F456989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 289 | 509 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_11169739|Ga0207705_111697391 |
| Length | 119 |
| Sequence | VEASEVQFFKDLLLKQRAEILNKTLALRNEAAIEATGQGDEGDLAVSEQSLAMTLRLQERDAHHLQKIDRTLGKIEEGSFGLCEQCEEPLQKNRLIARPVANLCVACKEEQESRERVFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 164 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 212 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 216 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 217 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 220 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 283 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.68 |
| Metatranscriptomes | 4.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 91.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006763J43179_107734 | 3300002870 | Unclassified | 500 |
| 2 | Ga0006759J45824_1006064 | 3300003163 | Unclassified | 834 |
| 3 | Ga0006758J48902_1019475 | 3300003300 | Unclassified | 559 |
| 4 | rootH1_10077254 | 3300003323 | Bacteria | 4251 |
| 5 | rootH1_10288592 | 3300003323 | Bacteria | 1631 |
| 6 | Ga0032354_1031084 | 3300003693 | Unclassified | 851 |
| 7 | Ga0058858_1379739 | 3300004785 | Bacteria | 603 |
| 8 | Ga0058859_11551521 | 3300004798 | Bacteria | 544 |
| 9 | Ga0058860_11846079 | 3300004801 | Unclassified | 724 |
| 10 | Ga0058860_12057947 | 3300004801 | Bacteria | 549 |
| 11 | Ga0058860_12102671 | 3300004801 | Bacteria | 610 |
| 12 | Ga0058862_10075690 | 3300004803 | Bacteria | 1176 |
| 13 | Ga0065715_10577474 | 3300005293 | Unclassified | 722 |
| 14 | Ga0070658_10044642 | 3300005327 | Bacteria | 3582 |
| 15 | Ga0070658_11121144 | 3300005327 | Bacteria | 684 |
| 16 | Ga0070676_10010085 | 3300005328 | Bacteria | 5117 |
| 17 | Ga0070683_100227111 | 3300005329 | Bacteria | 1774 |
| 18 | Ga0070683_100291078 | 3300005329 | Bacteria | 1553 |
| 19 | Ga0070683_101126882 | 3300005329 | Bacteria | 754 |
| 20 | Ga0070690_100001442 | 3300005330 | Bacteria | 12422 |
| 21 | Ga0070690_100003920 | 3300005330 | Bacteria | 8208 |
| 22 | Ga0070670_100522217 | 3300005331 | Bacteria | 1057 |
| 23 | Ga0068869_101225414 | 3300005334 | Bacteria | 660 |
| 24 | Ga0070666_10087814 | 3300005335 | Bacteria | 2132 |
| 25 | Ga0070666_10135707 | 3300005335 | Bacteria | 1712 |
| 26 | Ga0070666_11350574 | 3300005335 | Bacteria | 532 |
| 27 | Ga0070680_100040653 | 3300005336 | Unclassified | 3767 |
| 28 | Ga0070680_100385429 | 3300005336 | Unclassified | 1194 |
| 29 | Ga0068868_100213350 | 3300005338 | Unclassified | 1614 |
| 30 | Ga0068868_100240580 | 3300005338 | Bacteria | 1521 |
| 31 | Ga0070660_100334669 | 3300005339 | Archaea | 1245 |
| 32 | Ga0070660_100840306 | 3300005339 | Bacteria | 773 |
| 33 | Ga0070689_100003803 | 3300005340 | Bacteria | 10112 |
| 34 | Ga0070689_100067538 | 3300005340 | Bacteria | 2787 |
| 35 | Ga0070687_100029373 | 3300005343 | Bacteria | 2677 |
| 36 | Ga0070661_100776923 | 3300005344 | Unclassified | 785 |
| 37 | Ga0070692_10009790 | 3300005345 | Bacteria | 4338 |
| 38 | Ga0070692_10752199 | 3300005345 | Unclassified | 661 |
| 39 | Ga0070692_11240206 | 3300005345 | Bacteria | 532 |
| 40 | Ga0070668_100552362 | 3300005347 | Bacteria | 1002 |
| 41 | Ga0070668_102018855 | 3300005347 | Bacteria | 532 |
| 42 | Ga0070675_101169073 | 3300005354 | Bacteria | 708 |
| 43 | Ga0070671_100180443 | 3300005355 | Bacteria | 1787 |
| 44 | Ga0070674_101822217 | 3300005356 | Bacteria | 552 |
| 45 | Ga0070673_100100750 | 3300005364 | Unclassified | 2378 |
| 46 | Ga0070673_100490822 | 3300005364 | Bacteria | 1110 |
| 47 | Ga0070673_101822636 | 3300005364 | Unclassified | 576 |
| 48 | Ga0070688_100018368 | 3300005365 | Bacteria | 4034 |
| 49 | Ga0070659_100645682 | 3300005366 | Bacteria | 912 |
| 50 | Ga0070667_100191068 | 3300005367 | Bacteria | 1814 |
| 51 | Ga0070667_100661505 | 3300005367 | Bacteria | 965 |
| 52 | Ga0070709_10101459 | 3300005434 | Bacteria | 1918 |
| 53 | Ga0070714_100037927 | 3300005435 | Bacteria | 4052 |
| 54 | Ga0070713_100557502 | 3300005436 | Bacteria | 1085 |
| 55 | Ga0070710_10017455 | 3300005437 | Bacteria | 3673 |
| 56 | Ga0070701_10019365 | 3300005438 | Bacteria | 3214 |
| 57 | Ga0070711_100148595 | 3300005439 | Bacteria | 1765 |
| 58 | Ga0070705_100065309 | 3300005440 | Bacteria | 2178 |
| 59 | Ga0070705_100425298 | 3300005440 | Bacteria | 990 |
| 60 | Ga0070700_100002550 | 3300005441 | Bacteria | 9294 |
| 61 | Ga0070694_100037883 | 3300005444 | Bacteria | 3200 |
| 62 | Ga0070694_100243565 | 3300005444 | Bacteria | 1357 |
| 63 | Ga0070708_101450074 | 3300005445 | Bacteria | 640 |
| 64 | Ga0070663_100784630 | 3300005455 | Bacteria | 816 |
| 65 | Ga0070678_100011023 | 3300005456 | Bacteria | 5553 |
| 66 | Ga0070662_100032461 | 3300005457 | Bacteria | 3670 |
| 67 | Ga0070681_10070703 | 3300005458 | Unclassified | 3455 |
| 68 | Ga0070681_11716214 | 3300005458 | Bacteria | 554 |
| 69 | Ga0068867_100007894 | 3300005459 | Bacteria | 7522 |
| 70 | Ga0068867_100058006 | 3300005459 | Bacteria | 2868 |
| 71 | Ga0068867_101476219 | 3300005459 | Bacteria | 632 |
| 72 | Ga0070685_10021579 | 3300005466 | Bacteria | 3501 |
| 73 | Ga0070685_10358398 | 3300005466 | Bacteria | 999 |
| 74 | Ga0070685_10385932 | 3300005466 | Bacteria | 966 |
| 75 | Ga0070706_100039098 | 3300005467 | Bacteria | 4380 |
| 76 | Ga0070707_100038749 | 3300005468 | Bacteria | 4553 |
| 77 | Ga0070707_100281829 | 3300005468 | Bacteria | 1615 |
| 78 | Ga0070707_101846261 | 3300005468 | Unclassified | 572 |
| 79 | Ga0070679_100004235 | 3300005530 | Bacteria | 13240 |
| 80 | Ga0070679_100188629 | 3300005530 | Unclassified | 2031 |
| 81 | Ga0070684_100081070 | 3300005535 | Bacteria | 2871 |
| 82 | Ga0070684_100115190 | 3300005535 | Bacteria | 2414 |
| 83 | Ga0070684_100157933 | 3300005535 | Bacteria | 2056 |
| 84 | Ga0070684_100377089 | 3300005535 | Bacteria | 1306 |
| 85 | Ga0068853_100185938 | 3300005539 | Bacteria | 1886 |
| 86 | Ga0070686_100081212 | 3300005544 | Bacteria | 2147 |
| 87 | Ga0070686_100148529 | 3300005544 | Bacteria | 1639 |
| 88 | Ga0070693_100176087 | 3300005547 | Bacteria | 1374 |
| 89 | Ga0070693_101505718 | 3300005547 | Bacteria | 526 |
| 90 | Ga0070665_100011455 | 3300005548 | Bacteria | 8966 |
| 91 | Ga0070665_101282270 | 3300005548 | Unclassified | 743 |
| 92 | Ga0068855_100715795 | 3300005563 | Bacteria | 1070 |
| 93 | Ga0068855_100816784 | 3300005563 | Bacteria | 990 |
| 94 | Ga0068855_100840382 | 3300005563 | Unclassified | 974 |
| 95 | Ga0068855_101151804 | 3300005563 | Bacteria | 808 |
| 96 | Ga0068856_100327104 | 3300005614 | Bacteria | 1550 |
| 97 | Ga0068856_100497442 | 3300005614 | Bacteria | 1240 |
| 98 | Ga0068856_100892951 | 3300005614 | Bacteria | 907 |
| 99 | Ga0070702_100084202 | 3300005615 | Bacteria | 1912 |
| 100 | Ga0070702_101354951 | 3300005615 | Unclassified | 580 |
| 101 | Ga0068852_100438475 | 3300005616 | Bacteria | 1291 |
| 102 | Ga0068852_100631811 | 3300005616 | Bacteria | 1077 |
| 103 | Ga0068864_102652601 | 3300005618 | Bacteria | 507 |
| 104 | Ga0068866_10018223 | 3300005718 | Bacteria | 3171 |
| 105 | Ga0068870_11400583 | 3300005840 | Bacteria | 512 |
| 106 | Ga0068858_100043685 | 3300005842 | Bacteria | 4155 |
| 107 | Ga0068858_100614717 | 3300005842 | Bacteria | 1055 |
| 108 | Ga0068858_101391736 | 3300005842 | Bacteria | 691 |
| 109 | Ga0068860_100087028 | 3300005843 | Bacteria | 2974 |
| 110 | Ga0068862_100027130 | 3300005844 | Bacteria | 4819 |
| 111 | Ga0081455_10059695 | 3300005937 | Bacteria | 3219 |
| 112 | Ga0081455_10086608 | 3300005937 | Unclassified | 2551 |
| 113 | Ga0081455_10373793 | 3300005937 | Bacteria | 998 |
| 114 | Ga0081539_10158146 | 3300005985 | Bacteria | 1083 |
| 115 | Ga0075366_10093602 | 3300006195 | Bacteria | 1801 |
| 116 | Ga0075366_10249370 | 3300006195 | Unclassified | 1083 |
| 117 | Ga0097621_100025326 | 3300006237 | Bacteria | 4640 |
| 118 | Ga0097621_101112139 | 3300006237 | Bacteria | 742 |
| 119 | Ga0068871_100354553 | 3300006358 | Bacteria | 1298 |
| 120 | Ga0068871_100637441 | 3300006358 | Unclassified | 972 |
| 121 | Ga0075428_100220688 | 3300006844 | Bacteria | 2047 |
| 122 | Ga0075428_100343224 | 3300006844 | Unclassified | 1603 |
| 123 | Ga0075428_102255542 | 3300006844 | Bacteria | 561 |
| 124 | Ga0075431_100208346 | 3300006847 | Bacteria | 1998 |
| 125 | Ga0075433_11727421 | 3300006852 | Bacteria | 539 |
| 126 | Ga0075434_102664736 | 3300006871 | Unclassified | 500 |
| 127 | Ga0068865_100002478 | 3300006881 | Bacteria | 10926 |
| 128 | Ga0068865_100846249 | 3300006881 | Bacteria | 792 |
| 129 | Ga0097620_100570252 | 3300006931 | Bacteria | 1226 |
| 130 | Ga0111539_11087121 | 3300009094 | Bacteria | 929 |
| 131 | Ga0111539_13307297 | 3300009094 | Bacteria | 519 |
