F457225

General Info

Members Datasets Scaffolds Average Seq Length
510 299 486 258

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958122699|2958126508
Length 311
Sequence TEAVSPDTLVDMKDVNKWYGQFHVLRDIKLAVRRGEKLVICGPSGSGKSTLIRCINRLEIHQAGSIIVDGVELTDKIRSIDTVRSEVGMVFQQFNLFPHLTVLENLVLAPVCVRNERRADAIETAMYFLGRVKISEQAHKYPGQLSGGQQQRVAIARSLCMKPKVMLFDEPTSALDPEMVKEVLDVMIELADQGMTMICVTHEMGFARRVANRVIFMDQGQIIEQNAPDNFFDNPQHVRTKLFLSQVFGHSLQDQARSTVEPNAPDFALSSSIIGCGCQRNGTLADGAGICRHNPVGALDGFEQPSWSKVD

Samples

Sample ID Description Type Environment
1 2643221568 Rhizobium sp. Root564 Isolate Unclassified
2 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
3 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
4 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
5 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
6 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
7 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
8 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
9 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
10 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
11 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
12 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
13 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
14 2952252522 Salinicola sp. DM10 Isolate Unclassified
15 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
16 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
17 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
18 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
19 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
20 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
21 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
22 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
23 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
24 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
101 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
181 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0.2
Isolates 4.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 8.63
Nodule 0.59
Rhizoplane 2.75
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c006322 3300000043 Bacteria 1072
2 JGI25159J45721_1009583 3300002987 Bacteria 2544
3 JGI25151J46595_10000420 3300003187 Bacteria 42795
4 JGI25151J46595_10021169 3300003187 Bacteria 2725
5 JGI25153J46596_10000033 3300003215 Bacteria 194912
6 Ga0065707_10004461 3300005295 Bacteria 3681
7 Ga0065707_10089479 3300005295 Bacteria 4357
8 Ga0070690_100037888 3300005330 Bacteria 3040
9 Ga0070690_100483431 3300005330 Bacteria 923
10 Ga0070670_100019096 3300005331 Bacteria 5877
11 Ga0068868_100006679 3300005338 Bacteria 8184
12 Ga0070689_100015980 3300005340 Bacteria 5486
13 Ga0070668_100001207 3300005347 Bacteria 18349
14 Ga0070675_100007842 3300005354 Bacteria 8274
15 Ga0070675_100055259 3300005354 Bacteria 3268
16 Ga0070671_100077372 3300005355 Bacteria 2780
17 Ga0070673_100021464 3300005364 Bacteria 4682
18 Ga0070667_100275177 3300005367 Bacteria 1510
19 Ga0070703_10032095 3300005406 Bacteria 1593
20 Ga0070709_10236796 3300005434 Bacteria 1309
21 Ga0070714_100034276 3300005435 Bacteria 4251
22 Ga0070713_100035066 3300005436 Bacteria 4036
23 Ga0070713_100064644 3300005436 Bacteria 3071
24 Ga0070713_100066455 3300005436 Bacteria 3032
25 Ga0070713_100173343 3300005436 Bacteria 1934
26 Ga0070710_10263582 3300005437 Bacteria 1112
27 Ga0070711_100141942 3300005439 Bacteria 1802
28 Ga0070705_100002227 3300005440 Bacteria 9849
29 Ga0070700_100001544 3300005441 Bacteria 11480
30 Ga0070694_100000604 3300005444 Bacteria 19763
31 Ga0070708_100028165 3300005445 Bacteria 4831
32 Ga0070708_100089734 3300005445 Bacteria 2797
33 Ga0070678_100003587 3300005456 Bacteria 8661
34 Ga0070678_100401660 3300005456 Bacteria 1191
35 Ga0070662_100006187 3300005457 Bacteria 7705
36 Ga0070681_10544126 3300005458 Bacteria 1075
37 Ga0068867_100132835 3300005459 Bacteria 1937
38 Ga0068867_100543885 3300005459 Bacteria 1005
39 Ga0070706_100019382 3300005467 Bacteria 6274
40 Ga0070706_100058795 3300005467 Bacteria 3548
41 Ga0070706_100065014 3300005467 Bacteria 3373
42 Ga0070707_100180288 3300005468 Bacteria 2059
43 Ga0070707_100181045 3300005468 Bacteria 2054
44 Ga0070698_100020542 3300005471 Bacteria 6923
45 Ga0070698_100080183 3300005471 Bacteria 3259
46 Ga0070699_100001264 3300005518 Bacteria 23301
47 Ga0070699_100109382 3300005518 Bacteria 2426
48 Ga0070679_100403872 3300005530 Bacteria 1312
49 Ga0070697_100251089 3300005536 Bacteria 1512
50 Ga0070672_100001050 3300005543 Bacteria 16854
51 Ga0070672_100012617 3300005543 Bacteria 5942
52 Ga0070695_100002718 3300005545 Bacteria 10251
53 Ga0070695_100003107 3300005545 Bacteria 9666
54 Ga0070665_100461288 3300005548 Bacteria 1280
55 Ga0070704_100004637 3300005549 Bacteria 7952
56 Ga0070664_100205435 3300005564 Bacteria 1759
57 Ga0068857_100006147 3300005577 Bacteria 10261
58 Ga0068856_100074699 3300005614 Bacteria 3357
59 Ga0068856_100689991 3300005614 Bacteria 1041
60 Ga0068859_100004768 3300005617 Bacteria 13789
61 Ga0068859_100538959 3300005617 Bacteria 1262
62 Ga0068859_100570377 3300005617 Bacteria 1226
63 Ga0068861_100084908 3300005719 Bacteria 2486
64 Ga0068863_100026756 3300005841 Bacteria 5500
65 Ga0068863_100163554 3300005841 Bacteria 2133
66 Ga0068863_100352494 3300005841 Bacteria 1433
67 Ga0068858_100051099 3300005842 Bacteria 3825
68 Ga0068858_100110758 3300005842 Bacteria 2563
69 Ga0068860_100116712 3300005843 Bacteria 2554
70 Ga0068860_100562590 3300005843 Bacteria 1143
71 Ga0068862_100002512 3300005844 Bacteria 16242
72 Ga0068862_100013452 3300005844 Bacteria 6774
73 Ga0068862_100206333 3300005844 Bacteria 1774
74 Ga0081455_10011670 3300005937 Bacteria 8812
75 Ga0081455_10023373 3300005937 Bacteria 5752
76 Ga0081455_10130945 3300005937 Bacteria 1961
77 Ga0081455_10295868 3300005937 Bacteria 1163
78 Ga0081538_10047489 3300005981 Bacteria 2632
79 Ga0081540_1059415 3300005983 Bacteria 1836
80 Ga0081540_1113360 3300005983 Bacteria 1141
81 Ga0081539_10002517 3300005985 Bacteria 25624
82 Ga0081539_10004924 3300005985 Bacteria 14220
83 Ga0081539_10082405 3300005985 Bacteria 1686
84 Ga0070717_10119287 3300006028 Bacteria 2258
85 Ga0075368_10171976 3300006042 Bacteria 911
86 Ga0075363_100030199 3300006048 Bacteria 2803
87 Ga0075364_10015492 3300006051 Bacteria 4730
88 Ga0075364_10058308 3300006051 Bacteria 2530
89 Ga0075362_10016802 3300006177 Bacteria 3004
90 Ga0075362_10018638 3300006177 Bacteria 2875
91 Ga0075362_10030041 3300006177 Bacteria 2345
92 Ga0075362_10034412 3300006177 Bacteria 2208
93 Ga0075362_10046010 3300006177 Bacteria 1940
94 Ga0075362_10111220 3300006177 Bacteria 1289
95 Ga0075367_10341551 3300006178 Bacteria 944
96 Ga0075369_10000633 3300006186 Bacteria 11169
97 Ga0075366_10010435 3300006195 Bacteria 5216
98 Ga0075366_10049958 3300006195 Bacteria 2483
99 Ga0097621_100334177 3300006237 Bacteria 1344
100 Ga0068871_100323617 3300006358 Bacteria 1358
101 Ga0075428_100075459 3300006844 Bacteria 3681
102 Ga0075428_100106846 3300006844 Bacteria 3051
103 Ga0075428_100772586 3300006844 Bacteria 1022
104 Ga0075430_100122530 3300006846 Bacteria 2168
105 Ga0075430_100325749 3300006846 Bacteria 1270
106 Ga0075431_100017525 3300006847 Bacteria 7280
