576_0010342
928 Ga0451576_0110810
929 Ga0451576_1085668
930 Ga0451576_1921342
931 Ga0495669_0597777
932 Ga0496100_0088097
933 Ga0496101_0475260
934 Ga0496102_0212725
935 Ga0496102_0231649
936 Ga0496103_0046092
937 Ga0496106_0058178
938 Ga0496106_0191571
939 Ga0496106_0737713
940 Ga0496107_0046578
941 Ga0496107_0529349
942 Ga0496108_0000689
943 Ga0496109_0001300
944 Ga0496110_0043918
945 Ga0496115_0428869
946 Ga0501032_0228077
947 Ga0501033_0072748
948 Ga0501036_0272373
949 Ga0501038_0038405
950 Ga0501039_0006276
951 Ga0501040_0002281
952 Ga0501041_0034373
953 Ga0501042_0022078
954 Ga0501043_0093359
955 Ga0501046_0000607
956 Ga0501046_0459772
957 Ga0501047_0053799
958 Ga0501067_0327527
959 Ga0501068_0068188
960 Ga0501068_0177681
961 Ga0501069_0058008
962 Ga0501070_0025641
963 Ga0501072_0049358
964 Ga0501073_0004686
965 Ga0501073_0662468
966 Ga0501074_0007780
967 Ga0501074_0088465
968 Ga0501074_1140211
969 Ga0501075_0005460
970 Ga0501076_0053357
971 Ga0501077_0134496
972 Ga0501217_026373
973 Ga0501079_0000976
974 Ga0501080_0046004
975 Ga0501080_0131268
976 Ga0501081_0017810
977 Ga0501081_0911785
978 Ga0501083_0058995
979 Ga0501083_0071395
980 Ga0501045_0003234
981 Ga0501045_0201339
982 nmdc:mga05p37_1090256_c1
983 nmdc:mga05p37_1153359_c1
984 nmdc:mga05p37_1195207_c1
985 nmdc:mga05p37_133931_c1
986 nmdc:mga05p37_1580043_c1
987 nmdc:mga05p37_479355_c1
988 nmdc:mga05p37_594168_c1
989 nmdc:mga09592_1558590_c1
990 nmdc:mga09592_965702_c1
991 nmdc:mga0qj67_172933_c1
992 nmdc:mga06r32_159581_c1
993 nmdc:mga06r32_162149_c1
994 nmdc:mga06r32_268647_c1
995 nmdc:mga06r32_345464_c1
996 nmdc:mga06r32_54016_c1
997 nmdc:mga06r32_722177_c1
998 nmdc:mga06r32_85049_c1
999 nmdc:mga08y16_64803_c1
1000 nmdc:mga08y16_814776_c1
1001 nmdc:mga08y16_945711_c1
1002 nmdc:mga0n895_1329251_c1
1003 nmdc:mga0n895_137297_c1
1004 nmdc:mga0n895_362992_c1
1005 nmdc:mga0n895_41798_c1
1006 nmdc:mga0n895_4_c1
1007 nmdc:mga0n895_50053_c1
1008 nmdc:mga0n895_80538_c1
1009 nmdc:mga0rr50_168177_c1
1010 nmdc:mga0rr50_221644_c1
1011 nmdc:mga0rr50_43462_c1
1012 nmdc:mga0rr50_4_c1
1013 nmdc:mga08x19_137781_c1
1014 nmdc:mga08x19_228025_c1
1015 nmdc:mga08x19_48137_c1
1016 nmdc:mga08x19_5253_c1
1017 nmdc:mga0a205_196177_c1
1018 nmdc:mga0a205_30717_c1
1019 nmdc:mga0a205_311286_c1
1020 nmdc:mga0a205_697575_c1
1021 Ga0501084_0010953
1022 Ga0501082_0001321
1023 Ga0501082_0012651
1024 Ga0530510_0062847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

78

155

0.96

PF14539

DUF4442

Domain of unknown function (DUF4442)

44

163

0.87

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

71

162

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.963 28 144
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9607 26 142
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9568 24 146
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9568 26 143
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9562 25 144
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9618 26 143 3.10.129.10
af_Q9M2E4_49_183_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9577 34 144 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9517 24 142 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9404 25 144 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9312 26 143 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2D7HDP7-F1-model_v4 Thioesterase 0.9926 33 146 GO:0047617
AF-A0A1F7P700-F1-model_v4 Thioesterase domain-containing protein 0.9924 29 152 GO:0005829
GO:0061522
AF-A0A831Y662-F1-model_v4 PaaI family thioesterase 0.9871 23 152 GO:0005829
GO:0061522
AF-A0A7W0G0I7-F1-model_v4 PaaI family thioesterase 0.9868 35 144 GO:0047617
AF-A0A2V8WJJ9-F1-model_v4 PaaI family thioesterase 0.9845 25 152 GO:0005829
GO:0061522

Map