| 132 | Ga0105245_10014640 | 3300009098 | Bacteria | 6831 |
| 133 | Ga0105247_10016328 | 3300009101 | Bacteria | 4448 |
| 134 | Ga0114129_11243017 | 3300009147 | Bacteria | 926 |
| 135 | Ga0105243_10495624 | 3300009148 | Bacteria | 1156 |
| 136 | Ga0105242_10244171 | 3300009176 | Bacteria | 1615 |
| 137 | Ga0105242_10261693 | 3300009176 | Bacteria | 1563 |
| 138 | Ga0105242_10591994 | 3300009176 | Bacteria | 1070 |
| 139 | Ga0105242_12106602 | 3300009176 | Bacteria | 608 |
| 140 | Ga0105248_10699752 | 3300009177 | Bacteria | 1143 |
| 141 | Ga0105238_10004950 | 3300009551 | Bacteria | 13177 |
| 142 | Ga0105249_10410380 | 3300009553 | Bacteria | 1386 |
| 143 | Ga0105249_11260238 | 3300009553 | Bacteria | 811 |
| 144 | Ga0105239_10045590 | 3300010375 | Bacteria | 4805 |
| 145 | Ga0105239_10951505 | 3300010375 | Bacteria | 987 |
| 146 | Ga0105239_12550292 | 3300010375 | Bacteria | 596 |
| 147 | Ga0105239_13632833 | 3300010375 | Bacteria | 501 |
| 148 | Ga0105246_11401716 | 3300011119 | Bacteria | 652 |
| 149 | Ga0157369_11109805 | 3300013105 | Bacteria | 808 |
| 150 | Ga0157374_10311366 | 3300013296 | Bacteria | 1559 |
| 151 | Ga0157374_10468081 | 3300013296 | Bacteria | 1263 |
| 152 | Ga0157374_10480169 | 3300013296 | Bacteria | 1246 |
| 153 | Ga0157374_11140605 | 3300013296 | Bacteria | 800 |
| 154 | Ga0157378_10119939 | 3300013297 | Bacteria | 2423 |
| 155 | Ga0157378_10312361 | 3300013297 | Bacteria | 1525 |
| 156 | Ga0157378_11655001 | 3300013297 | Bacteria | 686 |
| 157 | Ga0157372_10644332 | 3300013307 | Bacteria | 1234 |
| 158 | Ga0157372_13030803 | 3300013307 | Bacteria | 537 |
| 159 | Ga0163163_12038350 | 3300014325 | Bacteria | 633 |
| 160 | Ga0163163_12277819 | 3300014325 | Bacteria | 601 |
| 161 | Ga0163163_12616284 | 3300014325 | Bacteria | 562 |
| 162 | Ga0157380_10455745 | 3300014326 | Bacteria | 1230 |
| 163 | Ga0157380_11043242 | 3300014326 | Bacteria | 853 |
| 164 | Ga0157377_10454452 | 3300014745 | Bacteria | 885 |
| 165 | Ga0157379_10875605 | 3300014968 | Bacteria | 851 |
| 166 | Ga0157376_10118980 | 3300014969 | Bacteria | 2338 |
| 167 | Ga0157376_10556063 | 3300014969 | Bacteria | 1136 |
| 168 | Ga0157376_10951898 | 3300014969 | Bacteria | 879 |
| 169 | Ga0157376_11058619 | 3300014969 | Bacteria | 836 |
| 170 | Ga0163161_10878933 | 3300017792 | Unclassified | 758 |
| 171 | Ga0206356_10649809 | 3300020070 | Bacteria | 1751 |
| 172 | Ga0206349_1888834 | 3300020075 | Unclassified | 573 |
| 173 | Ga0207697_10021953 | 3300025315 | Bacteria | 2615 |
| 174 | Ga0207692_10013102 | 3300025898 | Bacteria | 3588 |
| 175 | Ga0207692_10944029 | 3300025898 | Unclassified | 568 |
| 176 | Ga0207642_10015467 | 3300025899 | Bacteria | 2844 |
| 177 | Ga0207710_10008087 | 3300025900 | Bacteria | 4442 |
| 178 | Ga0207688_10390850 | 3300025901 | Bacteria | 861 |
| 179 | Ga0207680_10331156 | 3300025903 | Bacteria | 1066 |
| 180 | Ga0207680_10499703 | 3300025903 | Unclassified | 866 |
| 181 | Ga0207680_10556681 | 3300025903 | Bacteria | 819 |
| 182 | Ga0207699_10075790 | 3300025906 | Bacteria | 2070 |
| 183 | Ga0207645_10004684 | 3300025907 | Bacteria | 10067 |
| 184 | Ga0207705_10010661 | 3300025909 | Bacteria | 6674 |
| 185 | Ga0207705_10648561 | 3300025909 | Bacteria | 821 |
| 186 | Ga0207705_11169739 | 3300025909 | Unclassified | 591 |
| 187 | Ga0207684_11105136 | 3300025910 | Bacteria | 660 |
| 188 | Ga0207707_10080641 | 3300025912 | Bacteria | 2842 |
| 189 | Ga0207707_10167405 | 3300025912 | Bacteria | 1921 |
| 190 | Ga0207695_10327237 | 3300025913 | Bacteria | 1421 |
| 191 | Ga0207660_10108734 | 3300025917 | Unclassified | 2083 |
| 192 | Ga0207662_10030660 | 3300025918 | Unclassified | 3122 |
| 193 | Ga0207662_10030935 | 3300025918 | Bacteria | 3110 |
| 194 | Ga0207657_10270251 | 3300025919 | Unclassified | 1351 |
| 195 | Ga0207649_11580619 | 3300025920 | Unclassified | 519 |
| 196 | Ga0207652_10000360 | 3300025921 | Bacteria | 47230 |
| 197 | Ga0207652_10001885 | 3300025921 | Bacteria | 18172 |
| 198 | Ga0207652_10264839 | 3300025921 | Bacteria | 1550 |
| 199 | Ga0207646_10039380 | 3300025922 | Bacteria | 4255 |
| 200 | Ga0207646_11300229 | 3300025922 | Bacteria | 635 |
| 201 | Ga0207646_11553617 | 3300025922 | Unclassified | 572 |
| 202 | Ga0207681_10002930 | 3300025923 | Bacteria | 10773 |
| 203 | Ga0207694_10066993 | 3300025924 | Bacteria | 2802 |
| 204 | Ga0207650_10035631 | 3300025925 | Bacteria | 3616 |
| 205 | Ga0207659_10681264 | 3300025926 | Bacteria | 880 |
| 206 | Ga0207687_10101637 | 3300025927 | Bacteria | 2116 |
| 207 | Ga0207644_10103741 | 3300025931 | Bacteria | 2140 |
| 208 | Ga0207644_11130521 | 3300025931 | Unclassified | 658 |
| 209 | Ga0207690_10630654 | 3300025932 | Bacteria | 877 |
| 210 | Ga0207706_10038448 | 3300025933 | Bacteria | 4245 |
| 211 | Ga0207686_10294824 | 3300025934 | Bacteria | 1202 |
| 212 | Ga0207686_11428406 | 3300025934 | Bacteria | 570 |
| 213 | Ga0207709_10129544 | 3300025935 | Bacteria | 1717 |
| 214 | Ga0207670_10003609 | 3300025936 | Bacteria | 8208 |
| 215 | Ga0207670_10014878 | 3300025936 | Bacteria | 4633 |
| 216 | Ga0207670_10035113 | 3300025936 | Bacteria | 3248 |
| 217 | Ga0207669_10038520 | 3300025937 | Bacteria | 2753 |
| 218 | Ga0207669_10171750 | 3300025937 | Bacteria | 1544 |
| 219 | Ga0207669_10353674 | 3300025937 | Bacteria | 1136 |
| 220 | Ga0207704_10001642 | 3300025938 | Bacteria | 10037 |
| 221 | Ga0207691_10257872 | 3300025940 | Bacteria | 1503 |
| 222 | Ga0207711_10471689 | 3300025941 | Bacteria | 1169 |
| 223 | Ga0207711_10490680 | 3300025941 | Bacteria | 1144 |
| 224 | Ga0207689_10051614 | 3300025942 | Bacteria | 3390 |
| 225 | Ga0207661_10176867 | 3300025944 | Bacteria | 1861 |
| 226 | Ga0207661_10294990 | 3300025944 | Unclassified | 1452 |
| 227 | Ga0207661_10486092 | 3300025944 | Bacteria | 1127 |
| 228 | Ga0207667_10195523 | 3300025949 | Bacteria | 2075 |
| 229 | Ga0207667_10273233 | 3300025949 | Unclassified | 1727 |
| 230 | Ga0207667_11571339 | 3300025949 | Bacteria | 627 |
| 231 | Ga0207651_10000484 | 3300025960 | Bacteria | 16760 |
| 232 | Ga0207651_10205110 | 3300025960 | Bacteria | 1583 |
| 233 | Ga0207712_10342196 | 3300025961 | Bacteria | 1241 |
| 234 | Ga0207712_11858410 | 3300025961 | Bacteria | 539 |
| 235 | Ga0207668_10042568 | 3300025972 | Bacteria | 3076 |
| 236 | Ga0207668_10252978 | 3300025972 | Bacteria | 1432 |
| 237 | Ga0207640_11634366 | 3300025981 | Unclassified | 581 |
| 238 | Ga0207658_11743986 | 3300025986 | Unclassified | 568 |
| 239 | Ga0207677_10211661 | 3300026023 | Bacteria | 1549 |
| 240 | Ga0207677_10214821 | 3300026023 | Bacteria | 1539 |
| 241 | Ga0207703_10115620 | 3300026035 | Bacteria | 2296 |
| 242 | Ga0207703_12419472 | 3300026035 | Bacteria | 501 |
| 243 | Ga0207678_11020010 | 3300026067 | Unclassified | 732 |
| 244 | Ga0207708_10004142 | 3300026075 | Bacteria | 10667 |
| 245 | Ga0207708_10833998 | 3300026075 | Bacteria | 795 |
| 246 | Ga0207708_11585125 | 3300026075 | Bacteria | 575 |
| 247 | Ga0207702_10187036 | 3300026078 | Bacteria | 1911 |
| 248 | Ga0207702_10454185 | 3300026078 | Bacteria | 1244 |
| 249 | Ga0207641_10265597 | 3300026088 | Bacteria | 1608 |
| 250 | Ga0207648_10028413 | 3300026089 | Bacteria | 4959 |
| 251 | Ga0207648_11810319 | 3300026089 | Bacteria | 572 |
| 252 | Ga0207676_11045386 | 3300026095 | Unclassified | 806 |
| 253 | Ga0207676_11106155 | 3300026095 | Bacteria | 783 |
| 254 | Ga0207674_10833672 | 3300026116 | Bacteria | 889 |
| 255 | Ga0207683_10452113 | 3300026121 | Bacteria | 1184 |
| 256 | Ga0207698_10604720 | 3300026142 | Bacteria | 1081 |
| 257 | Ga0207698_11751924 | 3300026142 | Bacteria | 636 |
| 258 | Ga0207698_12601875 | 3300026142 | Unclassified | 515 |
| 259 | Ga0210002_1040030 | 3300027617 | Unclassified | 795 |
| 260 | Ga0268266_10001935 | 3300028379 | Bacteria | 23297 |
| 261 | Ga0268265_10947935 | 3300028380 | Bacteria | 848 |
| 262 | Ga0268264_10150138 | 3300028381 | Bacteria | 2088 |
| 263 | Ga0265326_10187299 | 3300028558 | Unclassified | 593 |
| 264 | Ga0265319_1057625 | 3300028563 | Unclassified | 1267 |
| 265 | Ga0265319_1140138 | 3300028563 | Unclassified | 750 |
| 266 | Ga0265334_10031817 | 3300028573 | Bacteria | 2106 |
| 267 | Ga0265336_10147315 | 3300028666 | Unclassified | 700 |
| 268 | Ga0307515_10836213 | 3300028794 | Bacteria | 546 |
| 269 | Ga0265338_10009440 | 3300028800 | Bacteria | 11627 |
| 270 | Ga0265338_10086106 | 3300028800 | Bacteria | 2617 |
| 271 | Ga0265338_10118251 | 3300028800 | Bacteria | 2118 |
| 272 | Ga0265338_10467473 | 3300028800 | Bacteria | 891 |
| 273 | Ga0307511_10003700 | 3300030521 | Bacteria | 15635 |
| 274 | Ga0265762_1171881 | 3300030760 | Bacteria | 528 |
| 275 | Ga0265766_1024722 | 3300030863 | Bacteria | 512 |