107 Ga0075431_100098259 3300006847 Bacteria 3023
108 Ga0075431_100154885 3300006847 Bacteria 2358
109 Ga0075429_100026251 3300006880 Bacteria 5056
110 Ga0075429_100101751 3300006880 Bacteria 2509
111 Ga0097620_100004768 3300006931 Bacteria 13789
112 Ga0097620_100538957 3300006931 Bacteria 1262
113 Ga0097620_100570349 3300006931 Bacteria 1226
114 Ga0111539_10000600 3300009094 Bacteria 46579
115 Ga0111539_10000771 3300009094 Bacteria 41650
116 Ga0111539_10002248 3300009094 Bacteria 25734
117 Ga0105245_10510417 3300009098 Bacteria 1219
118 Ga0114129_10081758 3300009147 Bacteria 4490
119 Ga0114129_10084256 3300009147 Bacteria 4414
120 Ga0114129_10147705 3300009147 Bacteria 3219
121 Ga0114129_10443114 3300009147 Bacteria 1705
122 Ga0105243_10290683 3300009148 Bacteria 1476
123 Ga0105242_10020588 3300009176 Bacteria 5174
124 Ga0105242_10185603 3300009176 Bacteria 1837
125 Ga0105242_10253147 3300009176 Bacteria 1588
126 Ga0105248_10001199 3300009177 Bacteria 28958
127 Ga0105248_10022595 3300009177 Bacteria 6980
128 Ga0105248_10357732 3300009177 Bacteria 1644
129 Ga0105237_10213380 3300009545 Bacteria 1930
130 Ga0105249_10004550 3300009553 Bacteria 11979
131 Ga0105249_10177285 3300009553 Bacteria 2071
132 Ga0105249_10212556 3300009553 Bacteria 1899
133 Ga0105239_10026796 3300010375 Bacteria 6344
134 Ga0105246_10003653 3300011119 Bacteria 9313
135 Ga0105246_10429339 3300011119 Bacteria 1105
136 Ga0157326_1003643 3300012513 Bacteria 1617
137 Ga0157338_1005635 3300012515 Bacteria 1132
138 Ga0157371_10012093 3300013102 Bacteria 6612
139 Ga0157369_10504817 3300013105 Bacteria 1251
140 Ga0157369_10586475 3300013105 Bacteria 1151
141 Ga0157374_10227796 3300013296 Bacteria 1830
142 Ga0157374_10380002 3300013296 Bacteria 1407
143 Ga0157378_10359276 3300013297 Bacteria 1425
144 Ga0163162_10009480 3300013306 Bacteria 9465
145 Ga0163162_10456637 3300013306 Bacteria 1409
146 Ga0163162_11208186 3300013306 Bacteria 858
147 Ga0157372_10172089 3300013307 Bacteria 2506
148 Ga0157372_10199809 3300013307 Bacteria 2316
149 Ga0157375_10036117 3300013308 Bacteria 4724
150 Ga0157375_10052996 3300013308 Bacteria 3990
151 Ga0163163_10288855 3300014325 Bacteria 1692
152 Ga0157380_10013281 3300014326 Bacteria 6000
153 Ga0157380_10037695 3300014326 Bacteria 3747
154 Ga0157380_10484978 3300014326 Bacteria 1196
155 Ga0182008_10011974 3300014497 Bacteria 4594
156 Ga0157377_10007573 3300014745 Bacteria 5252
157 Ga0157379_10008803 3300014968 Bacteria 8803
158 Ga0157379_10472202 3300014968 Bacteria 1160
159 Ga0163161_10014330 3300017792 Bacteria 5519
160 Ga0213872_10083665 3300021361 Bacteria 1432
161 Ga0213876_10023645 3300021384 Bacteria 3245
162 Ga0213876_10034856 3300021384 Bacteria 2655
163 Ga0209130_1001791 3300025284 Bacteria 12616
164 Ga0209025_1000094 3300025294 Bacteria 241080
165 Ga0209025_1000225 3300025294 Bacteria 133040
166 Ga0209758_1000070 3300025297 Bacteria 284093
167 Ga0209758_1001483 3300025297 Bacteria 27429
168 Ga0207426_1000317 3300025302 Bacteria 94070
169 Ga0207426_1040774 3300025302 Bacteria 1444
170 Ga0209257_1050571 3300025304 Bacteria 1176
171 Ga0207653_10036821 3300025885 Bacteria 1595
172 Ga0207682_10071856 3300025893 Bacteria 1467
173 Ga0207692_10359588 3300025898 Bacteria 899
174 Ga0207680_10038285 3300025903 Bacteria 2775
175 Ga0207647_10185800 3300025904 Bacteria 1205
176 Ga0207643_10120437 3300025908 Bacteria 1554
177 Ga0207643_10162877 3300025908 Bacteria 1342
178 Ga0207684_10107677 3300025910 Bacteria 2385
179 Ga0207684_10206835 3300025910 Bacteria 1693
180 Ga0207707_10019672 3300025912 Bacteria 5893
181 Ga0207693_10011991 3300025915 Bacteria 7007
182 Ga0207663_10202753 3300025916 Bacteria 1432
183 Ga0207660_10007818 3300025917 Bacteria 6920
184 Ga0207652_10321122 3300025921 Bacteria 1398
185 Ga0207646_10168464 3300025922 Bacteria 1978
186 Ga0207681_10207707 3300025923 Bacteria 1507
187 Ga0207681_10324188 3300025923 Bacteria 1226
188 Ga0207659_10003519 3300025926 Bacteria 9415
189 Ga0207700_10022949 3300025928 Bacteria 4291
190 Ga0207700_10115600 3300025928 Bacteria 2167
191 Ga0207700_10191756 3300025928 Bacteria 1718
192 Ga0207664_10073519 3300025929 Bacteria 2758
193 Ga0207644_10069684 3300025931 Bacteria 2568
194 Ga0207686_10425962 3300025934 Bacteria 1016
195 Ga0207670_10051241 3300025936 Bacteria 2771
196 Ga0207669_10315389 3300025937 Bacteria 1194
197 Ga0207712_10005083 3300025961 Bacteria 8318
198 Ga0207703_10033332 3300026035 Bacteria 4082
199 Ga0207708_10003078 3300026075 Bacteria 12277
200 Ga0207648_10017215 3300026089 Bacteria 6587
201 Ga0207676_10017901 3300026095 Bacteria 5141
202 Ga0207674_10009765 3300026116 Bacteria 10931
203 Ga0207683_10000648 3300026121 Bacteria 31842
204 Ga0207683_10074900 3300026121 Bacteria 2995
205 Ga0209281_1000303 3300027111 Bacteria 88888
206 Ga0209371_1000021 3300027312 Bacteria 555864
207 Ga0209588_1042348 3300027671 Bacteria 1471
208 Ga0207428_10001207 3300027907 Bacteria 27710
209 Ga0207428_10050199 3300027907 Bacteria 3339
210 Ga0268266_10151567 3300028379 Bacteria 2090
211 Ga0268265_10003669 3300028380 Bacteria 10948
212 Ga0268265_10193320 3300028380 Bacteria 1759
213 Ga0307515_10185275 3300028794 Bacteria 2014
214 Ga0268256_1000020 3300030500 Bacteria 557873
215 Ga0316182_1388399 3300030745 Bacteria 1662
216 Ga0265340_10112115 3300031247 Bacteria 1260
217 Ga0265340_10123181 3300031247 Bacteria 1192
218 Ga0265331_10000738 3300031250 Bacteria 27485
219 Ga0307513_10072999 3300031456 Bacteria 3574
220 Ga0307408_100569555 3300031548 Bacteria 1002
221 Ga0265313_10002249 3300031595 Bacteria 16970
222 Ga0307508_10346119 3300031616 Bacteria 1078
223 Ga0316575_10018474 3300031665 Bacteria 2658
224 Ga0316575_10083851 3300031665 Bacteria 1287
225 Ga0316579_10000411 3300031691 Bacteria 13674
226 Ga0316579_10002161 3300031691 Bacteria 7387
227 Ga0316579_10006455 3300031691 Bacteria 4788
228 Ga0316579_10011454 3300031691 Bacteria 3769
229 Ga0316579_10018280 3300031691 Bacteria 3083
230 Ga0316579_10087536 3300031691 Bacteria 1486
231 Ga0316576_10004142 3300031727 Bacteria 8650
232 Ga0316576_10008210 3300031727 Bacteria 6637
233 Ga0316576_10156313 3300031727 Bacteria 1719
234 Ga0316576_10166490 3300031727 Bacteria 1663
235 Ga0316576_10218472 3300031727 Bacteria 1434
236 Ga0316576_10306363 3300031727 Bacteria 1187
237 Ga0316578_10000314 3300031728 Bacteria 14986
238 Ga0316578_10006264 3300031728 Bacteria 5855
239 Ga0316578_10148266 3300031728 Bacteria 1413
240 Ga0307516_10336665 3300031730 Bacteria 1177
241 Ga0316577_10000045 3300031733 Bacteria 28412
242 Ga0316577_10002493 3300031733 Bacteria 9138
243 Ga0316577_10052781 3300031733 Bacteria 2268
244 Ga0316577_10174039 3300031733 Bacteria 1215
245 Ga0307413_10056095 3300031824 Bacteria 2401
246 Ga0307413_10378294 3300031824 Bacteria 1102
247 Ga0307518_10081495 3300031838 Bacteria 2336
248 Ga0307406_10088577 3300031901 Bacteria 2077
249 Ga0307406_10200002 3300031901 Bacteria 1470
250 Ga0307407_10018795 3300031903 Bacteria 3505
251 Ga0307412_10536145 3300031911 Bacteria 980
252 Ga0307409_100021160 3300031995 Bacteria 4453
253 Ga0307409_100201484 3300031995 Bacteria 1781
254 Ga0307416_100051315 3300032002 Bacteria 3294
255 Ga0307411_10007130 3300032005 Bacteria 5662
256 Ga0307411_10337174 3300032005 Bacteria 1224