| 276 | Ga0265332_10005390 | 3300031238 | Bacteria | 5903 |
| 277 | Ga0265328_10000547 | 3300031239 | Bacteria | 17495 |
| 278 | Ga0265320_10060216 | 3300031240 | Bacteria | 1813 |
| 279 | Ga0265329_10096248 | 3300031242 | Unclassified | 941 |
| 280 | Ga0265339_10000814 | 3300031249 | Bacteria | 24088 |
| 281 | Ga0265339_10005010 | 3300031249 | Bacteria | 8912 |
| 282 | Ga0265339_10006602 | 3300031249 | Bacteria | 7592 |
| 283 | Ga0265339_10211689 | 3300031249 | Bacteria | 952 |
| 284 | Ga0265331_10099275 | 3300031250 | Bacteria | 1341 |
| 285 | Ga0265316_10012776 | 3300031344 | Bacteria | 7502 |
| 286 | Ga0307408_101019649 | 3300031548 | Bacteria | 764 |
| 287 | Ga0265313_10007288 | 3300031595 | Bacteria | 7593 |
| 288 | Ga0265313_10040160 | 3300031595 | Bacteria | 2315 |
| 289 | Ga0307514_10024515 | 3300031649 | Bacteria | 4884 |
| 290 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 291 | Ga0265314_10009101 | 3300031711 | Bacteria | 8434 |
| 292 | Ga0265314_10069043 | 3300031711 | Bacteria | 2373 |
| 293 | Ga0265342_10000516 | 3300031712 | Bacteria | 41275 |
| 294 | Ga0265342_10001028 | 3300031712 | Bacteria | 27405 |
| 295 | Ga0316576_10623704 | 3300031727 | Bacteria | 786 |
| 296 | Ga0307405_11702427 | 3300031731 | Bacteria | 559 |
| 297 | Ga0307413_10798902 | 3300031824 | Bacteria | 793 |
| 298 | Ga0307413_11856943 | 3300031824 | Bacteria | 540 |
| 299 | Ga0307406_10009467 | 3300031901 | Bacteria | 5464 |
| 300 | Ga0307406_10016753 | 3300031901 | Bacteria | 4263 |
| 301 | Ga0307407_10244969 | 3300031903 | Bacteria | 1225 |
| 302 | Ga0307412_10008938 | 3300031911 | Bacteria | 5738 |
| 303 | Ga0316588_1146196 | 3300033528 | Unclassified | 605 |
| 304 | Ga0373948_0185663 | 3300034817 | Bacteria | 536 |
| 305 | Ga0373926_0430681 | 3300035083 | Unclassified | 522 |
| 306 | Ga0373923_0109712 | 3300035111 | Bacteria | 1224 |
| 307 | Ga0373923_0129015 | 3300035111 | Bacteria | 1135 |
| 308 | Ga0373936_0421144 | 3300035113 | Unclassified | 615 |
| 309 | Ga0373945_0332543 | 3300035116 | Bacteria | 656 |
| 310 | Ga0373953_0199919 | 3300035117 | Bacteria | 864 |
| 311 | Ga0373954_0030691 | 3300035118 | Bacteria | 2479 |
| 312 | Ga0373956_0006448 | 3300035119 | Bacteria | 4704 |
| 313 | Ga0373956_0027559 | 3300035119 | Bacteria | 2467 |
| 314 | Ga0373956_0165220 | 3300035119 | Bacteria | 1044 |
| 315 | Ga0373957_0072287 | 3300035120 | Bacteria | 1351 |
| 316 | Ga0373957_0093067 | 3300035120 | Unclassified | 1200 |
| 317 | Ga0373960_0270474 | 3300035121 | Unclassified | 623 |
| 318 | Ga0373943_0052723 | 3300035170 | Bacteria | 2006 |
| 319 | Ga0373943_0349159 | 3300035170 | Bacteria | 847 |
| 320 | Ga0373955_0024942 | 3300035172 | Bacteria | 3064 |
| 321 | Ga0373955_0335771 | 3300035172 | Bacteria | 914 |
| 322 | Ga0373955_0404189 | 3300035172 | Bacteria | 830 |
| 323 | Ga0316574_0688845 | 3300035398 | Bacteria | 627 |
| 324 | Ga0373924_0486760 | 3300035410 | Unclassified | 554 |
| 325 | Ga0373935_0752445 | 3300035692 | Unclassified | 718 |
| 326 | Ga0373935_1172319 | 3300035692 | Bacteria | 572 |
| 327 | Ga0373927_0028289 | 3300035695 | Bacteria | 3656 |
| 328 | Ga0373933_0007290 | 3300035724 | Bacteria | 6031 |
| 329 | Ga0373947_0119527 | 3300035725 | Bacteria | 1673 |
| 330 | Ga0373937_0006468 | 3300036401 | Bacteria | 10109 |
| 331 | Ga0373937_0028891 | 3300036401 | Bacteria | 5021 |
| 332 | Ga0373937_0074547 | 3300036401 | Bacteria | 3132 |
| 333 | Ga0373937_0526276 | 3300036401 | Unclassified | 1123 |
| 334 | Ga0373925_0311518 | 3300037068 | Bacteria | 1272 |
| 335 | Ga0395905_0430530 | 3300037471 | Bacteria | 1216 |
| 336 | Ga0395905_0651471 | 3300037471 | Bacteria | 955 |
| 337 | Ga0436360_0891124 | 3300039438 | Bacteria | 652 |
| 338 | Ga0436360_1275643 | 3300039438 | Bacteria | 903 |
| 339 | Ga0436361_0191127 | 3300039447 | Bacteria | 836 |
| 340 | Ga0436363_0272420 | 3300039450 | Bacteria | 503 |
| 341 | Ga0436362_0661266 | 3300039453 | Bacteria | 507 |
| 342 | Ga0436362_1172253 | 3300039453 | Bacteria | 623 |
| 343 | Ga0439465_0008321 | 3300041413 | Bacteria | 3273 |
| 344 | Ga0451794_16987 | 3300041446 | Bacteria | 604 |
| 345 | Ga0451797_0746618 | 3300041453 | Bacteria | 541 |
| 346 | Ga0451800_0273962 | 3300041459 | Bacteria | 878 |
| 347 | Ga0451800_1558869 | 3300041459 | Bacteria | 955 |
| 348 | Ga0451807_2194440 | 3300041486 | Bacteria | 1188 |
| 349 | Ga0451837_1678537 | 3300041494 | Bacteria | 780 |
| 350 | Ga0451839_0466753 | 3300041496 | Bacteria | 507 |
| 351 | Ga0451847_0667574 | 3300041503 | Bacteria | 553 |
| 352 | Ga0451849_0600664 | 3300041505 | Unclassified | 2584 |
| 353 | Ga0451843_0663320 | 3300041509 | Unclassified | 1120 |
| 354 | Ga0451855_1201734 | 3300041511 | Unclassified | 878 |
| 355 | Ga0451853_0601611 | 3300041512 | Bacteria | 816 |
| 356 | Ga0451853_1759616 | 3300041512 | Bacteria | 27396 |
| 357 | Ga0451853_3832943 | 3300041512 | Bacteria | 709 |
| 358 | Ga0451853_3842606 | 3300041512 | Bacteria | 1529 |
| 359 | Ga0439445_0030244 | 3300042004 | Bacteria | 1403 |
| 360 | Ga0439434_0217437 | 3300042435 | Bacteria | 648 |
| 361 | Ga0451577_0066385 | 3300042876 | Bacteria | 3218 |
| 362 | Ga0451577_0117032 | 3300042876 | Bacteria | 2387 |
| 363 | Ga0451577_0177995 | 3300042876 | Bacteria | 1917 |
| 364 | Ga0451577_0401782 | 3300042876 | Bacteria | 1243 |
| 365 | Ga0451577_0409783 | 3300042876 | Bacteria | 1230 |
| 366 | Ga0451577_0566313 | 3300042876 | Bacteria | 1031 |
| 367 | Ga0451577_0805048 | 3300042876 | Bacteria | 849 |
| 368 | Ga0451577_1126155 | 3300042876 | Bacteria | 702 |
| 369 | Ga0451577_1980054 | 3300042876 | Unclassified | 509 |
| 370 | Ga0466972_0446932 | 3300044658 | Bacteria | 607 |
| 371 | Ga0453683_0002373 | 3300044673 | Bacteria | 14721 |
| 372 | Ga0453683_0023842 | 3300044673 | Bacteria | 3897 |
| 373 | Ga0453683_0028649 | 3300044673 | Bacteria | 3525 |
| 374 | Ga0453683_0036600 | 3300044673 | Bacteria | 3089 |
| 375 | Ga0453683_0368847 | 3300044673 | Bacteria | 923 |
| 376 | Ga0453683_0481481 | 3300044673 | Bacteria | 804 |
| 377 | Ga0453684_0000082 | 3300044712 | Bacteria | 399380 |
| 378 | Ga0453684_0001048 | 3300044712 | Bacteria | 88382 |
| 379 | Ga0453684_0001308 | 3300044712 | Bacteria | 73691 |
| 380 | Ga0453684_0002592 | 3300044712 | Bacteria | 43253 |
| 381 | Ga0453684_0060439 | 3300044712 | Bacteria | 4873 |
| 382 | Ga0453684_0061490 | 3300044712 | Bacteria | 4820 |
| 383 | Ga0453684_0072781 | 3300044712 | Bacteria | 4336 |
| 384 | Ga0453684_0077572 | 3300044712 | Bacteria | 4162 |
| 385 | Ga0453684_0183611 | 3300044712 | Bacteria | 2453 |
| 386 | Ga0453684_0205913 | 3300044712 | Bacteria | 2290 |
| 387 | Ga0453684_0527012 | 3300044712 | Bacteria | 1304 |
| 388 | Ga0453684_0891090 | 3300044712 | Bacteria | 953 |
| 389 | Ga0453684_1156846 | 3300044712 | Bacteria | 814 |
| 390 | Ga0466960_0634830 | 3300044901 | Bacteria | 636 |
| 391 | Ga0451576_0008790 | 3300045051 | Bacteria | 11814 |
| 392 | Ga0451576_0010049 | 3300045051 | Bacteria | 10897 |
| 393 | Ga0451576_0039861 | 3300045051 | Bacteria | 4973 |
| 394 | Ga0451576_0253366 | 3300045051 | Bacteria | 1840 |
| 395 | Ga0451576_0260354 | 3300045051 | Bacteria | 1813 |
| 396 | Ga0451576_0340074 | 3300045051 | Bacteria | 1571 |
| 397 | Ga0451576_0556339 | 3300045051 | Bacteria | 1205 |
| 398 | Ga0451576_0684768 | 3300045051 | Bacteria | 1077 |
| 399 | Ga0451576_1938125 | 3300045051 | Bacteria | 607 |
| 400 | Ga0451576_2249749 | 3300045051 | Bacteria | 559 |
| 401 | Ga0495651_0876107 | 3300046462 | Unclassified | 550 |
| 402 | Ga0495662_0236033 | 3300046476 | Archaea | 901 |
| 403 | Ga0495640_0805165 | 3300046533 | Unclassified | 560 |
| 404 | Ga0495622_0105999 | 3300046557 | Unclassified | 1288 |
| 405 | Ga0495667_0406792 | 3300046559 | Unclassified | 857 |
| 406 | Ga0495667_0763891 | 3300046559 | Unclassified | 597 |
| 407 | Ga0495668_0738243 | 3300046616 | Bacteria | 545 |
| 408 | Ga0495635_0598396 | 3300046663 | Bacteria | 720 |
| 409 | Ga0495657_0417208 | 3300046675 | Bacteria | 788 |
| 410 | Ga0495657_0811407 | 3300046675 | Bacteria | 534 |
| 411 | Ga0495658_0761998 | 3300046683 | Unclassified | 620 |
| 412 | Ga0495604_0452179 | 3300047317 | Unclassified | 839 |
| 413 | Ga0495680_0242390 | 3300047322 | Bacteria | 1280 |
| 414 | Ga0495680_0248537 | 3300047322 | Unclassified | 1261 |
| 415 | Ga0495686_0020684 | 3300047472 | Bacteria | 4386 |
| 416 | Ga0496100_0671070 | 3300048903 | Unclassified | 808 |
| 417 | Ga0496104_0335929 | 3300048907 | Bacteria | 1424 |
| 418 | Ga0496104_1229533 | 3300048907 | Bacteria | 652 |
| 419 | Ga0496104_1422235 | 3300048907 | Bacteria | 596 |
| 420 | Ga0496108_0104858 | 3300048911 | Unclassified | 2413 |
| 421 | Ga0496108_0548208 | 3300048911 | Bacteria | 1009 |
| 422 | Ga0496109_1557934 | 3300048912 | Bacteria | 595 |