257 Ga0316583_10002443 3300032133 Bacteria 6448
258 Ga0316583_10003250 3300032133 Bacteria 5710
259 Ga0316583_10003334 3300032133 Bacteria 5652
260 Ga0316583_10005981 3300032133 Bacteria 4372
261 Ga0316583_10032092 3300032133 Bacteria 1868
262 Ga0316583_10061428 3300032133 Bacteria 1316
263 Ga0316585_10001450 3300032137 Bacteria 6268
264 Ga0316585_10001779 3300032137 Bacteria 5759
265 Ga0316580_10001711 3300032139 Bacteria 5846
266 Ga0316580_10012796 3300032139 Bacteria 2557
267 Ga0316580_10033575 3300032139 Bacteria 1588
268 Ga0373939_0019750 3300035114 Bacteria 1822
269 Ga0373941_0054958 3300035115 Bacteria 1278
270 Ga0373954_0023185 3300035118 Bacteria 2820
271 Ga0373956_0016383 3300035119 Bacteria 3113
272 Ga0373957_0011436 3300035120 Bacteria 2963
273 Ga0373943_0063094 3300035170 Bacteria 1857
274 Ga0316574_0000316 3300035398 Bacteria 18447
275 Ga0316574_0000560 3300035398 Bacteria 15384
276 Ga0316574_0003075 3300035398 Bacteria 8513
277 Ga0316574_0004087 3300035398 Bacteria 7604
278 Ga0316574_0018030 3300035398 Bacteria 4142
279 Ga0316574_0020932 3300035398 Bacteria 3877
280 Ga0316574_0078197 3300035398 Bacteria 2097
281 Ga0373935_0054961 3300035692 Bacteria 2537
282 Ga0373933_0051543 3300035724 Bacteria 2460
283 Ga0373947_0322041 3300035725 Bacteria 1034
284 Ga0373937_0192510 3300036401 Bacteria 1916
285 Ga0316582_0003497 3300036647 Bacteria 7708
286 Ga0316582_0007699 3300036647 Bacteria 5749
287 Ga0316582_0013558 3300036647 Bacteria 4593
288 Ga0316582_0025834 3300036647 Bacteria 3530
289 Ga0316582_0037492 3300036647 Bacteria 3006
290 Ga0316582_0105406 3300036647 Bacteria 1871
291 Ga0316582_0130531 3300036647 Bacteria 1687
292 Ga0316584_0005266 3300036712 Bacteria 8658
293 Ga0316584_0011490 3300036712 Bacteria 6224
294 Ga0316584_0018694 3300036712 Bacteria 5002
295 Ga0316584_0021339 3300036712 Bacteria 4706
296 Ga0316584_0071103 3300036712 Bacteria 2607
297 Ga0316584_0324065 3300036712 Bacteria 1111
298 Ga0373925_0143197 3300037068 Bacteria 1872
299 Ga0316581_0057569 3300037588 Bacteria 1192
300 Ga0436364_0403885 3300037853 Bacteria 5506
301 Ga0400484_33003 3300038725 Bacteria 1015
302 Ga0400483_015048 3300039062 Bacteria 11631
303 Ga0400483_093437 3300039062 Bacteria 26072
304 Ga0400483_129631 3300039062 Bacteria 2604
305 Ga0400483_134490 3300039062 Bacteria 3599
306 Ga0400483_157048 3300039062 Bacteria 4715
307 Ga0400483_262569 3300039062 Bacteria 2158
308 Ga0436365_0233045 3300039437 Bacteria 6984
309 Ga0436365_0346418 3300039437 Bacteria 10652
310 Ga0436360_0317613 3300039438 Bacteria 1443
311 Ga0436360_0352512 3300039438 Bacteria 3393
312 Ga0436360_0354988 3300039438 Bacteria 4526
313 Ga0436360_0720592 3300039438 Bacteria 1223
314 Ga0436361_0781565 3300039447 Bacteria 2866
315 Ga0436363_1161520 3300039450 Bacteria 1110
316 Ga0436363_1353470 3300039450 Bacteria 1391
317 Ga0436362_0016437 3300039453 Bacteria 3545
318 Ga0439455_0048504 3300042012 Bacteria 1105
319 Ga0439435_0045889 3300042436 Bacteria 1237
320 Ga0451577_0007509 3300042876 Bacteria 10710
321 Ga0453684_0079957 3300044712 Bacteria 4084
322 Ga0451576_0003175 3300045051 Bacteria 22963
323 Ga0451576_0744099 3300045051 Bacteria 1030
324 Ga0495664_0001415 3300046477 Bacteria 12716
325 Ga0495664_0076169 3300046477 Bacteria 2008
326 Ga0495608_0152125 3300046511 Bacteria 1474
327 Ga0495608_0288757 3300046511 Bacteria 1017
328 Ga0495610_0015517 3300046512 Bacteria 4422
329 Ga0495618_0173951 3300046514 Bacteria 1370
330 Ga0495628_0020351 3300046516 Bacteria 5476
331 Ga0495587_0028162 3300046536 Bacteria 3419
332 Ga0495645_0008297 3300046543 Bacteria 7248
333 Ga0495667_0090883 3300046559 Bacteria 1978
334 Ga0495657_0034708 3300046675 Bacteria 3501
335 Ga0495599_0011772 3300046678 Bacteria 5377
336 Ga0495646_0016881 3300046680 Bacteria 4636
337 Ga0495675_0015943 3300047444 Bacteria 4752
338 Ga0495675_0054678 3300047444 Bacteria 2533
339 Ga0495686_0003359 3300047472 Bacteria 13945
340 Ga0495602_0228130 3300048088 Bacteria 1401
341 Ga0496100_0203719 3300048903 Bacteria 1443
342 Ga0496102_0023979 3300048905 Bacteria 5423
343 Ga0496105_0011952 3300048908 Bacteria 6875
344 Ga0496106_0001529 3300048909 Bacteria 17390
345 Ga0496106_0035611 3300048909 Bacteria 3722
346 Ga0496109_0017896 3300048912 Bacteria 6219
347 Ga0496109_0200966 3300048912 Bacteria 1873
348 Ga0496110_0049319 3300048913 Bacteria 3693
349 Ga0496110_0427005 3300048913 Bacteria 1208
350 Ga0496111_0003900 3300048914 Bacteria 9340
351 Ga0496112_0169282 3300048915 Bacteria 2150
352 Ga0496113_0054574 3300048916 Bacteria 2991
353 Ga0496114_0049793 3300048917 Bacteria 3486
354 Ga0496115_0026510 3300048918 Bacteria 4524
355 Ga0496116_0000043 3300048919 Bacteria 328085
356 Ga0496116_0069063 3300048919 Bacteria 2248
357 Ga0496117_0006409 3300048920 Bacteria 11930
358 Ga0496118_0066081 3300048921 Bacteria 2641
359 Ga0496121_0000001 3300048924 Bacteria 1830318
360 Ga0496121_0011262 3300048924 Bacteria 9966
361 Ga0496122_0000025 3300048925 Bacteria 362915
362 Ga0496122_0055485 3300048925 Bacteria 2964
363 Ga0496122_0142346 3300048925 Bacteria 1497
364 Ga0496122_0158970 3300048925 Bacteria 1381
365 Ga0496123_0000032 3300048926 Bacteria 285282
366 Ga0496123_0018239 3300048926 Bacteria 5591
367 Ga0496123_0033538 3300048926 Bacteria 3693
368 Ga0496124_0015616 3300048927 Bacteria 7268
369 Ga0496124_0027074 3300048927 Bacteria 5157
370 Ga0496124_0078664 3300048927 Bacteria 2717
371 Ga0496124_0113068 3300048927 Bacteria 2182
372 Ga0496125_0000001 3300048928 Bacteria 1766138
373 Ga0496126_0000369 3300048929 Bacteria 92814
374 Ga0496126_0147023 3300048929 Bacteria 2023
375 Ga0501032_0001025 3300049569 Bacteria 22442
376 Ga0501033_0003029 3300049570 Bacteria 13990
377 Ga0501034_0024977 3300049571 Bacteria 6079
378 Ga0501034_0025364 3300049571 Bacteria 6035
379 Ga0501036_0001419 3300049572 Bacteria 18419
380 Ga0501036_0252123 3300049572 Bacteria 1479
381 Ga0501036_0303454 3300049572 Bacteria 1335
382 Ga0501037_0003506 3300049573 Bacteria 11384
383 Ga0501038_0003266 3300049574 Bacteria 15128
384 Ga0501038_0043366 3300049574 Bacteria 3912
385 Ga0501038_0533671 3300049574 Bacteria 894
386 Ga0501039_0002791 3300049575 Bacteria 13048
387 Ga0501039_0091941 3300049575 Bacteria 2365
388 Ga0501039_0176627 3300049575 Bacteria 1680
389 Ga0501039_0340136 3300049575 Bacteria 1179
390 Ga0501040_0026937 3300049576 Bacteria 3867
391 Ga0501040_0219988 3300049576 Bacteria 1351
392 Ga0501041_0009305 3300049577 Bacteria 5786
393 Ga0501041_0150068 3300049577 Bacteria 1455
394 Ga0501042_0004303 3300049578 Bacteria 9071
395 Ga0501042_0323206 3300049578 Bacteria 1115
396 Ga0501043_0000339 3300049579 Bacteria 42404
397 Ga0501046_0000671 3300049580 Bacteria 33150
398 Ga0501046_0036757 3300049580 Bacteria 3940
399 Ga0501046_0059099 3300049580 Bacteria 3005
400 Ga0501047_0001976 3300049581 Bacteria 19681
401 Ga0501048_0048666 3300049582 Bacteria 3023
402 Ga0501069_0000349 3300049585 Bacteria 20802
403 Ga0501070_0190735 3300049586 Bacteria 1685
404 Ga0501070_0543194 3300049586 Bacteria 931
405 Ga0501071_0038354 3300049587 Bacteria 3424
406 Ga0501072_0020599 3300049588 Bacteria 5111
407 Ga0501072_0198025 3300049588 Bacteria 1602
408 Ga0501073_0298980 3300049589 Bacteria 1110
409 Ga0501075_0006258 3300049591 Bacteria 8184