| 423 | Ga0496110_0326720 | 3300048913 | Unclassified | 1397 |
| 424 | Ga0496112_0027700 | 3300048915 | Bacteria | 5465 |
| 425 | Ga0496112_1371944 | 3300048915 | Unclassified | 622 |
| 426 | Ga0496112_1532116 | 3300048915 | Bacteria | 580 |
| 427 | Ga0496113_0880416 | 3300048916 | Bacteria | 709 |
| 428 | Ga0496115_0101075 | 3300048918 | Bacteria | 2364 |
| 429 | Ga0496115_1419543 | 3300048918 | Bacteria | 512 |
| 430 | Ga0496123_0217571 | 3300048926 | Bacteria | 966 |
| 431 | Ga0501312_064241 | 3300049528 | Bacteria | 640 |
| 432 | Ga0501312_081231 | 3300049528 | Bacteria | 587 |
| 433 | Ga0501032_0086291 | 3300049569 | Bacteria | 2086 |
| 434 | Ga0501034_0439301 | 3300049571 | Bacteria | 1224 |
| 435 | Ga0501034_0865761 | 3300049571 | Bacteria | 793 |
| 436 | Ga0501037_0488353 | 3300049573 | Unclassified | 836 |
| 437 | Ga0501038_0235730 | 3300049574 | Bacteria | 1454 |
| 438 | Ga0501043_0019752 | 3300049579 | Bacteria | 5291 |
| 439 | Ga0501047_0001215 | 3300049581 | Bacteria | 25539 |
| 440 | Ga0501047_0058279 | 3300049581 | Bacteria | 3731 |
| 441 | Ga0501048_0137615 | 3300049582 | Bacteria | 1726 |
| 442 | Ga0501067_0000389 | 3300049583 | Bacteria | 23907 |
| 443 | Ga0501067_0004630 | 3300049583 | Bacteria | 7620 |
| 444 | Ga0501067_0082007 | 3300049583 | Bacteria | 1788 |
| 445 | Ga0501068_0000260 | 3300049584 | Bacteria | 26078 |
| 446 | Ga0501068_0025539 | 3300049584 | Bacteria | 3475 |
| 447 | Ga0501068_0028275 | 3300049584 | Bacteria | 3315 |
| 448 | Ga0501068_0117202 | 3300049584 | Bacteria | 1659 |
| 449 | Ga0501068_0942297 | 3300049584 | Bacteria | 569 |
| 450 | Ga0501069_0007698 | 3300049585 | Bacteria | 5651 |
| 451 | Ga0501070_0131924 | 3300049586 | Bacteria | 2063 |
| 452 | Ga0501070_0904102 | 3300049586 | Bacteria | 688 |
| 453 | Ga0501071_0932309 | 3300049587 | Bacteria | 670 |
| 454 | Ga0501072_0000029 | 3300049588 | Bacteria | 134083 |
| 455 | Ga0501072_0047336 | 3300049588 | Unclassified | 3387 |
| 456 | Ga0501073_0004013 | 3300049589 | Bacteria | 11054 |
| 457 | Ga0501073_0023129 | 3300049589 | Bacteria | 4467 |
| 458 | Ga0501073_0195312 | 3300049589 | Bacteria | 1400 |
| 459 | Ga0501073_0249108 | 3300049589 | Bacteria | 1226 |
| 460 | Ga0501074_0011769 | 3300049590 | Bacteria | 6359 |
| 461 | Ga0501074_0075401 | 3300049590 | Bacteria | 2421 |
| 462 | Ga0501074_0115472 | 3300049590 | Bacteria | 1921 |
| 463 | Ga0501074_0155340 | 3300049590 | Unclassified | 1635 |
| 464 | Ga0501074_0897379 | 3300049590 | Bacteria | 624 |
| 465 | Ga0501075_0935974 | 3300049591 | Unclassified | 659 |
| 466 | Ga0501076_0017901 | 3300049592 | Bacteria | 5388 |
| 467 | Ga0501076_0055424 | 3300049592 | Bacteria | 3144 |
| 468 | Ga0501077_0055358 | 3300049593 | Bacteria | 2518 |
| 469 | Ga0501079_0008659 | 3300049741 | Bacteria | 7716 |
| 470 | Ga0501080_0001990 | 3300049742 | Bacteria | 17625 |
| 471 | Ga0501080_0023382 | 3300049742 | Bacteria | 5729 |
| 472 | Ga0501080_0277003 | 3300049742 | Unclassified | 1526 |
| 473 | Ga0501080_0313098 | 3300049742 | Bacteria | 1422 |
| 474 | Ga0501080_0491561 | 3300049742 | Bacteria | 1097 |
| 475 | Ga0501081_0324668 | 3300049743 | Bacteria | 1132 |
| 476 | Ga0501083_0001939 | 3300049744 | Bacteria | 14232 |
| 477 | Ga0501083_0006810 | 3300049744 | Bacteria | 8112 |
| 478 | Ga0501083_0008850 | 3300049744 | Bacteria | 7108 |
| 479 | Ga0501083_0026398 | 3300049744 | Bacteria | 4014 |
| 480 | Ga0501083_0071247 | 3300049744 | Bacteria | 2311 |
| 481 | Ga0501083_0118798 | 3300049744 | Archaea | 1734 |
| 482 | Ga0501083_0646020 | 3300049744 | Bacteria | 688 |
| 483 | Ga0501263_032218 | 3300049760 | Bacteria | 744 |
| 484 | Ga0501044_0001690 | 3300049823 | Bacteria | 25921 |
| 485 | Ga0501044_0219176 | 3300049823 | Unclassified | 1854 |
| 486 | nmdc:mga06r32_460050_c1 | 3300050510 | Bacteria | 1251 |
| 487 | nmdc:mga08y16_107346_c1 | 3300050511 | Bacteria | 2906 |
| 488 | nmdc:mga08y16_1303628_c1 | 3300050511 | Bacteria | 693 |
| 489 | Ga0495601_0204531 | 3300053077 | Bacteria | 1290 |
| 490 | Ga0495601_0325757 | 3300053077 | Bacteria | 1000 |
| 491 | Ga0495601_0775653 | 3300053077 | Unclassified | 609 |
| 492 | Ga0500655_029481 | 3300053133 | Bacteria | 1053 |
| 493 | Ga0500568_0004574 | 3300053139 | Bacteria | 7370 |
| 494 | Ga0501084_0000018 | 3300054114 | Bacteria | 147013 |
| 495 | Ga0501084_0001201 | 3300054114 | Bacteria | 20295 |
| 496 | Ga0501084_0010255 | 3300054114 | Bacteria | 7753 |
| 497 | Ga0501084_0017867 | 3300054114 | Bacteria | 5903 |
| 498 | Ga0501084_0471226 | 3300054114 | Bacteria | 1061 |
| 499 | Ga0590071_088801 | 3300059421 | Bacteria | 772 |
| 500 | Ga0590074_053271 | 3300059423 | Bacteria | 743 |
| 501 | Ga0587084_042489 | 3300059477 | Bacteria | 778 |
| 502 | Ga0587085_084102 | 3300059506 | Bacteria | 646 |
| 503 | Ga0587076_118675 | 3300059645 | Bacteria | 610 |
| 504 | Ga0587078_067861 | 3300059646 | Bacteria | 552 |
| 505 | Ga0501082_0000287 | 3300060353 | Bacteria | 44479 |
| 506 | Ga0501082_0030161 | 3300060353 | Bacteria | 4674 |
| 507 | Ga0501082_0056039 | 3300060353 | Bacteria | 3395 |
| 508 | Ga0501082_0056351 | 3300060353 | Bacteria | 3385 |
| 509 | Ga0530510_0615470 | 3300061734 | Unclassified | 826 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0368847 | Ga0453683_0368847_373_726 | 117 |
| 2 | 3300044712 | Ga0453684_0002592 | Ga0453684_0002592_6678_7034 | 117 |
| 3 | 3300044712 | Ga0453684_0060439 | Ga0453684_0060439_3965_4321 | 117 |
| 4 | 3300049591 | Ga0501075_0935974 | Ga0501075_0935974_238_591 | 117 |
| 5 | 3300042876 | Ga0451577_0401782 | Ga0451577_0401782_791_1147 | 118 |
| 6 | 3300044673 | Ga0453683_0002373 | Ga0453683_0002373_11006_11362 | 118 |
| 7 | 3300044673 | Ga0453683_0023842 | Ga0453683_0023842_3468_3824 | 118 |
| 8 | 3300044712 | Ga0453684_0000082 | Ga0453684_0000082_236367_236723 | 118 |
| 9 | 3300045051 | Ga0451576_0010049 | Ga0451576_0010049_9518_9874 | 118 |
| 10 | 3300045051 | Ga0451576_0039861 | Ga0451576_0039861_1755_2111 | 118 |
| 11 | 3300045051 | Ga0451576_0684768 | Ga0451576_0684768_479_835 | 118 |
| 12 | 3300005327 | Ga0070658_11121144 | Ga0070658_111211441 | 119 |
| 13 | 3300025909 | Ga0207705_11169739 | Ga0207705_111697391 | 119 |
| 14 | 3300042876 | Ga0451577_0066385 | Ga0451577_0066385_2538_2897 | 119 |
| 15 | 3300042876 | Ga0451577_0117032 | Ga0451577_0117032_46_405 | 119 |
| 16 | 3300042876 | Ga0451577_0177995 | Ga0451577_0177995_1330_1692 | 119 |
| 17 | 3300042876 | Ga0451577_0805048 | Ga0451577_0805048_111_470 | 119 |
| 18 | 3300042876 | Ga0451577_1980054 | Ga0451577_1980054_63_428 | 119 |
| 19 | 3300044673 | Ga0453683_0028649 | Ga0453683_0028649_2047_2406 | 119 |
| 20 | 3300044673 | Ga0453683_0481481 | Ga0453683_0481481_400_759 | 119 |
| 21 | 3300044712 | Ga0453684_0001048 | Ga0453684_0001048_8693_9052 | 119 |
| 22 | 3300044712 | Ga0453684_0061490 | Ga0453684_0061490_4437_4796 | 119 |
| 23 | 3300044712 | Ga0453684_0072781 | Ga0453684_0072781_3528_3890 | 119 |
| 24 | 3300044712 | Ga0453684_0077572 | Ga0453684_0077572_691_1050 | 119 |
| 25 | 3300044712 | Ga0453684_0205913 | Ga0453684_0205913_1319_1684 | 119 |
| 26 | 3300044712 | Ga0453684_0527012 | Ga0453684_0527012_204_563 | 119 |
| 27 | 3300044712 | Ga0453684_1156846 | Ga0453684_1156846_108_467 | 119 |
| 28 | 3300045051 | Ga0451576_0260354 | Ga0451576_0260354_1431_1790 | 119 |
| 29 | 3300045051 | Ga0451576_0340074 | Ga0451576_0340074_177_536 | 119 |
| 30 | 3300045051 | Ga0451576_0556339 | Ga0451576_0556339_748_1110 | 119 |
| 31 | 3300045051 | Ga0451576_1938125 | Ga0451576_1938125_108_467 | 119 |
| 32 | 3300045051 | Ga0451576_2249749 | Ga0451576_2249749_138_503 | 119 |
| 33 | 3300048912 | Ga0496109_1557934 | Ga0496109_1557934_192_551 | 119 |
| 34 | 3300003323 | rootH1_10077254 | rootH1_100772544 | 120 |
| 35 | 3300004785 | Ga0058858_1379739 | Ga0058858_13797391 | 120 |
| 36 | 3300004798 | Ga0058859_11551521 | Ga0058859_115515211 | 120 |
| 37 | 3300004801 | Ga0058860_12057947 | Ga0058860_120579471 | 120 |
| 38 | 3300004801 | Ga0058860_12102671 | Ga0058860_121026711 | 120 |
| 39 | 3300005329 | Ga0070683_100291078 | Ga0070683_1002910783 | 120 |
| 40 | 3300005329 | Ga0070683_101126882 | Ga0070683_1011268822 | 120 |
| 41 | 3300005334 | Ga0068869_101225414 | Ga0068869_1012254142 | 120 |
| 42 | 3300005335 | Ga0070666_11350574 | Ga0070666_113505741 | 120 |
| 43 | 3300005339 | Ga0070660_100840306 | Ga0070660_1008403061 | 120 |
| 44 | 3300005340 | Ga0070689_100003803 | Ga0070689_1000038033 | 120 |
| 45 | 3300005345 | Ga0070692_11240206 | Ga0070692_112402061 | 120 |
| 46 | 3300005347 | Ga0070668_102018855 | Ga0070668_1020188551 | 120 |
| 47 | 3300005354 | Ga0070675_101169073 | Ga0070675_1011690731 | 120 |
| 48 | 3300005356 | Ga0070674_101822217 | Ga0070674_1018222171 | 120 |
| 49 | 3300005444 | Ga0070694_100243565 | Ga0070694_1002435652 | 120 |
| 50 | 3300005445 | Ga0070708_101450074 | Ga0070708_1014500741 | 120 |
| 51 | 3300005456 | Ga0070678_100011023 | Ga0070678_1000110233 | 120 |
| 52 | 3300005458 | Ga0070681_11716214 | Ga0070681_117162141 | 120 |
| 53 | 3300005459 | Ga0068867_101476219 | Ga0068867_1014762192 | 120 |
| 54 | 3300005467 | Ga0070706_100039098 | Ga0070706_1000390983 | 120 |
| 55 | 3300005468 | Ga0070707_100038749 | Ga0070707_1000387494 | 120 |
| 56 | 3300005468 | Ga0070707_100281829 | Ga0070707_1002818292 | 120 |
| 57 | 3300005535 | Ga0070684_100081070 | Ga0070684_1000810702 | 120 |
| 58 | 3300005535 | Ga0070684_100377089 | Ga0070684_1003770892 | 120 |
| 59 | 3300005547 | Ga0070693_100176087 | Ga0070693_1001760872 | 120 |
| 60 | 3300005563 | Ga0068855_100715795 | Ga0068855_1007157952 | 120 |
| 61 | 3300005563 | Ga0068855_101151804 | Ga0068855_1011518042 | 120 |
| 62 | 3300005614 | Ga0068856_100327104 | Ga0068856_1003271042 | 120 |
| 63 | 3300005614 | Ga0068856_100497442 | Ga0068856_1004974422 | 120 |
| 64 | 3300005614 | Ga0068856_100892951 | Ga0068856_1008929512 | 120 |
| 65 | 3300005616 | Ga0068852_100438475 | Ga0068852_1004384752 | 120 |
| 66 | 3300005840 | Ga0068870_11400583 | Ga0068870_114005831 | 120 |
| 67 | 3300005842 | Ga0068858_101391736 | Ga0068858_1013917361 | 120 |
| 68 | 3300005937 | Ga0081455_10059695 | Ga0081455_100596953 | 120 |
| 69 | 3300005937 | Ga0081455_10086608 | Ga0081455_100866082 | 120 |
| 70 | 3300005985 | Ga0081539_10158146 | Ga0081539_101581462 | 120 |
| 71 | 3300006195 | Ga0075366_10093602 | Ga0075366_100936022 | 120 |
| 72 | 3300006195 | Ga0075366_10249370 | Ga0075366_102493701 | 120 |
| 73 | 3300006237 | Ga0097621_101112139 | Ga0097621_1011121391 | 120 |
| 74 | 3300006358 | Ga0068871_100354553 | Ga0068871_1003545532 | 120 |
| 75 | 3300006844 | Ga0075428_102255542 | Ga0075428_1022555421 | 120 |
| 76 | 3300006847 | Ga0075431_100208346 | Ga0075431_1002083461 | 120 |
| 77 | 3300006852 | Ga0075433_11727421 | Ga0075433_117274211 | 120 |
| 78 | 3300006881 | Ga0068865_100846249 | Ga0068865_1008462491 | 120 |
| 79 | 3300006931 | Ga0097620_100570252 | Ga0097620_1005702521 | 120 |
| 80 | 3300009094 | Ga0111539_11087121 | Ga0111539_110871212 | 120 |
| 81 | 3300009094 | Ga0111539_13307297 | Ga0111539_133072971 | 120 |
| 82 | 3300009098 | Ga0105245_10014640 | Ga0105245_100146407 | 120 |
| 83 | 3300009101 | Ga0105247_10016328 | Ga0105247_100163282 | 120 |
| 84 | 3300009176 | Ga0105242_10244171 | Ga0105242_102441712 | 120 |
| 85 | 3300009176 | Ga0105242_10261693 | Ga0105242_102616932 | 120 |
| 86 | 3300009176 | Ga0105242_12106602 | Ga0105242_121066021 | 120 |
| 87 | 3300009553 | Ga0105249_11260238 | Ga0105249_112602381 | 120 |
| 88 | 3300010375 | Ga0105239_10951505 | Ga0105239_109515051 | 120 |
| 89 | 3300010375 | Ga0105239_12550292 | Ga0105239_125502921 | 120 |
| 90 | 3300010375 | Ga0105239_13632833 | Ga0105239_136328331 | 120 |
| 91 | 3300011119 | Ga0105246_11401716 | Ga0105246_114017162 | 120 |
| 92 | 3300013105 | Ga0157369_11109805 | Ga0157369_111098051 | 120 |
| 93 | 3300013296 | Ga0157374_10311366 | Ga0157374_103113662 | 120 |
| 94 | 3300013296 | Ga0157374_10468081 | Ga0157374_104680812 | 120 |
| 95 | 3300013296 | Ga0157374_10480169 | Ga0157374_104801692 | 120 |
| 96 | 3300013307 | Ga0157372_10644332 | Ga0157372_106443322 | 120 |
| 97 | 3300013307 | Ga0157372_13030803 | Ga0157372_130308031 | 120 |
| 98 | 3300014325 | Ga0163163_12038350 | Ga0163163_120383502 | 120 |
| 99 | 3300014325 | Ga0163163_12277819 | Ga0163163_122778192 | 120 |
| 100 | 3300014325 | Ga0163163_12616284 | Ga0163163_126162841 | 120 |
| 101 | 3300014326 | Ga0157380_11043242 | Ga0157380_110432421 | 120 |
| 102 | 3300014969 | Ga0157376_10118980 | Ga0157376_101189803 | 120 |
| 103 | 3300014969 | Ga0157376_10556063 | Ga0157376_105560632 | 120 |
| 104 | 3300014969 | Ga0157376_10951898 | Ga0157376_109518982 | 120 |
| 105 | 3300017792 | Ga0163161_10878933 | Ga0163161_108789332 | 120 |
| 106 | 3300020075 | Ga0206349_1888834 | Ga0206349_18888341 | 120 |
| 107 | 3300025900 | Ga0207710_10008087 | Ga0207710_100080873 | 120 |
| 108 | 3300025903 | Ga0207680_10556681 | Ga0207680_105566812 | 120 |
| 109 | 3300025909 | Ga0207705_10648561 | Ga0207705_106485611 | 120 |
| 110 | 3300025910 | Ga0207684_11105136 | Ga0207684_111051361 | 120 |
| 111 | 3300025913 | Ga0207695_10327237 | Ga0207695_103272372 | 120 |
| 112 | 3300025922 | Ga0207646_10039380 | Ga0207646_100393804 | 120 |
| 113 | 3300025922 | Ga0207646_11300229 | Ga0207646_113002291 | 120 |
| 114 | 3300025926 | Ga0207659_10681264 | Ga0207659_106812641 | 120 |
| 115 | 3300025927 | Ga0207687_10101637 | Ga0207687_101016372 | 120 |
| 116 | 3300025932 | Ga0207690_10630654 | Ga0207690_106306542 | 120 |
| 117 | 3300025934 | Ga0207686_10294824 | Ga0207686_102948242 | 120 |
| 118 | 3300025934 | Ga0207686_11428406 | Ga0207686_114284062 | 120 |
| 119 | 3300025936 | Ga0207670_10014878 | Ga0207670_100148783 | 120 |
| 120 | 3300025941 | Ga0207711_10490680 | Ga0207711_104906802 | 120 |
| 121 | 3300025944 | Ga0207661_10486092 | Ga0207661_104860921 | 120 |
| 122 | 3300025949 | Ga0207667_11571339 | Ga0207667_115713391 | 120 |
| 123 | 3300025961 | Ga0207712_11858410 | Ga0207712_118584101 | 120 |
| 124 | 3300025972 | Ga0207668_10252978 | Ga0207668_102529782 | 120 |
| 125 | 3300026035 | Ga0207703_12419472 | Ga0207703_124194721 | 120 |
| 126 | 3300026067 | Ga0207678_11020010 | Ga0207678_110200101 | 120 |
| 127 | 3300026075 | Ga0207708_10833998 | Ga0207708_108339982 | 120 |
| 128 | 3300026075 | Ga0207708_11585125 | Ga0207708_115851251 | 120 |
| 129 | 3300026078 | Ga0207702_10187036 | Ga0207702_101870362 | 120 |
| 130 | 3300026078 | Ga0207702_10454185 | Ga0207702_104541852 | 120 |
| 131 | 3300026089 | Ga0207648_11810319 | Ga0207648_118103191 | 120 |
| 132 | 3300026116 | Ga0207674_10833672 | Ga0207674_108336721 | 120 |
| 133 | 3300026121 | Ga0207683_10452113 | Ga0207683_104521131 | 120 |
| 134 | 3300026142 | Ga0207698_11751924 | Ga0207698_117519242 | 120 |
| 135 | 3300028380 | Ga0268265_10947935 | Ga0268265_109479352 | 120 |
| 136 | 3300028573 | Ga0265334_10031817 | Ga0265334_100318171 | 120 |
| 137 | 3300028794 | Ga0307515_10836213 | Ga0307515_108362132 | 120 |
| 138 | 3300028800 | Ga0265338_10467473 | Ga0265338_104674731 | 120 |
| 139 | 3300030521 | Ga0307511_10003700 | Ga0307511_100037002 | 120 |
| 140 | 3300030760 | Ga0265762_1171881 | Ga0265762_11718811 | 120 |
| 141 | 3300030863 | Ga0265766_1024722 | Ga0265766_10247221 | 120 |
| 142 | 3300031238 | Ga0265332_10005390 | Ga0265332_100053902 | 120 |
| 143 | 3300031249 | Ga0265339_10000814 | Ga0265339_100008147 | 120 |
| 144 | 3300031250 | Ga0265331_10099275 | Ga0265331_100992751 | 120 |
| 145 | 3300031344 | Ga0265316_10012776 | Ga0265316_100127763 | 120 |
| 146 | 3300031649 | Ga0307514_10024515 | Ga0307514_100245152 | 120 |
| 147 | 3300031711 | Ga0265314_10000001 | Ga0265314_100000013214 | 120 |
| 148 | 3300031727 | Ga0316576_10623704 | Ga0316576_106237042 | 120 |
| 149 | 3300031731 | Ga0307405_11702427 | Ga0307405_117024271 | 120 |
| 150 | 3300031824 | Ga0307413_10798902 | Ga0307413_107989022 | 120 |
| 151 | 3300031824 | Ga0307413_11856943 | Ga0307413_118569431 | 120 |
| 152 | 3300031901 | Ga0307406_10009467 | Ga0307406_100094672 | 120 |
| 153 | 3300031903 | Ga0307407_10244969 | Ga0307407_102449692 | 120 |
| 154 | 3300031911 | Ga0307412_10008938 | Ga0307412_100089382 | 120 |
| 155 | 3300033528 | Ga0316588_1146196 | Ga0316588_11461961 | 120 |
| 156 | 3300034817 | Ga0373948_0185663 | Ga0373948_0185663_163_525 | 120 |
| 157 | 3300035119 | Ga0373956_0165220 | Ga0373956_0165220_562_924 | 120 |
| 158 | 3300035121 | Ga0373960_0270474 | Ga0373960_0270474_16_378 | 120 |
| 159 | 3300035172 | Ga0373955_0404189 | Ga0373955_0404189_187_549 | 120 |
| 160 | 3300035398 | Ga0316574_0688845 | Ga0316574_0688845_87_449 | 120 |
| 161 | 3300036401 | Ga0373937_0028891 | Ga0373937_0028891_3369_3731 | 120 |
| 162 | 3300036401 | Ga0373937_0526276 | Ga0373937_0526276_131_493 | 120 |
| 163 | 3300037471 | Ga0395905_0430530 | Ga0395905_0430530_111_473 | 120 |
| 164 | 3300037471 | Ga0395905_0651471 | Ga0395905_0651471_508_870 | 120 |
| 165 | 3300039438 | Ga0436360_0891124 | Ga0436360_0891124_214_576 | 120 |
| 166 | 3300039438 | Ga0436360_1275643 | Ga0436360_1275643_57_419 | 120 |
| 167 | 3300039447 | Ga0436361_0191127 | Ga0436361_0191127_327_689 | 120 |
| 168 | 3300039450 | Ga0436363_0272420 | Ga0436363_0272420_51_413 | 120 |
| 169 | 3300039453 | Ga0436362_0661266 | Ga0436362_0661266_97_459 | 120 |
| 170 | 3300041413 | Ga0439465_0008321 | Ga0439465_0008321_313_681 | 120 |
| 171 | 3300041446 | Ga0451794_16987 | Ga0451794_16987_187_549 | 120 |
| 172 | 3300041459 | Ga0451800_0273962 | Ga0451800_0273962_322_684 | 120 |