410 Ga0501075_0358034 3300049591 Bacteria 1112
411 Ga0501076_0088617 3300049592 Bacteria 2487
412 Ga0501076_0238841 3300049592 Bacteria 1486
413 Ga0501076_0293265 3300049592 Bacteria 1333
414 Ga0501077_0028280 3300049593 Bacteria 3562
415 Ga0501238_012008 3300049671 Bacteria 1168
416 Ga0501079_0007638 3300049741 Bacteria 8190
417 Ga0501080_0000471 3300049742 Bacteria 31285
418 Ga0501080_0481724 3300049742 Bacteria 1110
419 Ga0501081_0036208 3300049743 Bacteria 3364
420 Ga0501081_0145196 3300049743 Bacteria 1702
421 Ga0501035_0001114 3300049822 Bacteria 28107
422 Ga0501044_0002829 3300049823 Bacteria 19746
423 Ga0501044_0132518 3300049823 Bacteria 2486
424 Ga0501044_0177980 3300049823 Bacteria 2095
425 Ga0501045_0010853 3300049824 Bacteria 6386
426 Ga0501045_0012824 3300049824 Bacteria 5907
427 Ga0501045_0092883 3300049824 Bacteria 2232
428 Ga0501045_0171768 3300049824 Bacteria 1614
429 Ga0501045_0594215 3300049824 Bacteria 820
430 nmdc:mga03683_120432_c1 3300050489 Bacteria 1166
431 nmdc:mga03683_16363_c1 3300050489 Bacteria 2784
432 nmdc:mga03683_177921_c1 3300050489 Bacteria 969
433 nmdc:mga00v17_18973_c1 3300050491 Bacteria 3917
434 nmdc:mga06z11_36937_c1 3300050494 Bacteria 2416
435 nmdc:mga04h51_5815_c1 3300050495 Bacteria 3161
436 nmdc:mga07m45_187116_c1 3300050496 Bacteria 1204
437 nmdc:mga05p37_182939_c1 3300050507 Bacteria 2549
438 nmdc:mga05p37_497173_c1 3300050507 Bacteria 1401
439 nmdc:mga05p37_542517_c1 3300050507 Bacteria 1326
440 nmdc:mga05p37_80468_c1 3300050507 Bacteria 1401
441 nmdc:mga09592_17270_c1 3300050508 Bacteria 5909
442 nmdc:mga09592_37786_c1 3300050508 Bacteria 4051
443 nmdc:mga09592_523536_c1 3300050508 Bacteria 1020
444 nmdc:mga0qj67_110798_c1 3300050509 Bacteria 2216
445 nmdc:mga06r32_132089_c1 3300050510 Bacteria 2469
446 nmdc:mga06r32_204061_c1 3300050510 Bacteria 1964
447 nmdc:mga06r32_314512_c1 3300050510 Bacteria 1552
448 nmdc:mga06r32_51289_c1 3300050510 Bacteria 3948
449 nmdc:mga06r32_66485_c1 3300050510 Bacteria 3478
450 nmdc:mga06r32_69498_c1 3300050510 Bacteria 3404
451 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
452 nmdc:mga08y16_3513_c1 3300050511 Bacteria 16273
453 nmdc:mga08y16_65102_c1 3300050511 Bacteria 3805
454 nmdc:mga08y16_866_c1 3300050511 Bacteria 29145
455 nmdc:mga0a205_108370_c1 3300050515 Bacteria 2676
456 nmdc:mga0sz30_169_c1 3300050516 Bacteria 17103
457 Ga0495601_0134650 3300053077 Bacteria 1610
458 Ga0495601_0148769 3300053077 Bacteria 1528
459 Ga0495601_0239417 3300053077 Bacteria 1185
460 Ga0495612_0000204 3300053078 Bacteria 25372
461 Ga0495595_0009279 3300053084 Bacteria 4063
462 Ga0500651_0136999 3300053093 Bacteria 1478
463 Ga0500641_0003682 3300053096 Bacteria 5410
464 Ga0500641_0025605 3300053096 Bacteria 2283
465 Ga0500642_0159816 3300053130 Bacteria 1056
466 Ga0500658_0143359 3300053134 Bacteria 1073
467 Ga0500568_0013134 3300053139 Bacteria 3782
468 Ga0500604_0000809 3300053151 Bacteria 8610
469 Ga0500616_0000974 3300053153 Bacteria 30889
470 Ga0500616_0001438 3300053153 Bacteria 22861
471 Ga0500609_000036 3300053731 Bacteria 18052
472 Ga0501084_0019606 3300054114 Bacteria 5635
473 Ga0501084_0021381 3300054114 Bacteria 5392
474 Ga0501084_0102380 3300054114 Bacteria 2405
475 Ga0501084_0165616 3300054114 Bacteria 1866
476 Ga0501084_0593049 3300054114 Bacteria 936
477 Ga0587068_000214 3300059641 Bacteria 4524
478 Ga0501082_0001076 3300060353 Bacteria 24166
479 Ga0501082_0011523 3300060353 Bacteria 7609
480 Ga0501082_0016262 3300060353 Bacteria 6405
481 Ga0501082_0053636 3300060353 Bacteria 3475
482 Ga0501082_0081247 3300060353 Bacteria 2797
483 Ga0530510_0004618 3300061734 Bacteria 9526
484 Ga0530510_0009211 3300061734 Bacteria 6921
485 Ga0530510_0036161 3300061734 Bacteria 3559
486 Ga0530510_0409438 3300061734 Bacteria 1023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10510417 Ga0105245_105104171 243
2 3300005467 Ga0070706_100065014 Ga0070706_1000650143 244
3 3300005468 Ga0070707_100180288 Ga0070707_1001802884 244
4 3300005471 Ga0070698_100080183 Ga0070698_1000801833 244
5 3300006051 Ga0075364_10015492 Ga0075364_100154924 244
6 3300006847 Ga0075431_100098259 Ga0075431_1000982592 244
7 3300009176 Ga0105242_10020588 Ga0105242_100205884 244
8 3300009177 Ga0105248_10357732 Ga0105248_103577322 244
9 3300009553 Ga0105249_10177285 Ga0105249_101772852 244
10 3300012513 Ga0157326_1003643 Ga0157326_10036431 244
11 3300013105 Ga0157369_10504817 Ga0157369_105048171 244
12 3300013296 Ga0157374_10227796 Ga0157374_102277963 244
13 3300013297 Ga0157378_10359276 Ga0157378_103592761 244
14 3300014326 Ga0157380_10037695 Ga0157380_100376952 244
15 3300014745 Ga0157377_10007573 Ga0157377_100075732 244
16 3300025922 Ga0207646_10168464 Ga0207646_101684643 244
17 3300048903 Ga0496100_0203719 Ga0496100_0203719_506_1258 244
18 3300048908 Ga0496105_0011952 Ga0496105_0011952_5899_6651 244
19 3300048909 Ga0496106_0035611 Ga0496106_0035611_152_904 244
20 3300048912 Ga0496109_0017896 Ga0496109_0017896_1816_2568 244
21 3300048917 Ga0496114_0049793 Ga0496114_0049793_2418_3170 244
22 3300049575 Ga0501039_0340136 Ga0501039_0340136_188_976 244
23 3300049588 Ga0501072_0020599 Ga0501072_0020599_1031_1819 244
24 3300049592 Ga0501076_0238841 Ga0501076_0238841_228_1016 244
25 3300061734 Ga0530510_0036161 Ga0530510_0036161_818_1606 244
26 3300005937 Ga0081455_10023373 Ga0081455_100233733 245
27 3300006846 Ga0075430_100122530 Ga0075430_1001225302 245
28 3300006847 Ga0075431_100017525 Ga0075431_1000175252 245
29 3300006880 Ga0075429_100026251 Ga0075429_1000262515 245
30 3300025910 Ga0207684_10107677 Ga0207684_101076773 245
31 3300038725 Ga0400484_33003 Ga0400484_33003_71_835 245
32 3300039062 Ga0400483_129631 Ga0400483_129631_890_1660 245
33 3300039438 Ga0436360_0720592 Ga0436360_0720592_36_791 245
34 3300044712 Ga0453684_0079957 Ga0453684_0079957_945_1694 245
35 3300048919 Ga0496116_0069063 Ga0496116_0069063_564_1313 245
36 3300048920 Ga0496117_0006409 Ga0496117_0006409_8362_9111 245
37 3300048921 Ga0496118_0066081 Ga0496118_0066081_1725_2474 245
38 3300050491 nmdc:mga00v17_18973_c1 nmdc:mga00v17_18973_c1_2922_3671 245
39 3300050508 nmdc:mga09592_37786_c1 nmdc:mga09592_37786_c1_1916_2707 245
40 3300050509 nmdc:mga0qj67_110798_c1 nmdc:mga0qj67_110798_c1_136_927 245
41 3300050510 nmdc:mga06r32_51289_c1 nmdc:mga06r32_51289_c1_1737_2528 245
42 iso_pu_bacteria 2643221568 2643855672 245
43 iso_pu_bacteria 2818991439 2819559870 245
44 iso_pu_bacteria 2854896431 2854902007 245
45 iso_pu_bacteria 2854916844 2854916915 245
46 iso_pu_bacteria 2919166419 2919167564 245
47 iso_pu_bacteria 2929138655 2929139859 245
48 iso_pu_bacteria 2978969890 2978974011 245
49 iso_pu_bacteria 2979100975 2979106197 245
50 iso_pu_bacteria 2984509177 2984512007 245
51 iso_pu_bacteria 2984518228 2984521632 245
52 iso_pu_bacteria 2984537506 2984540926 245
53 iso_pu_bacteria 2984587000 2984589340 245
54 iso_pu_bacteria 2984601300 2984603188 245
55 3300005331 Ga0070670_100019096 Ga0070670_1000190962 246
56 3300005354 Ga0070675_100055259 Ga0070675_1000552592 246
57 3300005364 Ga0070673_100021464 Ga0070673_1000214644 246
58 3300005456 Ga0070678_100401660 Ga0070678_1004016601 246
59 3300005457 Ga0070662_100006187 Ga0070662_1000061872 246
60 3300005459 Ga0068867_100132835 Ga0068867_1001328352 246