| 173 | 3300041459 | Ga0451800_1558869 | Ga0451800_1558869_471_833 | 120 |
| 174 | 3300041496 | Ga0451839_0466753 | Ga0451839_0466753_14_376 | 120 |
| 175 | 3300041503 | Ga0451847_0667574 | Ga0451847_0667574_143_505 | 120 |
| 176 | 3300041512 | Ga0451853_3832943 | Ga0451853_3832943_69_431 | 120 |
| 177 | 3300042004 | Ga0439445_0030244 | Ga0439445_0030244_1009_1377 | 120 |
| 178 | 3300042435 | Ga0439434_0217437 | Ga0439434_0217437_178_540 | 120 |
| 179 | 3300042876 | Ga0451577_0409783 | Ga0451577_0409783_447_815 | 120 |
| 180 | 3300042876 | Ga0451577_1126155 | Ga0451577_1126155_103_465 | 120 |
| 181 | 3300044658 | Ga0466972_0446932 | Ga0466972_0446932_161_523 | 120 |
| 182 | 3300044673 | Ga0453683_0036600 | Ga0453683_0036600_2041_2403 | 120 |
| 183 | 3300044712 | Ga0453684_0183611 | Ga0453684_0183611_1660_2028 | 120 |
| 184 | 3300044901 | Ga0466960_0634830 | Ga0466960_0634830_219_581 | 120 |
| 185 | 3300045051 | Ga0451576_0008790 | Ga0451576_0008790_3695_4063 | 120 |
| 186 | 3300045051 | Ga0451576_0253366 | Ga0451576_0253366_64_426 | 120 |
| 187 | 3300046476 | Ga0495662_0236033 | Ga0495662_0236033_463_825 | 120 |
| 188 | 3300046533 | Ga0495640_0805165 | Ga0495640_0805165_119_481 | 120 |
| 189 | 3300046559 | Ga0495667_0406792 | Ga0495667_0406792_101_463 | 120 |
| 190 | 3300046675 | Ga0495657_0811407 | Ga0495657_0811407_79_441 | 120 |
| 191 | 3300047322 | Ga0495680_0248537 | Ga0495680_0248537_174_536 | 120 |
| 192 | 3300048907 | Ga0496104_1229533 | Ga0496104_1229533_183_545 | 120 |
| 193 | 3300048907 | Ga0496104_1422235 | Ga0496104_1422235_36_398 | 120 |
| 194 | 3300048915 | Ga0496112_1532116 | Ga0496112_1532116_189_551 | 120 |
| 195 | 3300048918 | Ga0496115_1419543 | Ga0496115_1419543_76_438 | 120 |
| 196 | 3300048926 | Ga0496123_0217571 | Ga0496123_0217571_99_461 | 120 |
| 197 | 3300049528 | Ga0501312_064241 | Ga0501312_064241_140_502 | 120 |
| 198 | 3300049528 | Ga0501312_081231 | Ga0501312_081231_57_419 | 120 |
| 199 | 3300049569 | Ga0501032_0086291 | Ga0501032_0086291_1529_1891 | 120 |
| 200 | 3300049571 | Ga0501034_0439301 | Ga0501034_0439301_340_702 | 120 |
| 201 | 3300049571 | Ga0501034_0865761 | Ga0501034_0865761_16_378 | 120 |
| 202 | 3300049573 | Ga0501037_0488353 | Ga0501037_0488353_112_474 | 120 |
| 203 | 3300049574 | Ga0501038_0235730 | Ga0501038_0235730_300_662 | 120 |
| 204 | 3300049579 | Ga0501043_0019752 | Ga0501043_0019752_1837_2199 | 120 |
| 205 | 3300049581 | Ga0501047_0001215 | Ga0501047_0001215_21882_22244 | 120 |
| 206 | 3300049581 | Ga0501047_0058279 | Ga0501047_0058279_3276_3638 | 120 |
| 207 | 3300049582 | Ga0501048_0137615 | Ga0501048_0137615_407_769 | 120 |
| 208 | 3300049583 | Ga0501067_0000389 | Ga0501067_0000389_19157_19519 | 120 |
| 209 | 3300049583 | Ga0501067_0082007 | Ga0501067_0082007_30_392 | 120 |
| 210 | 3300049584 | Ga0501068_0000260 | Ga0501068_0000260_22385_22747 | 120 |
| 211 | 3300049584 | Ga0501068_0025539 | Ga0501068_0025539_2520_2882 | 120 |
| 212 | 3300049584 | Ga0501068_0028275 | Ga0501068_0028275_1116_1478 | 120 |
| 213 | 3300049584 | Ga0501068_0117202 | Ga0501068_0117202_1064_1426 | 120 |
| 214 | 3300049584 | Ga0501068_0942297 | Ga0501068_0942297_46_408 | 120 |
| 215 | 3300049585 | Ga0501069_0007698 | Ga0501069_0007698_2209_2571 | 120 |
| 216 | 3300049586 | Ga0501070_0131924 | Ga0501070_0131924_63_425 | 120 |
| 217 | 3300049586 | Ga0501070_0904102 | Ga0501070_0904102_63_425 | 120 |
| 218 | 3300049587 | Ga0501071_0932309 | Ga0501071_0932309_166_528 | 120 |
| 219 | 3300049588 | Ga0501072_0000029 | Ga0501072_0000029_130362_130724 | 120 |
| 220 | 3300049588 | Ga0501072_0047336 | Ga0501072_0047336_1993_2355 | 120 |
| 221 | 3300049589 | Ga0501073_0004013 | Ga0501073_0004013_382_744 | 120 |
| 222 | 3300049589 | Ga0501073_0023129 | Ga0501073_0023129_113_475 | 120 |
| 223 | 3300049589 | Ga0501073_0195312 | Ga0501073_0195312_780_1142 | 120 |
| 224 | 3300049589 | Ga0501073_0249108 | Ga0501073_0249108_735_1097 | 120 |
| 225 | 3300049590 | Ga0501074_0011769 | Ga0501074_0011769_3335_3697 | 120 |
| 226 | 3300049590 | Ga0501074_0075401 | Ga0501074_0075401_367_729 | 120 |
| 227 | 3300049590 | Ga0501074_0155340 | Ga0501074_0155340_475_837 | 120 |
| 228 | 3300049590 | Ga0501074_0897379 | Ga0501074_0897379_156_518 | 120 |
| 229 | 3300049592 | Ga0501076_0017901 | Ga0501076_0017901_3066_3428 | 120 |
| 230 | 3300049592 | Ga0501076_0055424 | Ga0501076_0055424_2583_2945 | 120 |
| 231 | 3300049593 | Ga0501077_0055358 | Ga0501077_0055358_214_576 | 120 |
| 232 | 3300049741 | Ga0501079_0008659 | Ga0501079_0008659_3337_3699 | 120 |
| 233 | 3300049742 | Ga0501080_0001990 | Ga0501080_0001990_15306_15668 | 120 |
| 234 | 3300049742 | Ga0501080_0023382 | Ga0501080_0023382_1580_1942 | 120 |
| 235 | 3300049742 | Ga0501080_0277003 | Ga0501080_0277003_834_1196 | 120 |
| 236 | 3300049742 | Ga0501080_0313098 | Ga0501080_0313098_829_1191 | 120 |
| 237 | 3300049742 | Ga0501080_0491561 | Ga0501080_0491561_285_647 | 120 |
| 238 | 3300049743 | Ga0501081_0324668 | Ga0501081_0324668_144_506 | 120 |
| 239 | 3300049744 | Ga0501083_0001939 | Ga0501083_0001939_10076_10438 | 120 |
| 240 | 3300049744 | Ga0501083_0006810 | Ga0501083_0006810_2402_2764 | 120 |
| 241 | 3300049744 | Ga0501083_0008850 | Ga0501083_0008850_6163_6525 | 120 |
| 242 | 3300049744 | Ga0501083_0026398 | Ga0501083_0026398_2960_3322 | 120 |
| 243 | 3300049744 | Ga0501083_0118798 | Ga0501083_0118798_829_1191 | 120 |
| 244 | 3300049744 | Ga0501083_0646020 | Ga0501083_0646020_224_586 | 120 |
| 245 | 3300049760 | Ga0501263_032218 | Ga0501263_032218_237_599 | 120 |
| 246 | 3300049823 | Ga0501044_0001690 | Ga0501044_0001690_13744_14106 | 120 |
| 247 | 3300049823 | Ga0501044_0219176 | Ga0501044_0219176_1175_1537 | 120 |
| 248 | 3300050510 | nmdc:mga06r32_460050_c1 | nmdc:mga06r32_460050_c1_837_1199 | 120 |
| 249 | 3300050511 | nmdc:mga08y16_107346_c1 | nmdc:mga08y16_107346_c1_1925_2287 | 120 |
| 250 | 3300050511 | nmdc:mga08y16_1303628_c1 | nmdc:mga08y16_1303628_c1_268_630 | 120 |
| 251 | 3300053077 | Ga0495601_0775653 | Ga0495601_0775653_145_507 | 120 |
| 252 | 3300054114 | Ga0501084_0000018 | Ga0501084_0000018_16293_16655 | 120 |
| 253 | 3300054114 | Ga0501084_0001201 | Ga0501084_0001201_5934_6296 | 120 |
| 254 | 3300054114 | Ga0501084_0010255 | Ga0501084_0010255_4861_5223 | 120 |
| 255 | 3300054114 | Ga0501084_0017867 | Ga0501084_0017867_4662_5024 | 120 |
| 256 | 3300054114 | Ga0501084_0471226 | Ga0501084_0471226_664_1026 | 120 |
| 257 | 3300059421 | Ga0590071_088801 | Ga0590071_088801_336_698 | 120 |
| 258 | 3300059423 | Ga0590074_053271 | Ga0590074_053271_149_511 | 120 |
| 259 | 3300059477 | Ga0587084_042489 | Ga0587084_042489_61_423 | 120 |
| 260 | 3300059506 | Ga0587085_084102 | Ga0587085_084102_66_428 | 120 |
| 261 | 3300059646 | Ga0587078_067861 | Ga0587078_067861_105_467 | 120 |
| 262 | 3300060353 | Ga0501082_0000287 | Ga0501082_0000287_2103_2465 | 120 |
| 263 | 3300060353 | Ga0501082_0030161 | Ga0501082_0030161_3020_3382 | 120 |
| 264 | 3300060353 | Ga0501082_0056039 | Ga0501082_0056039_2793_3155 | 120 |
| 265 | 3300060353 | Ga0501082_0056351 | Ga0501082_0056351_1458_1820 | 120 |
| 266 | 3300061734 | Ga0530510_0615470 | Ga0530510_0615470_288_650 | 120 |
| 267 | 3300041453 | Ga0451797_0746618 | Ga0451797_0746618_140_505 | 121 |
| 268 | 3300005459 | Ga0068867_100058006 | Ga0068867_1000580063 | 122 |
| 269 | 3300006237 | Ga0097621_100025326 | Ga0097621_1000253265 | 122 |
| 270 | 3300006844 | Ga0075428_100220688 | Ga0075428_1002206882 | 122 |
| 271 | 3300026089 | Ga0207648_10028413 | Ga0207648_100284136 | 122 |
| 272 | 3300031249 | Ga0265339_10211689 | Ga0265339_102116892 | 122 |
| 273 | 3300041486 | Ga0451807_2194440 | Ga0451807_2194440_223_591 | 122 |
| 274 | 3300042876 | Ga0451577_0566313 | Ga0451577_0566313_114_482 | 122 |
| 275 | 3300044712 | Ga0453684_0891090 | Ga0453684_0891090_438_806 | 122 |
| 276 | 3300009147 | Ga0114129_11243017 | Ga0114129_112430171 | 123 |
| 277 | 3300013296 | Ga0157374_11140605 | Ga0157374_111406051 | 123 |
| 278 | 3300014969 | Ga0157376_11058619 | Ga0157376_110586192 | 123 |
| 279 | 3300041505 | Ga0451849_0600664 | Ga0451849_0600664_1815_2237 | 123 |
| 280 | 3300041509 | Ga0451843_0663320 | Ga0451843_0663320_227_649 | 123 |
| 281 | 3300041511 | Ga0451855_1201734 | Ga0451855_1201734_435_857 | 123 |
| 282 | 3300041512 | Ga0451853_1759616 | Ga0451853_1759616_2124_2546 | 123 |
| 283 | 3300044712 | Ga0453684_0001308 | Ga0453684_0001308_36595_36975 | 124 |
| 284 | 3300049744 | Ga0501083_0071247 | Ga0501083_0071247_413_832 | 124 |
| 285 | 3300002870 | Ga0006763J43179_107734 | Ga0006763J43179_1077341 | 125 |
| 286 | 3300003163 | Ga0006759J45824_1006064 | Ga0006759J45824_10060641 | 125 |
| 287 | 3300003300 | Ga0006758J48902_1019475 | Ga0006758J48902_10194751 | 125 |
| 288 | 3300003323 | rootH1_10288592 | rootH1_102885922 | 125 |
| 289 | 3300003693 | Ga0032354_1031084 | Ga0032354_10310841 | 125 |
| 290 | 3300004801 | Ga0058860_11846079 | Ga0058860_118460791 | 125 |
| 291 | 3300004803 | Ga0058862_10075690 | Ga0058862_100756903 | 125 |
| 292 | 3300005293 | Ga0065715_10577474 | Ga0065715_105774742 | 125 |
| 293 | 3300005327 | Ga0070658_10044642 | Ga0070658_100446424 | 125 |
| 294 | 3300005328 | Ga0070676_10010085 | Ga0070676_100100855 | 125 |
| 295 | 3300005329 | Ga0070683_100227111 | Ga0070683_1002271112 | 125 |
| 296 | 3300005330 | Ga0070690_100001442 | Ga0070690_1000014423 | 125 |
| 297 | 3300005330 | Ga0070690_100003920 | Ga0070690_1000039209 | 125 |
| 298 | 3300005331 | Ga0070670_100522217 | Ga0070670_1005222172 | 125 |
| 299 | 3300005335 | Ga0070666_10087814 | Ga0070666_100878142 | 125 |
| 300 | 3300005335 | Ga0070666_10135707 | Ga0070666_101357072 | 125 |
| 301 | 3300005336 | Ga0070680_100040653 | Ga0070680_1000406534 | 125 |
| 302 | 3300005336 | Ga0070680_100385429 | Ga0070680_1003854292 | 125 |
| 303 | 3300005338 | Ga0068868_100213350 | Ga0068868_1002133504 | 125 |
| 304 | 3300005338 | Ga0068868_100240580 | Ga0068868_1002405803 | 125 |
| 305 | 3300005339 | Ga0070660_100334669 | Ga0070660_1003346692 | 125 |
| 306 | 3300005340 | Ga0070689_100067538 | Ga0070689_1000675382 | 125 |
| 307 | 3300005343 | Ga0070687_100029373 | Ga0070687_1000293733 | 125 |
| 308 | 3300005344 | Ga0070661_100776923 | Ga0070661_1007769232 | 125 |
| 309 | 3300005345 | Ga0070692_10009790 | Ga0070692_100097904 | 125 |
| 310 | 3300005345 | Ga0070692_10752199 | Ga0070692_107521992 | 125 |
| 311 | 3300005347 | Ga0070668_100552362 | Ga0070668_1005523622 | 125 |
| 312 | 3300005355 | Ga0070671_100180443 | Ga0070671_1001804431 | 125 |
| 313 | 3300005364 | Ga0070673_100100750 | Ga0070673_1001007501 | 125 |
| 314 | 3300005364 | Ga0070673_100490822 | Ga0070673_1004908222 | 125 |
| 315 | 3300005364 | Ga0070673_101822636 | Ga0070673_1018226361 | 125 |
| 316 | 3300005365 | Ga0070688_100018368 | Ga0070688_1000183683 | 125 |
| 317 | 3300005366 | Ga0070659_100645682 | Ga0070659_1006456822 | 125 |
| 318 | 3300005367 | Ga0070667_100191068 | Ga0070667_1001910681 | 125 |
| 319 | 3300005367 | Ga0070667_100661505 | Ga0070667_1006615052 | 125 |
| 320 | 3300005434 | Ga0070709_10101459 | Ga0070709_101014592 | 125 |
| 321 | 3300005435 | Ga0070714_100037927 | Ga0070714_1000379272 | 125 |
| 322 | 3300005436 | Ga0070713_100557502 | Ga0070713_1005575022 | 125 |
| 323 | 3300005437 | Ga0070710_10017455 | Ga0070710_100174552 | 125 |
| 324 | 3300005438 | Ga0070701_10019365 | Ga0070701_100193654 | 125 |
| 325 | 3300005439 | Ga0070711_100148595 | Ga0070711_1001485951 | 125 |
| 326 | 3300005440 | Ga0070705_100065309 | Ga0070705_1000653092 | 125 |
| 327 | 3300005440 | Ga0070705_100425298 | Ga0070705_1004252982 | 125 |
| 328 | 3300005441 | Ga0070700_100002550 | Ga0070700_1000025506 | 125 |
| 329 | 3300005444 | Ga0070694_100037883 | Ga0070694_1000378832 | 125 |
| 330 | 3300005455 | Ga0070663_100784630 | Ga0070663_1007846301 | 125 |
| 331 | 3300005457 | Ga0070662_100032461 | Ga0070662_1000324614 | 125 |
| 332 | 3300005458 | Ga0070681_10070703 | Ga0070681_100707035 | 125 |
| 333 | 3300005459 | Ga0068867_100007894 | Ga0068867_1000078948 | 125 |
| 334 | 3300005466 | Ga0070685_10021579 | Ga0070685_100215795 | 125 |
| 335 | 3300005466 | Ga0070685_10358398 | Ga0070685_103583981 | 125 |
| 336 | 3300005466 | Ga0070685_10385932 | Ga0070685_103859322 | 125 |
| 337 | 3300005468 | Ga0070707_101846261 | Ga0070707_1018462611 | 125 |
| 338 | 3300005530 | Ga0070679_100004235 | Ga0070679_10000423514 | 125 |
| 339 | 3300005530 | Ga0070679_100188629 | Ga0070679_1001886293 | 125 |
| 340 | 3300005535 | Ga0070684_100115190 | Ga0070684_1001151903 | 125 |
| 341 | 3300005535 | Ga0070684_100157933 | Ga0070684_1001579331 | 125 |
| 342 | 3300005539 | Ga0068853_100185938 | Ga0068853_1001859382 | 125 |
| 343 | 3300005544 | Ga0070686_100081212 | Ga0070686_1000812123 | 125 |
| 344 | 3300005544 | Ga0070686_100148529 | Ga0070686_1001485291 | 125 |
| 345 | 3300005547 | Ga0070693_101505718 | Ga0070693_1015057181 | 125 |
| 346 | 3300005548 | Ga0070665_100011455 | Ga0070665_1000114553 | 125 |
| 347 | 3300005548 | Ga0070665_101282270 | Ga0070665_1012822702 | 125 |
| 348 | 3300005563 | Ga0068855_100816784 | Ga0068855_1008167842 | 125 |
| 349 | 3300005563 | Ga0068855_100840382 | Ga0068855_1008403822 | 125 |
| 350 | 3300005615 | Ga0070702_100084202 | Ga0070702_1000842021 | 125 |
| 351 | 3300005615 | Ga0070702_101354951 | Ga0070702_1013549512 | 125 |
| 352 | 3300005616 | Ga0068852_100631811 | Ga0068852_1006318111 | 125 |
| 353 | 3300005618 | Ga0068864_102652601 | Ga0068864_1026526011 | 125 |
| 354 | 3300005718 | Ga0068866_10018223 | Ga0068866_100182233 | 125 |
| 355 | 3300005842 | Ga0068858_100043685 | Ga0068858_1000436851 | 125 |
| 356 | 3300005842 | Ga0068858_100614717 | Ga0068858_1006147172 | 125 |
| 357 | 3300005843 | Ga0068860_100087028 | Ga0068860_1000870283 | 125 |
| 358 | 3300005844 | Ga0068862_100027130 | Ga0068862_1000271307 | 125 |
| 359 | 3300005937 | Ga0081455_10373793 | Ga0081455_103737933 | 125 |
| 360 | 3300006358 | Ga0068871_100637441 | Ga0068871_1006374412 | 125 |
| 361 | 3300006844 | Ga0075428_100343224 | Ga0075428_1003432242 | 125 |
| 362 | 3300006871 | Ga0075434_102664736 | Ga0075434_1026647361 | 125 |
| 363 | 3300006881 | Ga0068865_100002478 | Ga0068865_10000247810 | 125 |
| 364 | 3300009148 | Ga0105243_10495624 | Ga0105243_104956243 | 125 |
| 365 | 3300009176 | Ga0105242_10591994 | Ga0105242_105919942 | 125 |
| 366 | 3300009177 | Ga0105248_10699752 | Ga0105248_106997521 | 125 |
| 367 | 3300009551 | Ga0105238_10004950 | Ga0105238_100049506 | 125 |
| 368 | 3300009553 | Ga0105249_10410380 | Ga0105249_104103802 | 125 |
| 369 | 3300010375 | Ga0105239_10045590 | Ga0105239_100455902 | 125 |
| 370 | 3300013297 | Ga0157378_10119939 | Ga0157378_101199391 | 125 |
| 371 | 3300013297 | Ga0157378_10312361 | Ga0157378_103123613 | 125 |
| 372 | 3300013297 | Ga0157378_11655001 | Ga0157378_116550012 | 125 |
| 373 | 3300014326 | Ga0157380_10455745 | Ga0157380_104557452 | 125 |
| 374 | 3300014745 | Ga0157377_10454452 | Ga0157377_104544522 | 125 |
| 375 | 3300014968 | Ga0157379_10875605 | Ga0157379_108756051 | 125 |
| 376 | 3300020070 | Ga0206356_10649809 | Ga0206356_106498092 | 125 |
| 377 | 3300025315 | Ga0207697_10021953 | Ga0207697_100219532 | 125 |
| 378 | 3300025898 | Ga0207692_10013102 | Ga0207692_100131024 | 125 |
| 379 | 3300025898 | Ga0207692_10944029 | Ga0207692_109440291 | 125 |
| 380 | 3300025899 | Ga0207642_10015467 | Ga0207642_100154674 | 125 |
| 381 | 3300025901 | Ga0207688_10390850 | Ga0207688_103908502 | 125 |
| 382 | 3300025903 | Ga0207680_10331156 | Ga0207680_103311562 | 125 |
| 383 | 3300025903 | Ga0207680_10499703 | Ga0207680_104997032 | 125 |
| 384 | 3300025906 | Ga0207699_10075790 | Ga0207699_100757903 | 125 |
| 385 | 3300025907 | Ga0207645_10004684 | Ga0207645_100046844 | 125 |
| 386 | 3300025909 | Ga0207705_10010661 | Ga0207705_100106617 | 125 |
| 387 | 3300025912 | Ga0207707_10080641 | Ga0207707_100806412 | 125 |
| 388 | 3300025912 | Ga0207707_10167405 | Ga0207707_101674053 | 125 |
| 389 | 3300025917 | Ga0207660_10108734 | Ga0207660_101087342 | 125 |
| 390 | 3300025918 | Ga0207662_10030660 | Ga0207662_100306604 | 125 |
| 391 | 3300025918 | Ga0207662_10030935 | Ga0207662_100309352 | 125 |
| 392 | 3300025919 | Ga0207657_10270251 | Ga0207657_102702513 | 125 |
| 393 | 3300025920 | Ga0207649_11580619 | Ga0207649_115806191 | 125 |
| 394 | 3300025921 | Ga0207652_10000360 | Ga0207652_1000036025 | 125 |
| 395 | 3300025921 | Ga0207652_10001885 | Ga0207652_100018857 | 125 |
| 396 | 3300025921 | Ga0207652_10264839 | Ga0207652_102648391 | 125 |
| 397 | 3300025922 | Ga0207646_11553617 | Ga0207646_115536171 | 125 |
| 398 | 3300025923 | Ga0207681_10002930 | Ga0207681_100029304 | 125 |
| 399 | 3300025924 | Ga0207694_10066993 | Ga0207694_100669932 | 125 |
| 400 | 3300025925 | Ga0207650_10035631 | Ga0207650_100356314 | 125 |
| 401 | 3300025931 | Ga0207644_10103741 | Ga0207644_101037412 | 125 |
| 402 | 3300025931 | Ga0207644_11130521 | Ga0207644_111305212 | 125 |
| 403 | 3300025933 | Ga0207706_10038448 | Ga0207706_100384483 | 125 |
| 404 | 3300025935 | Ga0207709_10129544 | Ga0207709_101295443 | 125 |
| 405 | 3300025936 | Ga0207670_10003609 | Ga0207670_100036097 | 125 |
| 406 | 3300025936 | Ga0207670_10035113 | Ga0207670_100351132 | 125 |
| 407 | 3300025937 | Ga0207669_10038520 | Ga0207669_100385202 | 125 |
| 408 | 3300025937 | Ga0207669_10171750 | Ga0207669_101717502 | 125 |
| 409 | 3300025937 | Ga0207669_10353674 | Ga0207669_103536742 | 125 |
| 410 | 3300025938 | Ga0207704_10001642 | Ga0207704_100016429 | 125 |