61 3300005459 Ga0068867_100543885 Ga0068867_1005438852 246
62 3300005543 Ga0070672_100012617 Ga0070672_1000126172 246
63 3300005564 Ga0070664_100205435 Ga0070664_1002054352 246
64 3300005719 Ga0068861_100084908 Ga0068861_1000849082 246
65 3300005842 Ga0068858_100110758 Ga0068858_1001107583 246
66 3300005844 Ga0068862_100206333 Ga0068862_1002063332 246
67 3300005937 Ga0081455_10295868 Ga0081455_102958682 246
68 3300009176 Ga0105242_10185603 Ga0105242_101856032 246
69 3300009545 Ga0105237_10213380 Ga0105237_102133802 246
70 3300010375 Ga0105239_10026796 Ga0105239_100267962 246
71 3300013306 Ga0163162_11208186 Ga0163162_112081861 246
72 3300021361 Ga0213872_10083665 Ga0213872_100836652 246
73 3300025934 Ga0207686_10425962 Ga0207686_104259622 246
74 3300027111 Ga0209281_1000303 Ga0209281_100030325 246
75 3300028379 Ga0268266_10151567 Ga0268266_101515673 246
76 3300028794 Ga0307515_10185275 Ga0307515_101852752 246
77 3300031456 Ga0307513_10072999 Ga0307513_100729992 246
78 3300036647 Ga0316582_0025834 Ga0316582_0025834_25_780 246
79 3300039062 Ga0400483_093437 Ga0400483_093437_8912_9670 246
80 3300045051 Ga0451576_0744099 Ga0451576_0744099_177_932 246
81 3300048913 Ga0496110_0049319 Ga0496110_0049319_502_1257 246
82 3300048914 Ga0496111_0003900 Ga0496111_0003900_7597_8352 246
83 3300048924 Ga0496121_0011262 Ga0496121_0011262_2844_3599 246
84 3300048925 Ga0496122_0158970 Ga0496122_0158970_217_972 246
85 3300048926 Ga0496123_0018239 Ga0496123_0018239_3240_3995 246
86 3300048927 Ga0496124_0015616 Ga0496124_0015616_5597_6352 246
87 3300048927 Ga0496124_0113068 Ga0496124_0113068_324_1079 246
88 3300049571 Ga0501034_0025364 Ga0501034_0025364_1475_2236 246
89 3300049572 Ga0501036_0252123 Ga0501036_0252123_13_774 246
90 3300049575 Ga0501039_0091941 Ga0501039_0091941_918_1712 246
91 3300049577 Ga0501041_0150068 Ga0501041_0150068_159_953 246
92 3300049588 Ga0501072_0198025 Ga0501072_0198025_163_921 246
93 3300049589 Ga0501073_0298980 Ga0501073_0298980_65_835 246
94 3300049671 Ga0501238_012008 Ga0501238_012008_262_1017 246
95 3300049823 Ga0501044_0132518 Ga0501044_0132518_1078_1839 246
96 3300049824 Ga0501045_0171768 Ga0501045_0171768_613_1407 246
97 3300050494 nmdc:mga06z11_36937_c1 nmdc:mga06z11_36937_c1_246_1022 246
98 3300050495 nmdc:mga04h51_5815_c1 nmdc:mga04h51_5815_c1_826_1602 246
99 3300053153 Ga0500616_0000974 Ga0500616_0000974_15748_16500 246
100 3300054114 Ga0501084_0593049 Ga0501084_0593049_13_807 246
101 3300060353 Ga0501082_0053636 Ga0501082_0053636_1087_1881 246
102 3300060353 Ga0501082_0081247 Ga0501082_0081247_94_864 246
103 3300061734 Ga0530510_0009211 Ga0530510_0009211_4859_5653 246
104 iso_pu_bacteria 2648501241 2649121785 246
105 iso_pu_bacteria 2651869818 2652976324 246
106 iso_pu_bacteria 2687453129 2687577409 246
107 iso_pu_bacteria 2687453129 2687580030 246
108 iso_pu_bacteria 2821443989 2821445423 246
109 iso_pu_bacteria 2844533157 2844535430 246
110 iso_pu_bacteria 2883291878 2883294212 246
111 iso_pu_bacteria 2883354860 2883357259 246
112 iso_pu_bacteria 2952252522 2952255024 246
113 iso_pu_bacteria 2958122699 2958126508 246
114 iso_pu_bacteria 2977872689 2977873050 246
115 3300003187 JGI25151J46595_10021169 JGI25151J46595_100211693 247
116 3300005458 Ga0070681_10544126 Ga0070681_105441261 247
117 3300006051 Ga0075364_10058308 Ga0075364_100583084 247
118 3300006177 Ga0075362_10016802 Ga0075362_100168022 247
119 3300009148 Ga0105243_10290683 Ga0105243_102906832 247
120 3300013102 Ga0157371_10012093 Ga0157371_100120936 247
121 3300013307 Ga0157372_10172089 Ga0157372_101720893 247
122 3300025294 Ga0209025_1000094 Ga0209025_1000094103 247
123 3300027312 Ga0209371_1000021 Ga0209371_100002152 247
124 3300030500 Ga0268256_1000020 Ga0268256_100002058 247
125 3300030745 Ga0316182_1388399 Ga0316182_13883992 247
126 3300031691 Ga0316579_10000411 Ga0316579_100004114 247
127 3300031691 Ga0316579_10006455 Ga0316579_100064554 247
128 3300031691 Ga0316579_10018280 Ga0316579_100182802 247
129 3300031691 Ga0316579_10087536 Ga0316579_100875362 247
130 3300031727 Ga0316576_10008210 Ga0316576_100082103 247
131 3300031727 Ga0316576_10156313 Ga0316576_101563132 247
132 3300031727 Ga0316576_10306363 Ga0316576_103063631 247
133 3300031728 Ga0316578_10000314 Ga0316578_100003147 247
134 3300031728 Ga0316578_10148266 Ga0316578_101482662 247
135 3300031733 Ga0316577_10052781 Ga0316577_100527812 247
136 3300031733 Ga0316577_10174039 Ga0316577_101740392 247
137 3300031824 Ga0307413_10378294 Ga0307413_103782942 247
138 3300032005 Ga0307411_10337174 Ga0307411_103371741 247
139 3300032133 Ga0316583_10002443 Ga0316583_100024434 247
140 3300032133 Ga0316583_10003250 Ga0316583_100032504 247
141 3300032133 Ga0316583_10003334 Ga0316583_100033342 247
142 3300032133 Ga0316583_10032092 Ga0316583_100320922 247
143 3300032133 Ga0316583_10061428 Ga0316583_100614282 247
144 3300032137 Ga0316585_10001450 Ga0316585_100014505 247
145 3300032139 Ga0316580_10012796 Ga0316580_100127963 247
146 3300032139 Ga0316580_10033575 Ga0316580_100335751 247
147 3300035398 Ga0316574_0000316 Ga0316574_0000316_16134_16910 247
148 3300035398 Ga0316574_0004087 Ga0316574_0004087_1152_1928 247
149 3300035398 Ga0316574_0018030 Ga0316574_0018030_248_1024 247
150 3300035398 Ga0316574_0020932 Ga0316574_0020932_2773_3549 247
151 3300035398 Ga0316574_0078197 Ga0316574_0078197_379_1155 247
152 3300036647 Ga0316582_0007699 Ga0316582_0007699_4958_5734 247
153 3300036647 Ga0316582_0013558 Ga0316582_0013558_1888_2664 247
154 3300036647 Ga0316582_0037492 Ga0316582_0037492_1556_2332 247
155 3300036647 Ga0316582_0105406 Ga0316582_0105406_270_1046 247
156 3300036647 Ga0316582_0130531 Ga0316582_0130531_691_1467 247
157 3300036712 Ga0316584_0011490 Ga0316584_0011490_3682_4458 247
158 3300036712 Ga0316584_0018694 Ga0316584_0018694_4098_4874 247
159 3300036712 Ga0316584_0021339 Ga0316584_0021339_2684_3460 247
160 3300036712 Ga0316584_0324065 Ga0316584_0324065_212_988 247
161 3300037588 Ga0316581_0057569 Ga0316581_0057569_298_1074 247
162 3300048919 Ga0496116_0000043 Ga0496116_0000043_92579_93352 247
163 3300048924 Ga0496121_0000001 Ga0496121_0000001_1240373_1241146 247
164 3300048925 Ga0496122_0000025 Ga0496122_0000025_359157_359930 247
165 3300048925 Ga0496122_0055485 Ga0496122_0055485_143_916 247
166 3300048925 Ga0496122_0142346 Ga0496122_0142346_92_865 247
167 3300048926 Ga0496123_0000032 Ga0496123_0000032_4283_5056 247
168 3300048926 Ga0496123_0033538 Ga0496123_0033538_838_1611 247
169 3300048927 Ga0496124_0027074 Ga0496124_0027074_3982_4755 247
170 3300048927 Ga0496124_0078664 Ga0496124_0078664_1504_2277 247
171 3300048928 Ga0496125_0000001 Ga0496125_0000001_1399450_1400223 247
172 3300048929 Ga0496126_0000369 Ga0496126_0000369_33918_34691 247
173 3300049574 Ga0501038_0533671 Ga0501038_0533671_49_846 247
174 3300049578 Ga0501042_0323206 Ga0501042_0323206_140_910 247
175 3300049580 Ga0501046_0059099 Ga0501046_0059099_1046_1843 247
176 3300049824 Ga0501045_0092883 Ga0501045_0092883_471_1268 247
177 3300050489 nmdc:mga03683_120432_c1 nmdc:mga03683_120432_c1_317_1090 247
178 3300054114 Ga0501084_0165616 Ga0501084_0165616_474_1271 247
179 3300059641 Ga0587068_000214 Ga0587068_000214_189_962 247
180 3300002987 JGI25159J45721_1009583 JGI25159J45721_10095833 248
181 3300003187 JGI25151J46595_10000420 JGI25151J46595_1000042028 248
182 3300003215 JGI25153J46596_10000033 JGI25153J46596_1000003371 248
183 3300005295 Ga0065707_10004461 Ga0065707_100044615 248
184 3300005295 Ga0065707_10089479 Ga0065707_100894795 248
185 3300005330 Ga0070690_100037888 Ga0070690_1000378884 248
186 3300005330 Ga0070690_100483431 Ga0070690_1004834311 248
187 3300005338 Ga0068868_100006679 Ga0068868_1000066793 248
188 3300005340 Ga0070689_100015980 Ga0070689_1000159805 248
189 3300005347 Ga0070668_100001207 Ga0070668_10000120712 248
190 3300005354 Ga0070675_100007842 Ga0070675_1000078422 248
191 3300005355 Ga0070671_100077372 Ga0070671_1000773722 248
192 3300005367 Ga0070667_100275177 Ga0070667_1002751772 248
193 3300005406 Ga0070703_10032095 Ga0070703_100320951 248
194 3300005434 Ga0070709_10236796 Ga0070709_102367962 248
195 3300005435 Ga0070714_100034276 Ga0070714_1000342766 248
196 3300005436 Ga0070713_100035066 Ga0070713_1000350662 248
197 3300005436 Ga0070713_100064644 Ga0070713_1000646441 248
198 3300005436 Ga0070713_100066455 Ga0070713_1000664553 248
199 3300005436 Ga0070713_100173343 Ga0070713_1001733432 248
200 3300005437 Ga0070710_10263582 Ga0070710_102635822 248
201 3300005439 Ga0070711_100141942 Ga0070711_1001419422 248
202 3300005440 Ga0070705_100002227 Ga0070705_1000022274 248
203 3300005441 Ga0070700_100001544 Ga0070700_1000015444 248
204 3300005444 Ga0070694_100000604 Ga0070694_1000006044 248
205 3300005445 Ga0070708_100028165 Ga0070708_1000281653 248
206 3300005445 Ga0070708_100089734 Ga0070708_1000897342 248
207 3300005456 Ga0070678_100003587 Ga0070678_10000358710 248
208 3300005467 Ga0070706_100019382 Ga0070706_1000193824 248
209 3300005467 Ga0070706_100058795 Ga0070706_1000587951 248
210 3300005468 Ga0070707_100181045 Ga0070707_1001810452 248
211 3300005471 Ga0070698_100020542 Ga0070698_1000205427 248
212 3300005518 Ga0070699_100001264 Ga0070699_1000012644 248
213 3300005518 Ga0070699_100109382 Ga0070699_1001093823 248
214 3300005530 Ga0070679_100403872 Ga0070679_1004038722 248
215 3300005536 Ga0070697_100251089 Ga0070697_1002510892 248
216 3300005543 Ga0070672_100001050 Ga0070672_1000010503 248
217 3300005545 Ga0070695_100002718 Ga0070695_1000027185 248
218 3300005545 Ga0070695_100003107 Ga0070695_1000031078 248
219 3300005548 Ga0070665_100461288 Ga0070665_1004612881 248
220 3300005549 Ga0070704_100004637 Ga0070704_1000046374 248
221 3300005577 Ga0068857_100006147 Ga0068857_1000061474 248
222 3300005614 Ga0068856_100074699 Ga0068856_1000746994 248
223 3300005614 Ga0068856_100689991 Ga0068856_1006899911 248
224 3300005617 Ga0068859_100004768 Ga0068859_10000476811 248
225 3300005617 Ga0068859_100538959 Ga0068859_1005389591 248
226 3300005617 Ga0068859_100570377 Ga0068859_1005703772 248
227 3300005841 Ga0068863_100026756 Ga0068863_1000267563 248
228 3300005841 Ga0068863_100163554 Ga0068863_1001635542 248
229 3300005841 Ga0068863_100352494 Ga0068863_1003524942 248
230 3300005842 Ga0068858_100051099 Ga0068858_1000510992 248
231 3300005843 Ga0068860_100116712 Ga0068860_1001167121 248
232 3300005843 Ga0068860_100562590 Ga0068860_1005625902 248
233 3300005844 Ga0068862_100002512 Ga0068862_1000025124 248
234 3300005844 Ga0068862_100013452 Ga0068862_1000134522 248
235 3300005937 Ga0081455_10011670 Ga0081455_100116708 248
236 3300005937 Ga0081455_10130945 Ga0081455_101309452 248
237 3300005981 Ga0081538_10047489 Ga0081538_100474893 248
238 3300005983 Ga0081540_1059415 Ga0081540_10594151 248
239 3300005983 Ga0081540_1113360 Ga0081540_11133601 248
240 3300005985 Ga0081539_10002517 Ga0081539_1000251713 248
241 3300005985 Ga0081539_10004924 Ga0081539_100049247 248
242 3300005985 Ga0081539_10082405 Ga0081539_100824052 248
243 3300006028 Ga0070717_10119287 Ga0070717_101192871 248
244 3300006042 Ga0075368_10171976 Ga0075368_101719761 248
245 3300006048 Ga0075363_100030199 Ga0075363_1000301993 248
246 3300006177 Ga0075362_10018638 Ga0075362_100186382 248
247 3300006177 Ga0075362_10030041 Ga0075362_100300412 248
248 3300006177 Ga0075362_10034412 Ga0075362_100344123 248
249 3300006177 Ga0075362_10046010 Ga0075362_100460102 248
250 3300006177 Ga0075362_10111220 Ga0075362_101112202 248
251 3300006178 Ga0075367_10341551 Ga0075367_103415511 248
252 3300006186 Ga0075369_10000633 Ga0075369_1000063315 248
253 3300006195 Ga0075366_10010435 Ga0075366_100104356 248
254 3300006195 Ga0075366_10049958 Ga0075366_100499582 248
255 3300006237 Ga0097621_100334177 Ga0097621_1003341772 248
256 3300006358 Ga0068871_100323617 Ga0068871_1003236172 248
257 3300006844 Ga0075428_100106846 Ga0075428_1001068462 248
258 3300006844 Ga0075428_100772586 Ga0075428_1007725862 248
259 3300006846 Ga0075430_100325749 Ga0075430_1003257491 248
260 3300006847 Ga0075431_100154885 Ga0075431_1001548853 248
261 3300006880 Ga0075429_100101751 Ga0075429_1001017512 248
262 3300006931 Ga0097620_100004768 Ga0097620_10000476811 248
263 3300006931 Ga0097620_100538957 Ga0097620_1005389571 248
264 3300006931 Ga0097620_100570349 Ga0097620_1005703492 248
265 3300009094 Ga0111539_10000600 Ga0111539_1000060010 248
266 3300009094 Ga0111539_10002248 Ga0111539_1000224825 248
267 3300009147 Ga0114129_10081758 Ga0114129_100817585 248
268 3300009147 Ga0114129_10084256 Ga0114129_100842563 248
269 3300009147 Ga0114129_10147705 Ga0114129_101477051 248
270 3300009147 Ga0114129_10443114 Ga0114129_104431142 248
271 3300009176 Ga0105242_10253147 Ga0105242_102531471 248
272 3300009177 Ga0105248_10001199 Ga0105248_1000119926 248
273 3300009177 Ga0105248_10022595 Ga0105248_100225958 248
274 3300009553 Ga0105249_10004550 Ga0105249_100045504 248
275 3300009553 Ga0105249_10212556 Ga0105249_102125562 248
276 3300011119 Ga0105246_10003653 Ga0105246_100036533 248
277 3300011119 Ga0105246_10429339 Ga0105246_104293392 248
278 3300013105 Ga0157369_10586475 Ga0157369_105864751 248
279 3300013296 Ga0157374_10380002 Ga0157374_103800022 248
280 3300013306 Ga0163162_10009480 Ga0163162_1000948010 248
281 3300013306 Ga0163162_10456637 Ga0163162_104566371 248
282 3300013307 Ga0157372_10199809 Ga0157372_101998092 248
283 3300013308 Ga0157375_10036117 Ga0157375_100361174 248
284 3300013308 Ga0157375_10052996 Ga0157375_100529965 248
285 3300014325 Ga0163163_10288855 Ga0163163_102888551 248
286 3300014326 Ga0157380_10013281 Ga0157380_100132817 248
287 3300014326 Ga0157380_10484978 Ga0157380_104849782 248
288 3300014497 Ga0182008_10011974 Ga0182008_100119746 248
289 3300014968 Ga0157379_10008803 Ga0157379_100088036 248
290 3300014968 Ga0157379_10472202 Ga0157379_104722021 248
291 3300017792 Ga0163161_10014330 Ga0163161_100143303 248
292 3300021384 Ga0213876_10023645 Ga0213876_100236453 248
293 3300021384 Ga0213876_10034856 Ga0213876_100348562 248
294 3300025284 Ga0209130_1001791 Ga0209130_10017913 248
295 3300025294 Ga0209025_1000225 Ga0209025_1000225112 248
296 3300025297 Ga0209758_1000070 Ga0209758_1000070152 248
297 3300025297 Ga0209758_1001483 Ga0209758_100148317 248
298 3300025302 Ga0207426_1000317 Ga0207426_100031761 248
299 3300025302 Ga0207426_1040774 Ga0207426_10407742 248
300 3300025304 Ga0209257_1050571 Ga0209257_10505712 248
301 3300025885 Ga0207653_10036821 Ga0207653_100368211 248
302 3300025893 Ga0207682_10071856 Ga0207682_100718562 248
303 3300025898 Ga0207692_10359588 Ga0207692_103595881 248
304 3300025903 Ga0207680_10038285 Ga0207680_100382852 248
305 3300025904 Ga0207647_10185800 Ga0207647_101858001 248
306 3300025908 Ga0207643_10120437 Ga0207643_101204372 248
307 3300025908 Ga0207643_10162877 Ga0207643_101628771 248
308 3300025910 Ga0207684_10206835 Ga0207684_102068352 248
309 3300025912 Ga0207707_10019672 Ga0207707_100196724 248
310 3300025915 Ga0207693_10011991 Ga0207693_100119912 248
311 3300025916 Ga0207663_10202753 Ga0207663_102027532 248
312 3300025917 Ga0207660_10007818 Ga0207660_100078184 248
313 3300025921 Ga0207652_10321122 Ga0207652_103211222 248
314 3300025923 Ga0207681_10207707 Ga0207681_102077072 248
315 3300025923 Ga0207681_10324188 Ga0207681_103241882 248
316 3300025926 Ga0207659_10003519 Ga0207659_1000351910 248
317 3300025928 Ga0207700_10022949 Ga0207700_100229494 248
318 3300025928 Ga0207700_10115600 Ga0207700_101156002 248
319 3300025928 Ga0207700_10191756 Ga0207700_101917562 248
320 3300025929 Ga0207664_10073519 Ga0207664_100735192 248
321 3300025931 Ga0207644_10069684 Ga0207644_100696843 248
322 3300025936 Ga0207670_10051241 Ga0207670_100512413 248
323 3300025937 Ga0207669_10315389 Ga0207669_103153892 248
324 3300025961 Ga0207712_10005083 Ga0207712_100050834 248
325 3300026035 Ga0207703_10033332 Ga0207703_100333322 248
326 3300026075 Ga0207708_10003078 Ga0207708_100030784 248
327 3300026089 Ga0207648_10017215 Ga0207648_100172155 248
328 3300026095 Ga0207676_10017901 Ga0207676_100179014 248
329 3300026116 Ga0207674_10009765 Ga0207674_100097654 248
330 3300026121 Ga0207683_10000648 Ga0207683_1000064822 248
331 3300026121 Ga0207683_10074900 Ga0207683_100749001 248
332 3300027671 Ga0209588_1042348 Ga0209588_10423481 248
333 3300027907 Ga0207428_10001207 Ga0207428_100012077 248
334 3300028380 Ga0268265_10003669 Ga0268265_100036694 248
335 3300028380 Ga0268265_10193320 Ga0268265_101933202 248
336 3300031247 Ga0265340_10112115 Ga0265340_101121152 248
337 3300031247 Ga0265340_10123181 Ga0265340_101231812 248
338 3300031250 Ga0265331_10000738 Ga0265331_1000073823 248
339 3300031548 Ga0307408_100569555 Ga0307408_1005695551 248
340 3300031595 Ga0265313_10002249 Ga0265313_1000224910 248
341 3300031616 Ga0307508_10346119 Ga0307508_103461191 248
342 3300031665 Ga0316575_10018474 Ga0316575_100184743 248
343 3300031665 Ga0316575_10083851 Ga0316575_100838512 248
344 3300031691 Ga0316579_10002161 Ga0316579_100021619 248
345 3300031691 Ga0316579_10011454 Ga0316579_100114542 248
346 3300031727 Ga0316576_10004142 Ga0316576_100041429 248
347 3300031727 Ga0316576_10166490 Ga0316576_101664902 248
348 3300031727 Ga0316576_10218472 Ga0316576_102184722 248
349 3300031728 Ga0316578_10006264 Ga0316578_100062647 248
350 3300031730 Ga0307516_10336665 Ga0307516_103366652 248
351 3300031733 Ga0316577_10000045 Ga0316577_1000004512 248
352 3300031733 Ga0316577_10002493 Ga0316577_100024934 248
353 3300031824 Ga0307413_10056095 Ga0307413_100560953 248
354 3300031838 Ga0307518_10081495 Ga0307518_100814952 248
355 3300031901 Ga0307406_10088577 Ga0307406_100885772 248
356 3300031903 Ga0307407_10018795 Ga0307407_100187952 248
357 3300031911 Ga0307412_10536145 Ga0307412_105361452 248
358 3300031995 Ga0307409_100021160 Ga0307409_1000211602 248
359 3300032005 Ga0307411_10007130 Ga0307411_100071303 248
360 3300032133 Ga0316583_10005981 Ga0316583_100059813 248
361 3300032137 Ga0316585_10001779 Ga0316585_100017794 248
362 3300032139 Ga0316580_10001711 Ga0316580_100017114 248
363 3300035114 Ga0373939_0019750 Ga0373939_0019750_553_1320 248
364 3300035115 Ga0373941_0054958 Ga0373941_0054958_154_924 248
365 3300035118 Ga0373954_0023185 Ga0373954_0023185_351_1145 248
366 3300035119 Ga0373956_0016383 Ga0373956_0016383_390_1184 248
367 3300035120 Ga0373957_0011436 Ga0373957_0011436_662_1456 248
368 3300035170 Ga0373943_0063094 Ga0373943_0063094_977_1771 248
369 3300035398 Ga0316574_0000560 Ga0316574_0000560_9745_10503 248
370 3300035398 Ga0316574_0003075 Ga0316574_0003075_6879_7682 248
371 3300035692 Ga0373935_0054961 Ga0373935_0054961_1455_2225 248
372 3300035724 Ga0373933_0051543 Ga0373933_0051543_1349_2143 248
373 3300035725 Ga0373947_0322041 Ga0373947_0322041_88_882 248
374 3300036401 Ga0373937_0192510 Ga0373937_0192510_285_1079 248
375 3300036647 Ga0316582_0003497 Ga0316582_0003497_4517_5275 248
376 3300036712 Ga0316584_0005266 Ga0316584_0005266_6738_7496 248
377 3300036712 Ga0316584_0071103 Ga0316584_0071103_864_1667 248
378 3300037068 Ga0373925_0143197 Ga0373925_0143197_679_1473 248
379 3300037853 Ga0436364_0403885 Ga0436364_0403885_1724_2512 248
380 3300039062 Ga0400483_015048 Ga0400483_015048_429_1196 248
381 3300039062 Ga0400483_134490 Ga0400483_134490_1192_1977 248
382 3300039062 Ga0400483_157048 Ga0400483_157048_1045_1830 248
383 3300039062 Ga0400483_262569 Ga0400483_262569_179_946 248
384 3300039437 Ga0436365_0233045 Ga0436365_0233045_1162_1950 248
385 3300039437 Ga0436365_0346418 Ga0436365_0346418_495_1262 248
386 3300039438 Ga0436360_0317613 Ga0436360_0317613_524_1306 248
387 3300039438 Ga0436360_0352512 Ga0436360_0352512_1662_2450 248
388 3300039438 Ga0436360_0354988 Ga0436360_0354988_659_1456 248
389 3300039447 Ga0436361_0781565 Ga0436361_0781565_1080_1877 248
390 3300039450 Ga0436363_1161520 Ga0436363_1161520_58_846 248
391 3300039450 Ga0436363_1353470 Ga0436363_1353470_272_1060 248
392 3300039453 Ga0436362_0016437 Ga0436362_0016437_2247_3035 248
393 3300042012 Ga0439455_0048504 Ga0439455_0048504_299_1066 248
394 3300046477 Ga0495664_0001415 Ga0495664_0001415_10075_10869 248
395 3300046477 Ga0495664_0076169 Ga0495664_0076169_1203_1976 248
396 3300046511 Ga0495608_0152125 Ga0495608_0152125_214_1008 248
397 3300046511 Ga0495608_0288757 Ga0495608_0288757_217_990 248
398 3300046512 Ga0495610_0015517 Ga0495610_0015517_2060_2836 248
399 3300046514 Ga0495618_0173951 Ga0495618_0173951_486_1280 248
400 3300046516 Ga0495628_0020351 Ga0495628_0020351_4475_5269 248
401 3300046536 Ga0495587_0028162 Ga0495587_0028162_149_922 248
402 3300046543 Ga0495645_0008297 Ga0495645_0008297_6344_7138 248
403 3300046559 Ga0495667_0090883 Ga0495667_0090883_406_1179 248
404 3300046675 Ga0495657_0034708 Ga0495657_0034708_1476_2270 248
405 3300046678 Ga0495599_0011772 Ga0495599_0011772_1521_2315 248
406 3300046680 Ga0495646_0016881 Ga0495646_0016881_2780_3574 248
407 3300047444 Ga0495675_0015943 Ga0495675_0015943_1099_1893 248
408 3300047444 Ga0495675_0054678 Ga0495675_0054678_1519_2292 248
409 3300048088 Ga0495602_0228130 Ga0495602_0228130_286_1059 248
410 3300048905 Ga0496102_0023979 Ga0496102_0023979_556_1356 248
411 3300048909 Ga0496106_0001529 Ga0496106_0001529_12576_13376 248
412 3300048912 Ga0496109_0200966 Ga0496109_0200966_846_1616 248
413 3300048913 Ga0496110_0427005 Ga0496110_0427005_317_1087 248
414 3300048915 Ga0496112_0169282 Ga0496112_0169282_1137_1904 248
415 3300048916 Ga0496113_0054574 Ga0496113_0054574_817_1584 248
416 3300048918 Ga0496115_0026510 Ga0496115_0026510_2420_3220 248
417 3300048929 Ga0496126_0147023 Ga0496126_0147023_1138_1908 248
418 3300049569 Ga0501032_0001025 Ga0501032_0001025_15433_16218 248
419 3300049570 Ga0501033_0003029 Ga0501033_0003029_10901_11686 248
420 3300049571 Ga0501034_0024977 Ga0501034_0024977_72_857 248
421 3300049572 Ga0501036_0001419 Ga0501036_0001419_14599_15384 248
422 3300049572 Ga0501036_0303454 Ga0501036_0303454_280_1053 248
423 3300049573 Ga0501037_0003506 Ga0501037_0003506_6939_7724 248
424 3300049574 Ga0501038_0003266 Ga0501038_0003266_13229_14014 248
425 3300049574 Ga0501038_0043366 Ga0501038_0043366_2160_2933 248
426 3300049575 Ga0501039_0002791 Ga0501039_0002791_1240_2025 248
427 3300049575 Ga0501039_0176627 Ga0501039_0176627_190_957 248
428 3300049576 Ga0501040_0026937 Ga0501040_0026937_1649_2422 248
429 3300049576 Ga0501040_0219988 Ga0501040_0219988_184_960 248
430 3300049577 Ga0501041_0009305 Ga0501041_0009305_2270_3043 248
431 3300049578 Ga0501042_0004303 Ga0501042_0004303_288_1055 248
432 3300049579 Ga0501043_0000339 Ga0501043_0000339_10574_11359 248
433 3300049580 Ga0501046_0000671 Ga0501046_0000671_14889_15674 248
434 3300049580 Ga0501046_0036757 Ga0501046_0036757_1089_1889 248
435 3300049581 Ga0501047_0001976 Ga0501047_0001976_14539_15324 248
436 3300049582 Ga0501048_0048666 Ga0501048_0048666_228_1013 248
437 3300049585 Ga0501069_0000349 Ga0501069_0000349_6417_7202 248
438 3300049586 Ga0501070_0190735 Ga0501070_0190735_842_1615 248
439 3300049586 Ga0501070_0543194 Ga0501070_0543194_91_864 248
440 3300049587 Ga0501071_0038354 Ga0501071_0038354_1712_2485 248
441 3300049591 Ga0501075_0006258 Ga0501075_0006258_410_1183 248
442 3300049591 Ga0501075_0358034 Ga0501075_0358034_91_891 248
443 3300049592 Ga0501076_0088617 Ga0501076_0088617_605_1354 248
444 3300049592 Ga0501076_0293265 Ga0501076_0293265_499_1299 248
445 3300049593 Ga0501077_0028280 Ga0501077_0028280_2710_3483 248
446 3300049741 Ga0501079_0007638 Ga0501079_0007638_4535_5308 248
447 3300049742 Ga0501080_0000471 Ga0501080_0000471_14701_15486 248
448 3300049742 Ga0501080_0481724 Ga0501080_0481724_295_1062 248
449 3300049743 Ga0501081_0036208 Ga0501081_0036208_462_1235 248
450 3300049743 Ga0501081_0145196 Ga0501081_0145196_647_1447 248
451 3300049822 Ga0501035_0001114 Ga0501035_0001114_13102_13887 248
452 3300049823 Ga0501044_0002829 Ga0501044_0002829_5860_6645 248
453 3300049823 Ga0501044_0177980 Ga0501044_0177980_560_1345 248
454 3300049824 Ga0501045_0010853 Ga0501045_0010853_3682_4455 248
455 3300049824 Ga0501045_0012824 Ga0501045_0012824_2684_3433 248
456 3300049824 Ga0501045_0594215 Ga0501045_0594215_52_807 248
457 3300050489 nmdc:mga03683_16363_c1 nmdc:mga03683_16363_c1_488_1255 248
458 3300050489 nmdc:mga03683_177921_c1 nmdc:mga03683_177921_c1_105_875 248
459 3300050496 nmdc:mga07m45_187116_c1 nmdc:mga07m45_187116_c1_281_1051 248
460 3300050507 nmdc:mga05p37_182939_c1 nmdc:mga05p37_182939_c1_295_1071 248
461 3300050507 nmdc:mga05p37_497173_c1 nmdc:mga05p37_497173_c1_142_921 248
462 3300050507 nmdc:mga05p37_542517_c1 nmdc:mga05p37_542517_c1_320_1132 248
463 3300050507 nmdc:mga05p37_80468_c1 nmdc:mga05p37_80468_c1_398_1156 248
464 3300050508 nmdc:mga09592_523536_c1 nmdc:mga09592_523536_c1_223_978 248
465 3300050510 nmdc:mga06r32_132089_c1 nmdc:mga06r32_132089_c1_140_940 248
466 3300050510 nmdc:mga06r32_204061_c1 nmdc:mga06r32_204061_c1_276_1049 248
467 3300050510 nmdc:mga06r32_314512_c1 nmdc:mga06r32_314512_c1_690_1469 248
468 3300050510 nmdc:mga06r32_66485_c1 nmdc:mga06r32_66485_c1_1318_2094 248
469 3300050510 nmdc:mga06r32_69498_c1 nmdc:mga06r32_69498_c1_1837_2637 248
470 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_276324_277097 248
471 3300050511 nmdc:mga08y16_3513_c1 nmdc:mga08y16_3513_c1_11760_12542 248
472 3300050511 nmdc:mga08y16_65102_c1 nmdc:mga08y16_65102_c1_1133_1909 248
473 3300050515 nmdc:mga0a205_108370_c1 nmdc:mga0a205_108370_c1_1088_1867 248
474 3300050516 nmdc:mga0sz30_169_c1 nmdc:mga0sz30_169_c1_11454_12224 248
475 3300053077 Ga0495601_0134650 Ga0495601_0134650_278_1072 248
476 3300053077 Ga0495601_0148769 Ga0495601_0148769_158_931 248
477 3300053077 Ga0495601_0239417 Ga0495601_0239417_143_937 248
478 3300053078 Ga0495612_0000204 Ga0495612_0000204_24146_24940 248
479 3300053084 Ga0495595_0009279 Ga0495595_0009279_2960_3754 248
480 3300053093 Ga0500651_0136999 Ga0500651_0136999_261_1028 248
481 3300053096 Ga0500641_0003682 Ga0500641_0003682_3590_4354 248
482 3300053096 Ga0500641_0025605 Ga0500641_0025605_1258_2025 248
483 3300053130 Ga0500642_0159816 Ga0500642_0159816_163_921 248
484 3300053134 Ga0500658_0143359 Ga0500658_0143359_109_867 248
485 3300053139 Ga0500568_0013134 Ga0500568_0013134_2496_3257 248
486 3300053151 Ga0500604_0000809 Ga0500604_0000809_1599_2357 248
487 3300053153 Ga0500616_0001438 Ga0500616_0001438_12531_13301 248
488 3300053731 Ga0500609_000036 Ga0500609_000036_6502_7263 248
489 3300054114 Ga0501084_0019606 Ga0501084_0019606_4245_5045 248
490 3300054114 Ga0501084_0021381 Ga0501084_0021381_3052_3825 248
491 3300054114 Ga0501084_0102380 Ga0501084_0102380_507_1292 248
492 3300060353 Ga0501082_0001076 Ga0501082_0001076_12291_13076 248
493 3300060353 Ga0501082_0011523 Ga0501082_0011523_6480_7280 248
494 3300060353 Ga0501082_0016262 Ga0501082_0016262_2602_3375 248
495 3300061734 Ga0530510_0004618 Ga0530510_0004618_5044_5817 248
496 3300061734 Ga0530510_0409438 Ga0530510_0409438_144_950 248
497 3300000043 ARcpr5yngRDRAFT_c006322 ARcpr5yngRDRAFT_0063222 249
498 3300006844 Ga0075428_100075459 Ga0075428_1000754593 249
499 3300009094 Ga0111539_10000771 Ga0111539_1000077133 249
500 3300012515 Ga0157338_1005635 Ga0157338_10056352 249
501 3300027907 Ga0207428_10050199 Ga0207428_100501992 249
502 3300031901 Ga0307406_10200002 Ga0307406_102000022 249
503 3300031995 Ga0307409_100201484 Ga0307409_1002014842 249
504 3300032002 Ga0307416_100051315 Ga0307416_1000513152 249
505 3300042436 Ga0439435_0045889 Ga0439435_0045889_460_1212 249
506 3300042876 Ga0451577_0007509 Ga0451577_0007509_4970_5734 249
507 3300045051 Ga0451576_0003175 Ga0451576_0003175_15272_16036 249
508 3300047472 Ga0495686_0003359 Ga0495686_0003359_5031_5789 249
509 3300050508 nmdc:mga09592_17270_c1 nmdc:mga09592_17270_c1_2179_2931 249
510 3300050511 nmdc:mga08y16_866_c1 nmdc:mga08y16_866_c1_328_1080 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

25

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9894 7 247
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9829 8 247
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9773 7 247
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9748 8 247
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9709 5 246
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9818 8 247 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9738 8 247 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9609 8 244 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9486 8 243 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9485 23 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1A9R3F0-F1-model_v4 ABC transporter ATP-binding protein 0.9999 8 249 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7W9B063-F1-model_v4 Polar amino acid transport system ATP-binding protein 0.9957 6 246 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-S6L2W2-F1-model_v4 deleted 0.9941 132 247
AF-A0A2K0X6K2-F1-model_v4 Glutamate ABC transporter ATP-binding protein 0.9929 5 249 GO:0005524
GO:0015424
GO:0016887
AF-A0A2S6DDZ0-F1-model_v4 deleted 0.9922 144 240

Feature Viewer

pLDDT pTM Quality
93.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map