| 411 | 3300025940 | Ga0207691_10257872 | Ga0207691_102578722 | 125 |
| 412 | 3300025941 | Ga0207711_10471689 | Ga0207711_104716893 | 125 |
| 413 | 3300025942 | Ga0207689_10051614 | Ga0207689_100516141 | 125 |
| 414 | 3300025944 | Ga0207661_10176867 | Ga0207661_101768673 | 125 |
| 415 | 3300025944 | Ga0207661_10294990 | Ga0207661_102949903 | 125 |
| 416 | 3300025949 | Ga0207667_10195523 | Ga0207667_101955233 | 125 |
| 417 | 3300025949 | Ga0207667_10273233 | Ga0207667_102732332 | 125 |
| 418 | 3300025960 | Ga0207651_10000484 | Ga0207651_1000048415 | 125 |
| 419 | 3300025960 | Ga0207651_10205110 | Ga0207651_102051102 | 125 |
| 420 | 3300025961 | Ga0207712_10342196 | Ga0207712_103421963 | 125 |
| 421 | 3300025972 | Ga0207668_10042568 | Ga0207668_100425682 | 125 |
| 422 | 3300025981 | Ga0207640_11634366 | Ga0207640_116343662 | 125 |
| 423 | 3300025986 | Ga0207658_11743986 | Ga0207658_117439861 | 125 |
| 424 | 3300026023 | Ga0207677_10211661 | Ga0207677_102116613 | 125 |
| 425 | 3300026023 | Ga0207677_10214821 | Ga0207677_102148212 | 125 |
| 426 | 3300026035 | Ga0207703_10115620 | Ga0207703_101156202 | 125 |
| 427 | 3300026075 | Ga0207708_10004142 | Ga0207708_100041422 | 125 |
| 428 | 3300026088 | Ga0207641_10265597 | Ga0207641_102655971 | 125 |
| 429 | 3300026095 | Ga0207676_11045386 | Ga0207676_110453861 | 125 |
| 430 | 3300026095 | Ga0207676_11106155 | Ga0207676_111061552 | 125 |
| 431 | 3300026142 | Ga0207698_10604720 | Ga0207698_106047201 | 125 |
| 432 | 3300026142 | Ga0207698_12601875 | Ga0207698_126018751 | 125 |
| 433 | 3300027617 | Ga0210002_1040030 | Ga0210002_10400301 | 125 |
| 434 | 3300028379 | Ga0268266_10001935 | Ga0268266_100019353 | 125 |
| 435 | 3300028381 | Ga0268264_10150138 | Ga0268264_101501382 | 125 |
| 436 | 3300028558 | Ga0265326_10187299 | Ga0265326_101872991 | 125 |
| 437 | 3300028563 | Ga0265319_1057625 | Ga0265319_10576252 | 125 |
| 438 | 3300028563 | Ga0265319_1140138 | Ga0265319_11401382 | 125 |
| 439 | 3300028666 | Ga0265336_10147315 | Ga0265336_101473151 | 125 |
| 440 | 3300028800 | Ga0265338_10009440 | Ga0265338_100094403 | 125 |
| 441 | 3300028800 | Ga0265338_10086106 | Ga0265338_100861063 | 125 |
| 442 | 3300028800 | Ga0265338_10118251 | Ga0265338_101182511 | 125 |
| 443 | 3300031239 | Ga0265328_10000547 | Ga0265328_100005478 | 125 |
| 444 | 3300031240 | Ga0265320_10060216 | Ga0265320_100602163 | 125 |
| 445 | 3300031242 | Ga0265329_10096248 | Ga0265329_100962481 | 125 |
| 446 | 3300031249 | Ga0265339_10005010 | Ga0265339_1000501010 | 125 |
| 447 | 3300031249 | Ga0265339_10006602 | Ga0265339_100066027 | 125 |
| 448 | 3300031548 | Ga0307408_101019649 | Ga0307408_1010196491 | 125 |
| 449 | 3300031595 | Ga0265313_10007288 | Ga0265313_100072888 | 125 |
| 450 | 3300031595 | Ga0265313_10040160 | Ga0265313_100401602 | 125 |
| 451 | 3300031711 | Ga0265314_10009101 | Ga0265314_100091014 | 125 |
| 452 | 3300031711 | Ga0265314_10069043 | Ga0265314_100690431 | 125 |
| 453 | 3300031712 | Ga0265342_10000516 | Ga0265342_100005161 | 125 |
| 454 | 3300031712 | Ga0265342_10001028 | Ga0265342_100010281 | 125 |
| 455 | 3300031901 | Ga0307406_10016753 | Ga0307406_100167535 | 125 |
| 456 | 3300035083 | Ga0373926_0430681 | Ga0373926_0430681_132_509 | 125 |
| 457 | 3300035111 | Ga0373923_0109712 | Ga0373923_0109712_761_1159 | 125 |
| 458 | 3300035111 | Ga0373923_0129015 | Ga0373923_0129015_85_462 | 125 |
| 459 | 3300035113 | Ga0373936_0421144 | Ga0373936_0421144_130_507 | 125 |
| 460 | 3300035116 | Ga0373945_0332543 | Ga0373945_0332543_89_466 | 125 |
| 461 | 3300035117 | Ga0373953_0199919 | Ga0373953_0199919_470_847 | 125 |
| 462 | 3300035118 | Ga0373954_0030691 | Ga0373954_0030691_545_922 | 125 |
| 463 | 3300035119 | Ga0373956_0006448 | Ga0373956_0006448_4286_4663 | 125 |
| 464 | 3300035119 | Ga0373956_0027559 | Ga0373956_0027559_178_555 | 125 |
| 465 | 3300035120 | Ga0373957_0072287 | Ga0373957_0072287_181_558 | 125 |
| 466 | 3300035120 | Ga0373957_0093067 | Ga0373957_0093067_206_583 | 125 |
| 467 | 3300035170 | Ga0373943_0052723 | Ga0373943_0052723_1008_1385 | 125 |
| 468 | 3300035170 | Ga0373943_0349159 | Ga0373943_0349159_294_692 | 125 |
| 469 | 3300035172 | Ga0373955_0024942 | Ga0373955_0024942_891_1268 | 125 |
| 470 | 3300035172 | Ga0373955_0335771 | Ga0373955_0335771_454_852 | 125 |
| 471 | 3300035410 | Ga0373924_0486760 | Ga0373924_0486760_60_437 | 125 |
| 472 | 3300035692 | Ga0373935_0752445 | Ga0373935_0752445_268_645 | 125 |
| 473 | 3300035692 | Ga0373935_1172319 | Ga0373935_1172319_156_533 | 125 |
| 474 | 3300035695 | Ga0373927_0028289 | Ga0373927_0028289_912_1289 | 125 |
| 475 | 3300035724 | Ga0373933_0007290 | Ga0373933_0007290_4455_4832 | 125 |
| 476 | 3300035725 | Ga0373947_0119527 | Ga0373947_0119527_470_847 | 125 |
| 477 | 3300036401 | Ga0373937_0006468 | Ga0373937_0006468_5496_5873 | 125 |
| 478 | 3300036401 | Ga0373937_0074547 | Ga0373937_0074547_2030_2428 | 125 |
| 479 | 3300037068 | Ga0373925_0311518 | Ga0373925_0311518_207_584 | 125 |
| 480 | 3300039453 | Ga0436362_1172253 | Ga0436362_1172253_183_572 | 125 |
| 481 | 3300041494 | Ga0451837_1678537 | Ga0451837_1678537_333_719 | 125 |
| 482 | 3300041512 | Ga0451853_0601611 | Ga0451853_0601611_385_762 | 125 |
| 483 | 3300041512 | Ga0451853_3842606 | Ga0451853_3842606_66_452 | 125 |
| 484 | 3300046462 | Ga0495651_0876107 | Ga0495651_0876107_57_434 | 125 |
| 485 | 3300046557 | Ga0495622_0105999 | Ga0495622_0105999_570_947 | 125 |
| 486 | 3300046559 | Ga0495667_0763891 | Ga0495667_0763891_174_551 | 125 |
| 487 | 3300046616 | Ga0495668_0738243 | Ga0495668_0738243_26_412 | 125 |
| 488 | 3300046663 | Ga0495635_0598396 | Ga0495635_0598396_247_624 | 125 |
| 489 | 3300046675 | Ga0495657_0417208 | Ga0495657_0417208_322_699 | 125 |
| 490 | 3300046683 | Ga0495658_0761998 | Ga0495658_0761998_86_463 | 125 |
| 491 | 3300047317 | Ga0495604_0452179 | Ga0495604_0452179_366_743 | 125 |
| 492 | 3300047322 | Ga0495680_0242390 | Ga0495680_0242390_807_1184 | 125 |
| 493 | 3300047472 | Ga0495686_0020684 | Ga0495686_0020684_3275_3670 | 125 |
| 494 | 3300048903 | Ga0496100_0671070 | Ga0496100_0671070_261_638 | 125 |
| 495 | 3300048907 | Ga0496104_0335929 | Ga0496104_0335929_339_722 | 125 |
| 496 | 3300048911 | Ga0496108_0104858 | Ga0496108_0104858_1482_1859 | 125 |
| 497 | 3300048911 | Ga0496108_0548208 | Ga0496108_0548208_468_893 | 125 |
| 498 | 3300048913 | Ga0496110_0326720 | Ga0496110_0326720_813_1190 | 125 |
| 499 | 3300048915 | Ga0496112_0027700 | Ga0496112_0027700_2644_3021 | 125 |
| 500 | 3300048915 | Ga0496112_1371944 | Ga0496112_1371944_74_451 | 125 |
| 501 | 3300048916 | Ga0496113_0880416 | Ga0496113_0880416_206_583 | 125 |
| 502 | 3300048918 | Ga0496115_0101075 | Ga0496115_0101075_1184_1609 | 125 |
| 503 | 3300049583 | Ga0501067_0004630 | Ga0501067_0004630_2864_3241 | 125 |
| 504 | 3300049590 | Ga0501074_0115472 | Ga0501074_0115472_1286_1672 | 125 |
| 505 | 3300053077 | Ga0495601_0204531 | Ga0495601_0204531_13_390 | 125 |
| 506 | 3300053077 | Ga0495601_0325757 | Ga0495601_0325757_37_477 | 125 |
| 507 | 3300053133 | Ga0500655_029481 | Ga0500655_029481_492_869 | 125 |
| 508 | 3300053139 | Ga0500568_0004574 | Ga0500568_0004574_6733_7155 | 125 |
| 509 | 3300059645 | Ga0587076_118675 | Ga0587076_118675_126_557 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.9011 | 6 | 119 |
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.833 | 6 | 119 |
| 7khe-assembly1.cif.gz_M | escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp | 0.773 | 6 | 125 |
| 4ijj-assembly1.cif.gz_A | structure of transcription factor dksa2 from pseudomonas aeruginosa | 0.7547 | 8 | 122 |
| 4ijj-assembly3.cif.gz_C | structure of transcription factor dksa2 from pseudomonas aeruginosa | 0.745 | 1 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.7547 | 8 | 122 | 1.20.120.910 |
| 1tjlB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.7175 | 6 | 125 | 1.20.120.910 |
| 1tjlB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.6823 | 6 | 125 | 1.20.120.910 |
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.6822 | 8 | 122 | 1.20.120.910 |
| 2kq9A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.6651 | 4 | 116 | 1.20.120.910 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V4X305-F1-model_v4 | General stress protein 16O | 0.8415 | 6 | 121 |
GO:0008270
|
| AF-A0A1F5V074-F1-model_v4 | Zinc finger DksA/TraR C4-type domain-containing protein | 0.8401 | 2 | 116 |
GO:0008270
|
| AF-A0A1V4X305-F1-model_v4 | General stress protein 16O | 0.8279 | 6 | 121 |
GO:0008270
|
| AF-A0A7C6AL52-F1-model_v4 | TraR/DksA family transcriptional regulator | 0.8274 | 6 | 124 |
GO:0008270
|
| AF-A0A2M7H953-F1-model_v4 | RNA polymerase-binding protein DksA | 0.8246 | 4 | 124 |
GO:0005737
GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar