F456989

General Info

Members Datasets Scaffolds Average Seq Length
509 289 509 123

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_11169739|Ga0207705_111697391
Length 119
Sequence VEASEVQFFKDLLLKQRAEILNKTLALRNEAAIEATGQGDEGDLAVSEQSLAMTLRLQERDAHHLQKIDRTLGKIEEGSFGLCEQCEEPLQKNRLIARPVANLCVACKEEQESRERVFA

Samples

Sample ID Description Type Environment
1 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
216 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 4.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.73
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006763J43179_107734 3300002870 Unclassified 500
2 Ga0006759J45824_1006064 3300003163 Unclassified 834
3 Ga0006758J48902_1019475 3300003300 Unclassified 559
4 rootH1_10077254 3300003323 Bacteria 4251
5 rootH1_10288592 3300003323 Bacteria 1631
6 Ga0032354_1031084 3300003693 Unclassified 851
7 Ga0058858_1379739 3300004785 Bacteria 603
8 Ga0058859_11551521 3300004798 Bacteria 544
9 Ga0058860_11846079 3300004801 Unclassified 724
10 Ga0058860_12057947 3300004801 Bacteria 549
11 Ga0058860_12102671 3300004801 Bacteria 610
12 Ga0058862_10075690 3300004803 Bacteria 1176
13 Ga0065715_10577474 3300005293 Unclassified 722
14 Ga0070658_10044642 3300005327 Bacteria 3582
15 Ga0070658_11121144 3300005327 Bacteria 684
16 Ga0070676_10010085 3300005328 Bacteria 5117
17 Ga0070683_100227111 3300005329 Bacteria 1774
18 Ga0070683_100291078 3300005329 Bacteria 1553
19 Ga0070683_101126882 3300005329 Bacteria 754
20 Ga0070690_100001442 3300005330 Bacteria 12422
21 Ga0070690_100003920 3300005330 Bacteria 8208
22 Ga0070670_100522217 3300005331 Bacteria 1057
23 Ga0068869_101225414 3300005334 Bacteria 660
24 Ga0070666_10087814 3300005335 Bacteria 2132
25 Ga0070666_10135707 3300005335 Bacteria 1712
26 Ga0070666_11350574 3300005335 Bacteria 532
27 Ga0070680_100040653 3300005336 Unclassified 3767
28 Ga0070680_100385429 3300005336 Unclassified 1194
29 Ga0068868_100213350 3300005338 Unclassified 1614
30 Ga0068868_100240580 3300005338 Bacteria 1521
31 Ga0070660_100334669 3300005339 Archaea 1245
32 Ga0070660_100840306 3300005339 Bacteria 773
33 Ga0070689_100003803 3300005340 Bacteria 10112
34 Ga0070689_100067538 3300005340 Bacteria 2787
35 Ga0070687_100029373 3300005343 Bacteria 2677
36 Ga0070661_100776923 3300005344 Unclassified 785
37 Ga0070692_10009790 3300005345 Bacteria 4338
38 Ga0070692_10752199 3300005345 Unclassified 661
39 Ga0070692_11240206 3300005345 Bacteria 532
40 Ga0070668_100552362 3300005347 Bacteria 1002
41 Ga0070668_102018855 3300005347 Bacteria 532
42 Ga0070675_101169073 3300005354 Bacteria 708
43 Ga0070671_100180443 3300005355 Bacteria 1787
44 Ga0070674_101822217 3300005356 Bacteria 552
45 Ga0070673_100100750 3300005364 Unclassified 2378
46 Ga0070673_100490822 3300005364 Bacteria 1110
47 Ga0070673_101822636 3300005364 Unclassified 576
48 Ga0070688_100018368 3300005365 Bacteria 4034
49 Ga0070659_100645682 3300005366 Bacteria 912
50 Ga0070667_100191068 3300005367 Bacteria 1814
51 Ga0070667_100661505 3300005367 Bacteria 965
52 Ga0070709_10101459 3300005434 Bacteria 1918
53 Ga0070714_100037927 3300005435 Bacteria 4052
54 Ga0070713_100557502 3300005436 Bacteria 1085
55 Ga0070710_10017455 3300005437 Bacteria 3673
56 Ga0070701_10019365 3300005438 Bacteria 3214
57 Ga0070711_100148595 3300005439 Bacteria 1765
58 Ga0070705_100065309 3300005440 Bacteria 2178
59 Ga0070705_100425298 3300005440 Bacteria 990
60 Ga0070700_100002550 3300005441 Bacteria 9294
61 Ga0070694_100037883 3300005444 Bacteria 3200
62 Ga0070694_100243565 3300005444 Bacteria 1357
63 Ga0070708_101450074 3300005445 Bacteria 640
64 Ga0070663_100784630 3300005455 Bacteria 816
65 Ga0070678_100011023 3300005456 Bacteria 5553
66 Ga0070662_100032461 3300005457 Bacteria 3670
67 Ga0070681_10070703 3300005458 Unclassified 3455
68 Ga0070681_11716214 3300005458 Bacteria 554
69 Ga0068867_100007894 3300005459 Bacteria 7522
70 Ga0068867_100058006 3300005459 Bacteria 2868
71 Ga0068867_101476219 3300005459 Bacteria 632
72 Ga0070685_10021579 3300005466 Bacteria 3501
73 Ga0070685_10358398 3300005466 Bacteria 999
74 Ga0070685_10385932 3300005466 Bacteria 966
75 Ga0070706_100039098 3300005467 Bacteria 4380
76 Ga0070707_100038749 3300005468 Bacteria 4553
77 Ga0070707_100281829 3300005468 Bacteria 1615
78 Ga0070707_101846261 3300005468 Unclassified 572
79 Ga0070679_100004235 3300005530 Bacteria 13240
80 Ga0070679_100188629 3300005530 Unclassified 2031
81 Ga0070684_100081070 3300005535 Bacteria 2871
82 Ga0070684_100115190 3300005535 Bacteria 2414
83 Ga0070684_100157933 3300005535 Bacteria 2056
84 Ga0070684_100377089 3300005535 Bacteria 1306
85 Ga0068853_100185938 3300005539 Bacteria 1886
86 Ga0070686_100081212 3300005544 Bacteria 2147
87 Ga0070686_100148529 3300005544 Bacteria 1639
88 Ga0070693_100176087 3300005547 Bacteria 1374
89 Ga0070693_101505718 3300005547 Bacteria 526
90 Ga0070665_100011455 3300005548 Bacteria 8966
91 Ga0070665_101282270 3300005548 Unclassified 743
92 Ga0068855_100715795 3300005563 Bacteria 1070
93 Ga0068855_100816784 3300005563 Bacteria 990
94 Ga0068855_100840382 3300005563 Unclassified 974
95 Ga0068855_101151804 3300005563 Bacteria 808
96 Ga0068856_100327104 3300005614 Bacteria 1550
97 Ga0068856_100497442 3300005614 Bacteria 1240
98 Ga0068856_100892951 3300005614 Bacteria 907
99 Ga0070702_100084202 3300005615 Bacteria 1912
100 Ga0070702_101354951 3300005615 Unclassified 580
101 Ga0068852_100438475 3300005616 Bacteria 1291
102 Ga0068852_100631811 3300005616 Bacteria 1077
103 Ga0068864_102652601 3300005618 Bacteria 507
104 Ga0068866_10018223 3300005718 Bacteria 3171
105 Ga0068870_11400583 3300005840 Bacteria 512
106 Ga0068858_100043685 3300005842 Bacteria 4155
107 Ga0068858_100614717 3300005842 Bacteria 1055
108 Ga0068858_101391736 3300005842 Bacteria 691
109 Ga0068860_100087028 3300005843 Bacteria 2974
110 Ga0068862_100027130 3300005844 Bacteria 4819
111 Ga0081455_10059695 3300005937 Bacteria 3219
112 Ga0081455_10086608 3300005937 Unclassified 2551
113 Ga0081455_10373793 3300005937 Bacteria 998
114 Ga0081539_10158146 3300005985 Bacteria 1083
115 Ga0075366_10093602 3300006195 Bacteria 1801
116 Ga0075366_10249370 3300006195 Unclassified 1083
117 Ga0097621_100025326 3300006237 Bacteria 4640
118 Ga0097621_101112139 3300006237 Bacteria 742
119 Ga0068871_100354553 3300006358 Bacteria 1298
120 Ga0068871_100637441 3300006358 Unclassified 972
121 Ga0075428_100220688 3300006844 Bacteria 2047
122 Ga0075428_100343224 3300006844 Unclassified 1603
123 Ga0075428_102255542 3300006844 Bacteria 561
124 Ga0075431_100208346 3300006847 Bacteria 1998
125 Ga0075433_11727421 3300006852 Bacteria 539
126 Ga0075434_102664736 3300006871 Unclassified 500
127 Ga0068865_100002478 3300006881 Bacteria 10926
128 Ga0068865_100846249 3300006881 Bacteria 792
129 Ga0097620_100570252 3300006931 Bacteria 1226
130 Ga0111539_11087121 3300009094 Bacteria 929
131 Ga0111539_13307297 3300009094 Bacteria 519
132 Ga0105245_10014640 3300009098 Bacteria 6831
133 Ga0105247_10016328 3300009101 Bacteria 4448
134 Ga0114129_11243017 3300009147 Bacteria 926
135 Ga0105243_10495624 3300009148 Bacteria 1156
136 Ga0105242_10244171 3300009176 Bacteria 1615
137 Ga0105242_10261693 3300009176 Bacteria 1563
138 Ga0105242_10591994 3300009176 Bacteria 1070
139 Ga0105242_12106602 3300009176 Bacteria 608
140 Ga0105248_10699752 3300009177 Bacteria 1143
141 Ga0105238_10004950 3300009551 Bacteria 13177
142 Ga0105249_10410380 3300009553 Bacteria 1386
143 Ga0105249_11260238 3300009553 Bacteria 811
144 Ga0105239_10045590 3300010375 Bacteria 4805
145 Ga0105239_10951505 3300010375 Bacteria 987
146 Ga0105239_12550292 3300010375 Bacteria 596
147 Ga0105239_13632833 3300010375 Bacteria 501
148 Ga0105246_11401716 3300011119 Bacteria 652
149 Ga0157369_11109805 3300013105 Bacteria 808
150 Ga0157374_10311366 3300013296 Bacteria 1559
151 Ga0157374_10468081 3300013296 Bacteria 1263
152 Ga0157374_10480169 3300013296 Bacteria 1246
153 Ga0157374_11140605 3300013296 Bacteria 800
154 Ga0157378_10119939 3300013297 Bacteria 2423
155 Ga0157378_10312361 3300013297 Bacteria 1525
156 Ga0157378_11655001 3300013297 Bacteria 686
157 Ga0157372_10644332 3300013307 Bacteria 1234
158 Ga0157372_13030803 3300013307 Bacteria 537
159 Ga0163163_12038350 3300014325 Bacteria 633
160 Ga0163163_12277819 3300014325 Bacteria 601
161 Ga0163163_12616284 3300014325 Bacteria 562
162 Ga0157380_10455745 3300014326 Bacteria 1230
163 Ga0157380_11043242 3300014326 Bacteria 853
164 Ga0157377_10454452 3300014745 Bacteria 885
165 Ga0157379_10875605 3300014968 Bacteria 851
166 Ga0157376_10118980 3300014969 Bacteria 2338
167 Ga0157376_10556063 3300014969 Bacteria 1136
168 Ga0157376_10951898 3300014969 Bacteria 879
169 Ga0157376_11058619 3300014969 Bacteria 836
170 Ga0163161_10878933 3300017792 Unclassified 758
171 Ga0206356_10649809 3300020070 Bacteria 1751
172 Ga0206349_1888834 3300020075 Unclassified 573
173 Ga0207697_10021953 3300025315 Bacteria 2615
174 Ga0207692_10013102 3300025898 Bacteria 3588
175 Ga0207692_10944029 3300025898 Unclassified 568
176 Ga0207642_10015467 3300025899 Bacteria 2844
177 Ga0207710_10008087 3300025900 Bacteria 4442
178 Ga0207688_10390850 3300025901 Bacteria 861
179 Ga0207680_10331156 3300025903 Bacteria 1066
180 Ga0207680_10499703 3300025903 Unclassified 866
181 Ga0207680_10556681 3300025903 Bacteria 819
182 Ga0207699_10075790 3300025906 Bacteria 2070
183 Ga0207645_10004684 3300025907 Bacteria 10067
184 Ga0207705_10010661 3300025909 Bacteria 6674
185 Ga0207705_10648561 3300025909 Bacteria 821
186 Ga0207705_11169739 3300025909 Unclassified 591
187 Ga0207684_11105136 3300025910 Bacteria 660
188 Ga0207707_10080641 3300025912 Bacteria 2842
189 Ga0207707_10167405 3300025912 Bacteria 1921
190 Ga0207695_10327237 3300025913 Bacteria 1421
191 Ga0207660_10108734 3300025917 Unclassified 2083
192 Ga0207662_10030660 3300025918 Unclassified 3122
193 Ga0207662_10030935 3300025918 Bacteria 3110
194 Ga0207657_10270251 3300025919 Unclassified 1351
195 Ga0207649_11580619 3300025920 Unclassified 519
196 Ga0207652_10000360 3300025921 Bacteria 47230
197 Ga0207652_10001885 3300025921 Bacteria 18172
198 Ga0207652_10264839 3300025921 Bacteria 1550
199 Ga0207646_10039380 3300025922 Bacteria 4255
200 Ga0207646_11300229 3300025922 Bacteria 635
201 Ga0207646_11553617 3300025922 Unclassified 572
202 Ga0207681_10002930 3300025923 Bacteria 10773
203 Ga0207694_10066993 3300025924 Bacteria 2802
204 Ga0207650_10035631 3300025925 Bacteria 3616
205 Ga0207659_10681264 3300025926 Bacteria 880
206 Ga0207687_10101637 3300025927 Bacteria 2116
207 Ga0207644_10103741 3300025931 Bacteria 2140
208 Ga0207644_11130521 3300025931 Unclassified 658
209 Ga0207690_10630654 3300025932 Bacteria 877
210 Ga0207706_10038448 3300025933 Bacteria 4245
211 Ga0207686_10294824 3300025934 Bacteria 1202
212 Ga0207686_11428406 3300025934 Bacteria 570
213 Ga0207709_10129544 3300025935 Bacteria 1717
214 Ga0207670_10003609 3300025936 Bacteria 8208
215 Ga0207670_10014878 3300025936 Bacteria 4633
216 Ga0207670_10035113 3300025936 Bacteria 3248
217 Ga0207669_10038520 3300025937 Bacteria 2753
218 Ga0207669_10171750 3300025937 Bacteria 1544
219 Ga0207669_10353674 3300025937 Bacteria 1136
220 Ga0207704_10001642 3300025938 Bacteria 10037
221 Ga0207691_10257872 3300025940 Bacteria 1503
222 Ga0207711_10471689 3300025941 Bacteria 1169
223 Ga0207711_10490680 3300025941 Bacteria 1144
224 Ga0207689_10051614 3300025942 Bacteria 3390
225 Ga0207661_10176867 3300025944 Bacteria 1861
226 Ga0207661_10294990 3300025944 Unclassified 1452
227 Ga0207661_10486092 3300025944 Bacteria 1127
228 Ga0207667_10195523 3300025949 Bacteria 2075
229 Ga0207667_10273233 3300025949 Unclassified 1727
230 Ga0207667_11571339 3300025949 Bacteria 627
231 Ga0207651_10000484 3300025960 Bacteria 16760
232 Ga0207651_10205110 3300025960 Bacteria 1583
233 Ga0207712_10342196 3300025961 Bacteria 1241
234 Ga0207712_11858410 3300025961 Bacteria 539
235 Ga0207668_10042568 3300025972 Bacteria 3076
236 Ga0207668_10252978 3300025972 Bacteria 1432
237 Ga0207640_11634366 3300025981 Unclassified 581
238 Ga0207658_11743986 3300025986 Unclassified 568
239 Ga0207677_10211661 3300026023 Bacteria 1549
240 Ga0207677_10214821 3300026023 Bacteria 1539
241 Ga0207703_10115620 3300026035 Bacteria 2296
242 Ga0207703_12419472 3300026035 Bacteria 501
243 Ga0207678_11020010 3300026067 Unclassified 732
244 Ga0207708_10004142 3300026075 Bacteria 10667
245 Ga0207708_10833998 3300026075 Bacteria 795
246 Ga0207708_11585125 3300026075 Bacteria 575
247 Ga0207702_10187036 3300026078 Bacteria 1911
248 Ga0207702_10454185 3300026078 Bacteria 1244
249 Ga0207641_10265597 3300026088 Bacteria 1608
250 Ga0207648_10028413 3300026089 Bacteria 4959
251 Ga0207648_11810319 3300026089 Bacteria 572
252 Ga0207676_11045386 3300026095 Unclassified 806
253 Ga0207676_11106155 3300026095 Bacteria 783
254 Ga0207674_10833672 3300026116 Bacteria 889
255 Ga0207683_10452113 3300026121 Bacteria 1184
256 Ga0207698_10604720 3300026142 Bacteria 1081
257 Ga0207698_11751924 3300026142 Bacteria 636
258 Ga0207698_12601875 3300026142 Unclassified 515
259 Ga0210002_1040030 3300027617 Unclassified 795
260 Ga0268266_10001935 3300028379 Bacteria 23297
261 Ga0268265_10947935 3300028380 Bacteria 848
262 Ga0268264_10150138 3300028381 Bacteria 2088
263 Ga0265326_10187299 3300028558 Unclassified 593
264 Ga0265319_1057625 3300028563 Unclassified 1267
265 Ga0265319_1140138 3300028563 Unclassified 750
266 Ga0265334_10031817 3300028573 Bacteria 2106
267 Ga0265336_10147315 3300028666 Unclassified 700
268 Ga0307515_10836213 3300028794 Bacteria 546
269 Ga0265338_10009440 3300028800 Bacteria 11627
270 Ga0265338_10086106 3300028800 Bacteria 2617
271 Ga0265338_10118251 3300028800 Bacteria 2118
272 Ga0265338_10467473 3300028800 Bacteria 891
273 Ga0307511_10003700 3300030521 Bacteria 15635
274 Ga0265762_1171881 3300030760 Bacteria 528
275 Ga0265766_1024722 3300030863 Bacteria 512
276 Ga0265332_10005390 3300031238 Bacteria 5903
277 Ga0265328_10000547 3300031239 Bacteria 17495
278 Ga0265320_10060216 3300031240 Bacteria 1813
279 Ga0265329_10096248 3300031242 Unclassified 941
280 Ga0265339_10000814 3300031249 Bacteria 24088
281 Ga0265339_10005010 3300031249 Bacteria 8912
282 Ga0265339_10006602 3300031249 Bacteria 7592
283 Ga0265339_10211689 3300031249 Bacteria 952
284 Ga0265331_10099275 3300031250 Bacteria 1341
285 Ga0265316_10012776 3300031344 Bacteria 7502
286 Ga0307408_101019649 3300031548 Bacteria 764
287 Ga0265313_10007288 3300031595 Bacteria 7593
288 Ga0265313_10040160 3300031595 Bacteria 2315
289 Ga0307514_10024515 3300031649 Bacteria 4884
290 Ga0265314_10000001 3300031711 Bacteria 3792860
291 Ga0265314_10009101 3300031711 Bacteria 8434
292 Ga0265314_10069043 3300031711 Bacteria 2373
293 Ga0265342_10000516 3300031712 Bacteria 41275
294 Ga0265342_10001028 3300031712 Bacteria 27405
295 Ga0316576_10623704 3300031727 Bacteria 786
296 Ga0307405_11702427 3300031731 Bacteria 559
297 Ga0307413_10798902 3300031824 Bacteria 793
298 Ga0307413_11856943 3300031824 Bacteria 540
299 Ga0307406_10009467 3300031901 Bacteria 5464
300 Ga0307406_10016753 3300031901 Bacteria 4263
301 Ga0307407_10244969 3300031903 Bacteria 1225
302 Ga0307412_10008938 3300031911 Bacteria 5738
303 Ga0316588_1146196 3300033528 Unclassified 605
304 Ga0373948_0185663 3300034817 Bacteria 536
305 Ga0373926_0430681 3300035083 Unclassified 522
306 Ga0373923_0109712 3300035111 Bacteria 1224
307 Ga0373923_0129015 3300035111 Bacteria 1135
308 Ga0373936_0421144 3300035113 Unclassified 615
309 Ga0373945_0332543 3300035116 Bacteria 656
310 Ga0373953_0199919 3300035117 Bacteria 864
311 Ga0373954_0030691 3300035118 Bacteria 2479
312 Ga0373956_0006448 3300035119 Bacteria 4704
313 Ga0373956_0027559 3300035119 Bacteria 2467
314 Ga0373956_0165220 3300035119 Bacteria 1044
315 Ga0373957_0072287 3300035120 Bacteria 1351
316 Ga0373957_0093067 3300035120 Unclassified 1200
317 Ga0373960_0270474 3300035121 Unclassified 623
318 Ga0373943_0052723 3300035170 Bacteria 2006
319 Ga0373943_0349159 3300035170 Bacteria 847
320 Ga0373955_0024942 3300035172 Bacteria 3064
321 Ga0373955_0335771 3300035172 Bacteria 914
322 Ga0373955_0404189 3300035172 Bacteria 830
323 Ga0316574_0688845 3300035398 Bacteria 627
324 Ga0373924_0486760 3300035410 Unclassified 554
325 Ga0373935_0752445 3300035692 Unclassified 718
326 Ga0373935_1172319 3300035692 Bacteria 572
327 Ga0373927_0028289 3300035695 Bacteria 3656
328 Ga0373933_0007290 3300035724 Bacteria 6031
329 Ga0373947_0119527 3300035725 Bacteria 1673
330 Ga0373937_0006468 3300036401 Bacteria 10109
331 Ga0373937_0028891 3300036401 Bacteria 5021
332 Ga0373937_0074547 3300036401 Bacteria 3132
333 Ga0373937_0526276 3300036401 Unclassified 1123
334 Ga0373925_0311518 3300037068 Bacteria 1272
335 Ga0395905_0430530 3300037471 Bacteria 1216
336 Ga0395905_0651471 3300037471 Bacteria 955
337 Ga0436360_0891124 3300039438 Bacteria 652
338 Ga0436360_1275643 3300039438 Bacteria 903
339 Ga0436361_0191127 3300039447 Bacteria 836
340 Ga0436363_0272420 3300039450 Bacteria 503
341 Ga0436362_0661266 3300039453 Bacteria 507
342 Ga0436362_1172253 3300039453 Bacteria 623
343 Ga0439465_0008321 3300041413 Bacteria 3273
344 Ga0451794_16987 3300041446 Bacteria 604
345 Ga0451797_0746618 3300041453 Bacteria 541
346 Ga0451800_0273962 3300041459 Bacteria 878
347 Ga0451800_1558869 3300041459 Bacteria 955
348 Ga0451807_2194440 3300041486 Bacteria 1188
349 Ga0451837_1678537 3300041494 Bacteria 780
350 Ga0451839_0466753 3300041496 Bacteria 507
351 Ga0451847_0667574 3300041503 Bacteria 553
352 Ga0451849_0600664 3300041505 Unclassified 2584
353 Ga0451843_0663320 3300041509 Unclassified 1120
354 Ga0451855_1201734 3300041511 Unclassified 878
355 Ga0451853_0601611 3300041512 Bacteria 816
356 Ga0451853_1759616 3300041512 Bacteria 27396
357 Ga0451853_3832943 3300041512 Bacteria 709
358 Ga0451853_3842606 3300041512 Bacteria 1529
359 Ga0439445_0030244 3300042004 Bacteria 1403
360 Ga0439434_0217437 3300042435 Bacteria 648
361 Ga0451577_0066385 3300042876 Bacteria 3218
362 Ga0451577_0117032 3300042876 Bacteria 2387
363 Ga0451577_0177995 3300042876 Bacteria 1917
364 Ga0451577_0401782 3300042876 Bacteria 1243
365 Ga0451577_0409783 3300042876 Bacteria 1230
366 Ga0451577_0566313 3300042876 Bacteria 1031
367 Ga0451577_0805048 3300042876 Bacteria 849
368 Ga0451577_1126155 3300042876 Bacteria 702
369 Ga0451577_1980054 3300042876 Unclassified 509
370 Ga0466972_0446932 3300044658 Bacteria 607
371 Ga0453683_0002373 3300044673 Bacteria 14721
372 Ga0453683_0023842 3300044673 Bacteria 3897
373 Ga0453683_0028649 3300044673 Bacteria 3525
374 Ga0453683_0036600 3300044673 Bacteria 3089
375 Ga0453683_0368847 3300044673 Bacteria 923
376 Ga0453683_0481481 3300044673 Bacteria 804
377 Ga0453684_0000082 3300044712 Bacteria 399380
378 Ga0453684_0001048 3300044712 Bacteria 88382
379 Ga0453684_0001308 3300044712 Bacteria 73691
380 Ga0453684_0002592 3300044712 Bacteria 43253
381 Ga0453684_0060439 3300044712 Bacteria 4873
382 Ga0453684_0061490 3300044712 Bacteria 4820
383 Ga0453684_0072781 3300044712 Bacteria 4336
384 Ga0453684_0077572 3300044712 Bacteria 4162
385 Ga0453684_0183611 3300044712 Bacteria 2453
386 Ga0453684_0205913 3300044712 Bacteria 2290
387 Ga0453684_0527012 3300044712 Bacteria 1304
388 Ga0453684_0891090 3300044712 Bacteria 953
389 Ga0453684_1156846 3300044712 Bacteria 814
390 Ga0466960_0634830 3300044901 Bacteria 636
391 Ga0451576_0008790 3300045051 Bacteria 11814
392 Ga0451576_0010049 3300045051 Bacteria 10897
393 Ga0451576_0039861 3300045051 Bacteria 4973
394 Ga0451576_0253366 3300045051 Bacteria 1840
395 Ga0451576_0260354 3300045051 Bacteria 1813
396 Ga0451576_0340074 3300045051 Bacteria 1571
397 Ga0451576_0556339 3300045051 Bacteria 1205
398 Ga0451576_0684768 3300045051 Bacteria 1077
399 Ga0451576_1938125 3300045051 Bacteria 607
400 Ga0451576_2249749 3300045051 Bacteria 559
401 Ga0495651_0876107 3300046462 Unclassified 550
402 Ga0495662_0236033 3300046476 Archaea 901
403 Ga0495640_0805165 3300046533 Unclassified 560
404 Ga0495622_0105999 3300046557 Unclassified 1288
405 Ga0495667_0406792 3300046559 Unclassified 857
406 Ga0495667_0763891 3300046559 Unclassified 597
407 Ga0495668_0738243 3300046616 Bacteria 545
408 Ga0495635_0598396 3300046663 Bacteria 720
409 Ga0495657_0417208 3300046675 Bacteria 788
410 Ga0495657_0811407 3300046675 Bacteria 534
411 Ga0495658_0761998 3300046683 Unclassified 620
412 Ga0495604_0452179 3300047317 Unclassified 839
413 Ga0495680_0242390 3300047322 Bacteria 1280
414 Ga0495680_0248537 3300047322 Unclassified 1261
415 Ga0495686_0020684 3300047472 Bacteria 4386
416 Ga0496100_0671070 3300048903 Unclassified 808
417 Ga0496104_0335929 3300048907 Bacteria 1424
418 Ga0496104_1229533 3300048907 Bacteria 652
419 Ga0496104_1422235 3300048907 Bacteria 596
420 Ga0496108_0104858 3300048911 Unclassified 2413
421 Ga0496108_0548208 3300048911 Bacteria 1009
422 Ga0496109_1557934 3300048912 Bacteria 595
423 Ga0496110_0326720 3300048913 Unclassified 1397
424 Ga0496112_0027700 3300048915 Bacteria 5465
425 Ga0496112_1371944 3300048915 Unclassified 622
426 Ga0496112_1532116 3300048915 Bacteria 580
427 Ga0496113_0880416 3300048916 Bacteria 709
428 Ga0496115_0101075 3300048918 Bacteria 2364
429 Ga0496115_1419543 3300048918 Bacteria 512
430 Ga0496123_0217571 3300048926 Bacteria 966
431 Ga0501312_064241 3300049528 Bacteria 640
432 Ga0501312_081231 3300049528 Bacteria 587
433 Ga0501032_0086291 3300049569 Bacteria 2086
434 Ga0501034_0439301 3300049571 Bacteria 1224
435 Ga0501034_0865761 3300049571 Bacteria 793
436 Ga0501037_0488353 3300049573 Unclassified 836
437 Ga0501038_0235730 3300049574 Bacteria 1454
438 Ga0501043_0019752 3300049579 Bacteria 5291
439 Ga0501047_0001215 3300049581 Bacteria 25539
440 Ga0501047_0058279 3300049581 Bacteria 3731
441 Ga0501048_0137615 3300049582 Bacteria 1726
442 Ga0501067_0000389 3300049583 Bacteria 23907
443 Ga0501067_0004630 3300049583 Bacteria 7620
444 Ga0501067_0082007 3300049583 Bacteria 1788
445 Ga0501068_0000260 3300049584 Bacteria 26078
446 Ga0501068_0025539 3300049584 Bacteria 3475
447 Ga0501068_0028275 3300049584 Bacteria 3315
448 Ga0501068_0117202 3300049584 Bacteria 1659
449 Ga0501068_0942297 3300049584 Bacteria 569
450 Ga0501069_0007698 3300049585 Bacteria 5651
451 Ga0501070_0131924 3300049586 Bacteria 2063
452 Ga0501070_0904102 3300049586 Bacteria 688
453 Ga0501071_0932309 3300049587 Bacteria 670
454 Ga0501072_0000029 3300049588 Bacteria 134083
455 Ga0501072_0047336 3300049588 Unclassified 3387
456 Ga0501073_0004013 3300049589 Bacteria 11054
457 Ga0501073_0023129 3300049589 Bacteria 4467
458 Ga0501073_0195312 3300049589 Bacteria 1400
459 Ga0501073_0249108 3300049589 Bacteria 1226
460 Ga0501074_0011769 3300049590 Bacteria 6359
461 Ga0501074_0075401 3300049590 Bacteria 2421
462 Ga0501074_0115472 3300049590 Bacteria 1921
463 Ga0501074_0155340 3300049590 Unclassified 1635
464 Ga0501074_0897379 3300049590 Bacteria 624
465 Ga0501075_0935974 3300049591 Unclassified 659
466 Ga0501076_0017901 3300049592 Bacteria 5388
467 Ga0501076_0055424 3300049592 Bacteria 3144
468 Ga0501077_0055358 3300049593 Bacteria 2518
469 Ga0501079_0008659 3300049741 Bacteria 7716
470 Ga0501080_0001990 3300049742 Bacteria 17625
471 Ga0501080_0023382 3300049742 Bacteria 5729
472 Ga0501080_0277003 3300049742 Unclassified 1526
473 Ga0501080_0313098 3300049742 Bacteria 1422
474 Ga0501080_0491561 3300049742 Bacteria 1097
475 Ga0501081_0324668 3300049743 Bacteria 1132
476 Ga0501083_0001939 3300049744 Bacteria 14232
477 Ga0501083_0006810 3300049744 Bacteria 8112
478 Ga0501083_0008850 3300049744 Bacteria 7108
479 Ga0501083_0026398 3300049744 Bacteria 4014
480 Ga0501083_0071247 3300049744 Bacteria 2311
481 Ga0501083_0118798 3300049744 Archaea 1734
482 Ga0501083_0646020 3300049744 Bacteria 688
483 Ga0501263_032218 3300049760 Bacteria 744
484 Ga0501044_0001690 3300049823 Bacteria 25921
485 Ga0501044_0219176 3300049823 Unclassified 1854
486 nmdc:mga06r32_460050_c1 3300050510 Bacteria 1251
487 nmdc:mga08y16_107346_c1 3300050511 Bacteria 2906
488 nmdc:mga08y16_1303628_c1 3300050511 Bacteria 693
489 Ga0495601_0204531 3300053077 Bacteria 1290
490 Ga0495601_0325757 3300053077 Bacteria 1000
491 Ga0495601_0775653 3300053077 Unclassified 609
492 Ga0500655_029481 3300053133 Bacteria 1053
493 Ga0500568_0004574 3300053139 Bacteria 7370
494 Ga0501084_0000018 3300054114 Bacteria 147013
495 Ga0501084_0001201 3300054114 Bacteria 20295
496 Ga0501084_0010255 3300054114 Bacteria 7753
497 Ga0501084_0017867 3300054114 Bacteria 5903
498 Ga0501084_0471226 3300054114 Bacteria 1061
499 Ga0590071_088801 3300059421 Bacteria 772
500 Ga0590074_053271 3300059423 Bacteria 743
501 Ga0587084_042489 3300059477 Bacteria 778
502 Ga0587085_084102 3300059506 Bacteria 646
503 Ga0587076_118675 3300059645 Bacteria 610
504 Ga0587078_067861 3300059646 Bacteria 552
505 Ga0501082_0000287 3300060353 Bacteria 44479
506 Ga0501082_0030161 3300060353 Bacteria 4674
507 Ga0501082_0056039 3300060353 Bacteria 3395
508 Ga0501082_0056351 3300060353 Bacteria 3385
509 Ga0530510_0615470 3300061734 Unclassified 826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0368847 Ga0453683_0368847_373_726 117
2 3300044712 Ga0453684_0002592 Ga0453684_0002592_6678_7034 117
3 3300044712 Ga0453684_0060439 Ga0453684_0060439_3965_4321 117
4 3300049591 Ga0501075_0935974 Ga0501075_0935974_238_591 117
5 3300042876 Ga0451577_0401782 Ga0451577_0401782_791_1147 118
6 3300044673 Ga0453683_0002373 Ga0453683_0002373_11006_11362 118
7 3300044673 Ga0453683_0023842 Ga0453683_0023842_3468_3824 118
8 3300044712 Ga0453684_0000082 Ga0453684_0000082_236367_236723 118
9 3300045051 Ga0451576_0010049 Ga0451576_0010049_9518_9874 118
10 3300045051 Ga0451576_0039861 Ga0451576_0039861_1755_2111 118
11 3300045051 Ga0451576_0684768 Ga0451576_0684768_479_835 118
12 3300005327 Ga0070658_11121144 Ga0070658_111211441 119
13 3300025909 Ga0207705_11169739 Ga0207705_111697391 119
14 3300042876 Ga0451577_0066385 Ga0451577_0066385_2538_2897 119
15 3300042876 Ga0451577_0117032 Ga0451577_0117032_46_405 119
16 3300042876 Ga0451577_0177995 Ga0451577_0177995_1330_1692 119
17 3300042876 Ga0451577_0805048 Ga0451577_0805048_111_470 119
18 3300042876 Ga0451577_1980054 Ga0451577_1980054_63_428 119
19 3300044673 Ga0453683_0028649 Ga0453683_0028649_2047_2406 119
20 3300044673 Ga0453683_0481481 Ga0453683_0481481_400_759 119
21 3300044712 Ga0453684_0001048 Ga0453684_0001048_8693_9052 119
22 3300044712 Ga0453684_0061490 Ga0453684_0061490_4437_4796 119
23 3300044712 Ga0453684_0072781 Ga0453684_0072781_3528_3890 119
24 3300044712 Ga0453684_0077572 Ga0453684_0077572_691_1050 119
25 3300044712 Ga0453684_0205913 Ga0453684_0205913_1319_1684 119
26 3300044712 Ga0453684_0527012 Ga0453684_0527012_204_563 119
27 3300044712 Ga0453684_1156846 Ga0453684_1156846_108_467 119
28 3300045051 Ga0451576_0260354 Ga0451576_0260354_1431_1790 119
29 3300045051 Ga0451576_0340074 Ga0451576_0340074_177_536 119
30 3300045051 Ga0451576_0556339 Ga0451576_0556339_748_1110 119
31 3300045051 Ga0451576_1938125 Ga0451576_1938125_108_467 119
32 3300045051 Ga0451576_2249749 Ga0451576_2249749_138_503 119
33 3300048912 Ga0496109_1557934 Ga0496109_1557934_192_551 119
34 3300003323 rootH1_10077254 rootH1_100772544 120
35 3300004785 Ga0058858_1379739 Ga0058858_13797391 120
36 3300004798 Ga0058859_11551521 Ga0058859_115515211 120
37 3300004801 Ga0058860_12057947 Ga0058860_120579471 120
38 3300004801 Ga0058860_12102671 Ga0058860_121026711 120
39 3300005329 Ga0070683_100291078 Ga0070683_1002910783 120
40 3300005329 Ga0070683_101126882 Ga0070683_1011268822 120
41 3300005334 Ga0068869_101225414 Ga0068869_1012254142 120
42 3300005335 Ga0070666_11350574 Ga0070666_113505741 120
43 3300005339 Ga0070660_100840306 Ga0070660_1008403061 120
44 3300005340 Ga0070689_100003803 Ga0070689_1000038033 120
45 3300005345 Ga0070692_11240206 Ga0070692_112402061 120
46 3300005347 Ga0070668_102018855 Ga0070668_1020188551 120
47 3300005354 Ga0070675_101169073 Ga0070675_1011690731 120
48 3300005356 Ga0070674_101822217 Ga0070674_1018222171 120
49 3300005444 Ga0070694_100243565 Ga0070694_1002435652 120
50 3300005445 Ga0070708_101450074 Ga0070708_1014500741 120
51 3300005456 Ga0070678_100011023 Ga0070678_1000110233 120
52 3300005458 Ga0070681_11716214 Ga0070681_117162141 120
53 3300005459 Ga0068867_101476219 Ga0068867_1014762192 120
54 3300005467 Ga0070706_100039098 Ga0070706_1000390983 120
55 3300005468 Ga0070707_100038749 Ga0070707_1000387494 120
56 3300005468 Ga0070707_100281829 Ga0070707_1002818292 120
57 3300005535 Ga0070684_100081070 Ga0070684_1000810702 120
58 3300005535 Ga0070684_100377089 Ga0070684_1003770892 120
59 3300005547 Ga0070693_100176087 Ga0070693_1001760872 120
60 3300005563 Ga0068855_100715795 Ga0068855_1007157952 120
61 3300005563 Ga0068855_101151804 Ga0068855_1011518042 120
62 3300005614 Ga0068856_100327104 Ga0068856_1003271042 120
63 3300005614 Ga0068856_100497442 Ga0068856_1004974422 120
64 3300005614 Ga0068856_100892951 Ga0068856_1008929512 120
65 3300005616 Ga0068852_100438475 Ga0068852_1004384752 120
66 3300005840 Ga0068870_11400583 Ga0068870_114005831 120
67 3300005842 Ga0068858_101391736 Ga0068858_1013917361 120
68 3300005937 Ga0081455_10059695 Ga0081455_100596953 120
69 3300005937 Ga0081455_10086608 Ga0081455_100866082 120
70 3300005985 Ga0081539_10158146 Ga0081539_101581462 120
71 3300006195 Ga0075366_10093602 Ga0075366_100936022 120
72 3300006195 Ga0075366_10249370 Ga0075366_102493701 120
73 3300006237 Ga0097621_101112139 Ga0097621_1011121391 120
74 3300006358 Ga0068871_100354553 Ga0068871_1003545532 120
75 3300006844 Ga0075428_102255542 Ga0075428_1022555421 120
76 3300006847 Ga0075431_100208346 Ga0075431_1002083461 120
77 3300006852 Ga0075433_11727421 Ga0075433_117274211 120
78 3300006881 Ga0068865_100846249 Ga0068865_1008462491 120
79 3300006931 Ga0097620_100570252 Ga0097620_1005702521 120
80 3300009094 Ga0111539_11087121 Ga0111539_110871212 120
81 3300009094 Ga0111539_13307297 Ga0111539_133072971 120
82 3300009098 Ga0105245_10014640 Ga0105245_100146407 120
83 3300009101 Ga0105247_10016328 Ga0105247_100163282 120
84 3300009176 Ga0105242_10244171 Ga0105242_102441712 120
85 3300009176 Ga0105242_10261693 Ga0105242_102616932 120
86 3300009176 Ga0105242_12106602 Ga0105242_121066021 120
87 3300009553 Ga0105249_11260238 Ga0105249_112602381 120
88 3300010375 Ga0105239_10951505 Ga0105239_109515051 120
89 3300010375 Ga0105239_12550292 Ga0105239_125502921 120
90 3300010375 Ga0105239_13632833 Ga0105239_136328331 120
91 3300011119 Ga0105246_11401716 Ga0105246_114017162 120
92 3300013105 Ga0157369_11109805 Ga0157369_111098051 120
93 3300013296 Ga0157374_10311366 Ga0157374_103113662 120
94 3300013296 Ga0157374_10468081 Ga0157374_104680812 120
95 3300013296 Ga0157374_10480169 Ga0157374_104801692 120
96 3300013307 Ga0157372_10644332 Ga0157372_106443322 120
97 3300013307 Ga0157372_13030803 Ga0157372_130308031 120
98 3300014325 Ga0163163_12038350 Ga0163163_120383502 120
99 3300014325 Ga0163163_12277819 Ga0163163_122778192 120
100 3300014325 Ga0163163_12616284 Ga0163163_126162841 120
101 3300014326 Ga0157380_11043242 Ga0157380_110432421 120
102 3300014969 Ga0157376_10118980 Ga0157376_101189803 120
103 3300014969 Ga0157376_10556063 Ga0157376_105560632 120
104 3300014969 Ga0157376_10951898 Ga0157376_109518982 120
105 3300017792 Ga0163161_10878933 Ga0163161_108789332 120
106 3300020075 Ga0206349_1888834 Ga0206349_18888341 120
107 3300025900 Ga0207710_10008087 Ga0207710_100080873 120
108 3300025903 Ga0207680_10556681 Ga0207680_105566812 120
109 3300025909 Ga0207705_10648561 Ga0207705_106485611 120
110 3300025910 Ga0207684_11105136 Ga0207684_111051361 120
111 3300025913 Ga0207695_10327237 Ga0207695_103272372 120
112 3300025922 Ga0207646_10039380 Ga0207646_100393804 120
113 3300025922 Ga0207646_11300229 Ga0207646_113002291 120
114 3300025926 Ga0207659_10681264 Ga0207659_106812641 120
115 3300025927 Ga0207687_10101637 Ga0207687_101016372 120
116 3300025932 Ga0207690_10630654 Ga0207690_106306542 120
117 3300025934 Ga0207686_10294824 Ga0207686_102948242 120
118 3300025934 Ga0207686_11428406 Ga0207686_114284062 120
119 3300025936 Ga0207670_10014878 Ga0207670_100148783 120
120 3300025941 Ga0207711_10490680 Ga0207711_104906802 120
121 3300025944 Ga0207661_10486092 Ga0207661_104860921 120
122 3300025949 Ga0207667_11571339 Ga0207667_115713391 120
123 3300025961 Ga0207712_11858410 Ga0207712_118584101 120
124 3300025972 Ga0207668_10252978 Ga0207668_102529782 120
125 3300026035 Ga0207703_12419472 Ga0207703_124194721 120
126 3300026067 Ga0207678_11020010 Ga0207678_110200101 120
127 3300026075 Ga0207708_10833998 Ga0207708_108339982 120
128 3300026075 Ga0207708_11585125 Ga0207708_115851251 120
129 3300026078 Ga0207702_10187036 Ga0207702_101870362 120
130 3300026078 Ga0207702_10454185 Ga0207702_104541852 120
131 3300026089 Ga0207648_11810319 Ga0207648_118103191 120
132 3300026116 Ga0207674_10833672 Ga0207674_108336721 120
133 3300026121 Ga0207683_10452113 Ga0207683_104521131 120
134 3300026142 Ga0207698_11751924 Ga0207698_117519242 120
135 3300028380 Ga0268265_10947935 Ga0268265_109479352 120
136 3300028573 Ga0265334_10031817 Ga0265334_100318171 120
137 3300028794 Ga0307515_10836213 Ga0307515_108362132 120
138 3300028800 Ga0265338_10467473 Ga0265338_104674731 120
139 3300030521 Ga0307511_10003700 Ga0307511_100037002 120
140 3300030760 Ga0265762_1171881 Ga0265762_11718811 120
141 3300030863 Ga0265766_1024722 Ga0265766_10247221 120
142 3300031238 Ga0265332_10005390 Ga0265332_100053902 120
143 3300031249 Ga0265339_10000814 Ga0265339_100008147 120
144 3300031250 Ga0265331_10099275 Ga0265331_100992751 120
145 3300031344 Ga0265316_10012776 Ga0265316_100127763 120
146 3300031649 Ga0307514_10024515 Ga0307514_100245152 120
147 3300031711 Ga0265314_10000001 Ga0265314_100000013214 120
148 3300031727 Ga0316576_10623704 Ga0316576_106237042 120
149 3300031731 Ga0307405_11702427 Ga0307405_117024271 120
150 3300031824 Ga0307413_10798902 Ga0307413_107989022 120
151 3300031824 Ga0307413_11856943 Ga0307413_118569431 120
152 3300031901 Ga0307406_10009467 Ga0307406_100094672 120
153 3300031903 Ga0307407_10244969 Ga0307407_102449692 120
154 3300031911 Ga0307412_10008938 Ga0307412_100089382 120
155 3300033528 Ga0316588_1146196 Ga0316588_11461961 120
156 3300034817 Ga0373948_0185663 Ga0373948_0185663_163_525 120
157 3300035119 Ga0373956_0165220 Ga0373956_0165220_562_924 120
158 3300035121 Ga0373960_0270474 Ga0373960_0270474_16_378 120
159 3300035172 Ga0373955_0404189 Ga0373955_0404189_187_549 120
160 3300035398 Ga0316574_0688845 Ga0316574_0688845_87_449 120
161 3300036401 Ga0373937_0028891 Ga0373937_0028891_3369_3731 120
162 3300036401 Ga0373937_0526276 Ga0373937_0526276_131_493 120
163 3300037471 Ga0395905_0430530 Ga0395905_0430530_111_473 120
164 3300037471 Ga0395905_0651471 Ga0395905_0651471_508_870 120
165 3300039438 Ga0436360_0891124 Ga0436360_0891124_214_576 120
166 3300039438 Ga0436360_1275643 Ga0436360_1275643_57_419 120
167 3300039447 Ga0436361_0191127 Ga0436361_0191127_327_689 120
168 3300039450 Ga0436363_0272420 Ga0436363_0272420_51_413 120
169 3300039453 Ga0436362_0661266 Ga0436362_0661266_97_459 120
170 3300041413 Ga0439465_0008321 Ga0439465_0008321_313_681 120
171 3300041446 Ga0451794_16987 Ga0451794_16987_187_549 120
172 3300041459 Ga0451800_0273962 Ga0451800_0273962_322_684 120
173 3300041459 Ga0451800_1558869 Ga0451800_1558869_471_833 120
174 3300041496 Ga0451839_0466753 Ga0451839_0466753_14_376 120
175 3300041503 Ga0451847_0667574 Ga0451847_0667574_143_505 120
176 3300041512 Ga0451853_3832943 Ga0451853_3832943_69_431 120
177 3300042004 Ga0439445_0030244 Ga0439445_0030244_1009_1377 120
178 3300042435 Ga0439434_0217437 Ga0439434_0217437_178_540 120
179 3300042876 Ga0451577_0409783 Ga0451577_0409783_447_815 120
180 3300042876 Ga0451577_1126155 Ga0451577_1126155_103_465 120
181 3300044658 Ga0466972_0446932 Ga0466972_0446932_161_523 120
182 3300044673 Ga0453683_0036600 Ga0453683_0036600_2041_2403 120
183 3300044712 Ga0453684_0183611 Ga0453684_0183611_1660_2028 120
184 3300044901 Ga0466960_0634830 Ga0466960_0634830_219_581 120
185 3300045051 Ga0451576_0008790 Ga0451576_0008790_3695_4063 120
186 3300045051 Ga0451576_0253366 Ga0451576_0253366_64_426 120
187 3300046476 Ga0495662_0236033 Ga0495662_0236033_463_825 120
188 3300046533 Ga0495640_0805165 Ga0495640_0805165_119_481 120
189 3300046559 Ga0495667_0406792 Ga0495667_0406792_101_463 120
190 3300046675 Ga0495657_0811407 Ga0495657_0811407_79_441 120
191 3300047322 Ga0495680_0248537 Ga0495680_0248537_174_536 120
192 3300048907 Ga0496104_1229533 Ga0496104_1229533_183_545 120
193 3300048907 Ga0496104_1422235 Ga0496104_1422235_36_398 120
194 3300048915 Ga0496112_1532116 Ga0496112_1532116_189_551 120
195 3300048918 Ga0496115_1419543 Ga0496115_1419543_76_438 120
196 3300048926 Ga0496123_0217571 Ga0496123_0217571_99_461 120
197 3300049528 Ga0501312_064241 Ga0501312_064241_140_502 120
198 3300049528 Ga0501312_081231 Ga0501312_081231_57_419 120
199 3300049569 Ga0501032_0086291 Ga0501032_0086291_1529_1891 120
200 3300049571 Ga0501034_0439301 Ga0501034_0439301_340_702 120
201 3300049571 Ga0501034_0865761 Ga0501034_0865761_16_378 120
202 3300049573 Ga0501037_0488353 Ga0501037_0488353_112_474 120
203 3300049574 Ga0501038_0235730 Ga0501038_0235730_300_662 120
204 3300049579 Ga0501043_0019752 Ga0501043_0019752_1837_2199 120
205 3300049581 Ga0501047_0001215 Ga0501047_0001215_21882_22244 120
206 3300049581 Ga0501047_0058279 Ga0501047_0058279_3276_3638 120
207 3300049582 Ga0501048_0137615 Ga0501048_0137615_407_769 120
208 3300049583 Ga0501067_0000389 Ga0501067_0000389_19157_19519 120
209 3300049583 Ga0501067_0082007 Ga0501067_0082007_30_392 120
210 3300049584 Ga0501068_0000260 Ga0501068_0000260_22385_22747 120
211 3300049584 Ga0501068_0025539 Ga0501068_0025539_2520_2882 120
212 3300049584 Ga0501068_0028275 Ga0501068_0028275_1116_1478 120
213 3300049584 Ga0501068_0117202 Ga0501068_0117202_1064_1426 120
214 3300049584 Ga0501068_0942297 Ga0501068_0942297_46_408 120
215 3300049585 Ga0501069_0007698 Ga0501069_0007698_2209_2571 120
216 3300049586 Ga0501070_0131924 Ga0501070_0131924_63_425 120
217 3300049586 Ga0501070_0904102 Ga0501070_0904102_63_425 120
218 3300049587 Ga0501071_0932309 Ga0501071_0932309_166_528 120
219 3300049588 Ga0501072_0000029 Ga0501072_0000029_130362_130724 120
220 3300049588 Ga0501072_0047336 Ga0501072_0047336_1993_2355 120
221 3300049589 Ga0501073_0004013 Ga0501073_0004013_382_744 120
222 3300049589 Ga0501073_0023129 Ga0501073_0023129_113_475 120
223 3300049589 Ga0501073_0195312 Ga0501073_0195312_780_1142 120
224 3300049589 Ga0501073_0249108 Ga0501073_0249108_735_1097 120
225 3300049590 Ga0501074_0011769 Ga0501074_0011769_3335_3697 120
226 3300049590 Ga0501074_0075401 Ga0501074_0075401_367_729 120
227 3300049590 Ga0501074_0155340 Ga0501074_0155340_475_837 120
228 3300049590 Ga0501074_0897379 Ga0501074_0897379_156_518 120
229 3300049592 Ga0501076_0017901 Ga0501076_0017901_3066_3428 120
230 3300049592 Ga0501076_0055424 Ga0501076_0055424_2583_2945 120
231 3300049593 Ga0501077_0055358 Ga0501077_0055358_214_576 120
232 3300049741 Ga0501079_0008659 Ga0501079_0008659_3337_3699 120
233 3300049742 Ga0501080_0001990 Ga0501080_0001990_15306_15668 120
234 3300049742 Ga0501080_0023382 Ga0501080_0023382_1580_1942 120
235 3300049742 Ga0501080_0277003 Ga0501080_0277003_834_1196 120
236 3300049742 Ga0501080_0313098 Ga0501080_0313098_829_1191 120
237 3300049742 Ga0501080_0491561 Ga0501080_0491561_285_647 120
238 3300049743 Ga0501081_0324668 Ga0501081_0324668_144_506 120
239 3300049744 Ga0501083_0001939 Ga0501083_0001939_10076_10438 120
240 3300049744 Ga0501083_0006810 Ga0501083_0006810_2402_2764 120
241 3300049744 Ga0501083_0008850 Ga0501083_0008850_6163_6525 120
242 3300049744 Ga0501083_0026398 Ga0501083_0026398_2960_3322 120
243 3300049744 Ga0501083_0118798 Ga0501083_0118798_829_1191 120
244 3300049744 Ga0501083_0646020 Ga0501083_0646020_224_586 120
245 3300049760 Ga0501263_032218 Ga0501263_032218_237_599 120
246 3300049823 Ga0501044_0001690 Ga0501044_0001690_13744_14106 120
247 3300049823 Ga0501044_0219176 Ga0501044_0219176_1175_1537 120
248 3300050510 nmdc:mga06r32_460050_c1 nmdc:mga06r32_460050_c1_837_1199 120
249 3300050511 nmdc:mga08y16_107346_c1 nmdc:mga08y16_107346_c1_1925_2287 120
250 3300050511 nmdc:mga08y16_1303628_c1 nmdc:mga08y16_1303628_c1_268_630 120
251 3300053077 Ga0495601_0775653 Ga0495601_0775653_145_507 120
252 3300054114 Ga0501084_0000018 Ga0501084_0000018_16293_16655 120
253 3300054114 Ga0501084_0001201 Ga0501084_0001201_5934_6296 120
254 3300054114 Ga0501084_0010255 Ga0501084_0010255_4861_5223 120
255 3300054114 Ga0501084_0017867 Ga0501084_0017867_4662_5024 120
256 3300054114 Ga0501084_0471226 Ga0501084_0471226_664_1026 120
257 3300059421 Ga0590071_088801 Ga0590071_088801_336_698 120
258 3300059423 Ga0590074_053271 Ga0590074_053271_149_511 120
259 3300059477 Ga0587084_042489 Ga0587084_042489_61_423 120
260 3300059506 Ga0587085_084102 Ga0587085_084102_66_428 120
261 3300059646 Ga0587078_067861 Ga0587078_067861_105_467 120
262 3300060353 Ga0501082_0000287 Ga0501082_0000287_2103_2465 120
263 3300060353 Ga0501082_0030161 Ga0501082_0030161_3020_3382 120
264 3300060353 Ga0501082_0056039 Ga0501082_0056039_2793_3155 120
265 3300060353 Ga0501082_0056351 Ga0501082_0056351_1458_1820 120
266 3300061734 Ga0530510_0615470 Ga0530510_0615470_288_650 120
267 3300041453 Ga0451797_0746618 Ga0451797_0746618_140_505 121
268 3300005459 Ga0068867_100058006 Ga0068867_1000580063 122
269 3300006237 Ga0097621_100025326 Ga0097621_1000253265 122
270 3300006844 Ga0075428_100220688 Ga0075428_1002206882 122
271 3300026089 Ga0207648_10028413 Ga0207648_100284136 122
272 3300031249 Ga0265339_10211689 Ga0265339_102116892 122
273 3300041486 Ga0451807_2194440 Ga0451807_2194440_223_591 122
274 3300042876 Ga0451577_0566313 Ga0451577_0566313_114_482 122
275 3300044712 Ga0453684_0891090 Ga0453684_0891090_438_806 122
276 3300009147 Ga0114129_11243017 Ga0114129_112430171 123
277 3300013296 Ga0157374_11140605 Ga0157374_111406051 123
278 3300014969 Ga0157376_11058619 Ga0157376_110586192 123
279 3300041505 Ga0451849_0600664 Ga0451849_0600664_1815_2237 123
280 3300041509 Ga0451843_0663320 Ga0451843_0663320_227_649 123
281 3300041511 Ga0451855_1201734 Ga0451855_1201734_435_857 123
282 3300041512 Ga0451853_1759616 Ga0451853_1759616_2124_2546 123
283 3300044712 Ga0453684_0001308 Ga0453684_0001308_36595_36975 124
284 3300049744 Ga0501083_0071247 Ga0501083_0071247_413_832 124
285 3300002870 Ga0006763J43179_107734 Ga0006763J43179_1077341 125
286 3300003163 Ga0006759J45824_1006064 Ga0006759J45824_10060641 125
287 3300003300 Ga0006758J48902_1019475 Ga0006758J48902_10194751 125
288 3300003323 rootH1_10288592 rootH1_102885922 125
289 3300003693 Ga0032354_1031084 Ga0032354_10310841 125
290 3300004801 Ga0058860_11846079 Ga0058860_118460791 125
291 3300004803 Ga0058862_10075690 Ga0058862_100756903 125
292 3300005293 Ga0065715_10577474 Ga0065715_105774742 125
293 3300005327 Ga0070658_10044642 Ga0070658_100446424 125
294 3300005328 Ga0070676_10010085 Ga0070676_100100855 125
295 3300005329 Ga0070683_100227111 Ga0070683_1002271112 125
296 3300005330 Ga0070690_100001442 Ga0070690_1000014423 125
297 3300005330 Ga0070690_100003920 Ga0070690_1000039209 125
298 3300005331 Ga0070670_100522217 Ga0070670_1005222172 125
299 3300005335 Ga0070666_10087814 Ga0070666_100878142 125
300 3300005335 Ga0070666_10135707 Ga0070666_101357072 125
301 3300005336 Ga0070680_100040653 Ga0070680_1000406534 125
302 3300005336 Ga0070680_100385429 Ga0070680_1003854292 125
303 3300005338 Ga0068868_100213350 Ga0068868_1002133504 125
304 3300005338 Ga0068868_100240580 Ga0068868_1002405803 125
305 3300005339 Ga0070660_100334669 Ga0070660_1003346692 125
306 3300005340 Ga0070689_100067538 Ga0070689_1000675382 125
307 3300005343 Ga0070687_100029373 Ga0070687_1000293733 125
308 3300005344 Ga0070661_100776923 Ga0070661_1007769232 125
309 3300005345 Ga0070692_10009790 Ga0070692_100097904 125
310 3300005345 Ga0070692_10752199 Ga0070692_107521992 125
311 3300005347 Ga0070668_100552362 Ga0070668_1005523622 125
312 3300005355 Ga0070671_100180443 Ga0070671_1001804431 125
313 3300005364 Ga0070673_100100750 Ga0070673_1001007501 125
314 3300005364 Ga0070673_100490822 Ga0070673_1004908222 125
315 3300005364 Ga0070673_101822636 Ga0070673_1018226361 125
316 3300005365 Ga0070688_100018368 Ga0070688_1000183683 125
317 3300005366 Ga0070659_100645682 Ga0070659_1006456822 125
318 3300005367 Ga0070667_100191068 Ga0070667_1001910681 125
319 3300005367 Ga0070667_100661505 Ga0070667_1006615052 125
320 3300005434 Ga0070709_10101459 Ga0070709_101014592 125
321 3300005435 Ga0070714_100037927 Ga0070714_1000379272 125
322 3300005436 Ga0070713_100557502 Ga0070713_1005575022 125
323 3300005437 Ga0070710_10017455 Ga0070710_100174552 125
324 3300005438 Ga0070701_10019365 Ga0070701_100193654 125
325 3300005439 Ga0070711_100148595 Ga0070711_1001485951 125
326 3300005440 Ga0070705_100065309 Ga0070705_1000653092 125
327 3300005440 Ga0070705_100425298 Ga0070705_1004252982 125
328 3300005441 Ga0070700_100002550 Ga0070700_1000025506 125
329 3300005444 Ga0070694_100037883 Ga0070694_1000378832 125
330 3300005455 Ga0070663_100784630 Ga0070663_1007846301 125
331 3300005457 Ga0070662_100032461 Ga0070662_1000324614 125
332 3300005458 Ga0070681_10070703 Ga0070681_100707035 125
333 3300005459 Ga0068867_100007894 Ga0068867_1000078948 125
334 3300005466 Ga0070685_10021579 Ga0070685_100215795 125
335 3300005466 Ga0070685_10358398 Ga0070685_103583981 125
336 3300005466 Ga0070685_10385932 Ga0070685_103859322 125
337 3300005468 Ga0070707_101846261 Ga0070707_1018462611 125
338 3300005530 Ga0070679_100004235 Ga0070679_10000423514 125
339 3300005530 Ga0070679_100188629 Ga0070679_1001886293 125
340 3300005535 Ga0070684_100115190 Ga0070684_1001151903 125
341 3300005535 Ga0070684_100157933 Ga0070684_1001579331 125
342 3300005539 Ga0068853_100185938 Ga0068853_1001859382 125
343 3300005544 Ga0070686_100081212 Ga0070686_1000812123 125
344 3300005544 Ga0070686_100148529 Ga0070686_1001485291 125
345 3300005547 Ga0070693_101505718 Ga0070693_1015057181 125
346 3300005548 Ga0070665_100011455 Ga0070665_1000114553 125
347 3300005548 Ga0070665_101282270 Ga0070665_1012822702 125
348 3300005563 Ga0068855_100816784 Ga0068855_1008167842 125
349 3300005563 Ga0068855_100840382 Ga0068855_1008403822 125
350 3300005615 Ga0070702_100084202 Ga0070702_1000842021 125
351 3300005615 Ga0070702_101354951 Ga0070702_1013549512 125
352 3300005616 Ga0068852_100631811 Ga0068852_1006318111 125
353 3300005618 Ga0068864_102652601 Ga0068864_1026526011 125
354 3300005718 Ga0068866_10018223 Ga0068866_100182233 125
355 3300005842 Ga0068858_100043685 Ga0068858_1000436851 125
356 3300005842 Ga0068858_100614717 Ga0068858_1006147172 125
357 3300005843 Ga0068860_100087028 Ga0068860_1000870283 125
358 3300005844 Ga0068862_100027130 Ga0068862_1000271307 125
359 3300005937 Ga0081455_10373793 Ga0081455_103737933 125
360 3300006358 Ga0068871_100637441 Ga0068871_1006374412 125
361 3300006844 Ga0075428_100343224 Ga0075428_1003432242 125
362 3300006871 Ga0075434_102664736 Ga0075434_1026647361 125
363 3300006881 Ga0068865_100002478 Ga0068865_10000247810 125
364 3300009148 Ga0105243_10495624 Ga0105243_104956243 125
365 3300009176 Ga0105242_10591994 Ga0105242_105919942 125
366 3300009177 Ga0105248_10699752 Ga0105248_106997521 125
367 3300009551 Ga0105238_10004950 Ga0105238_100049506 125
368 3300009553 Ga0105249_10410380 Ga0105249_104103802 125
369 3300010375 Ga0105239_10045590 Ga0105239_100455902 125
370 3300013297 Ga0157378_10119939 Ga0157378_101199391 125
371 3300013297 Ga0157378_10312361 Ga0157378_103123613 125
372 3300013297 Ga0157378_11655001 Ga0157378_116550012 125
373 3300014326 Ga0157380_10455745 Ga0157380_104557452 125
374 3300014745 Ga0157377_10454452 Ga0157377_104544522 125
375 3300014968 Ga0157379_10875605 Ga0157379_108756051 125
376 3300020070 Ga0206356_10649809 Ga0206356_106498092 125
377 3300025315 Ga0207697_10021953 Ga0207697_100219532 125
378 3300025898 Ga0207692_10013102 Ga0207692_100131024 125
379 3300025898 Ga0207692_10944029 Ga0207692_109440291 125
380 3300025899 Ga0207642_10015467 Ga0207642_100154674 125
381 3300025901 Ga0207688_10390850 Ga0207688_103908502 125
382 3300025903 Ga0207680_10331156 Ga0207680_103311562 125
383 3300025903 Ga0207680_10499703 Ga0207680_104997032 125
384 3300025906 Ga0207699_10075790 Ga0207699_100757903 125
385 3300025907 Ga0207645_10004684 Ga0207645_100046844 125
386 3300025909 Ga0207705_10010661 Ga0207705_100106617 125
387 3300025912 Ga0207707_10080641 Ga0207707_100806412 125
388 3300025912 Ga0207707_10167405 Ga0207707_101674053 125
389 3300025917 Ga0207660_10108734 Ga0207660_101087342 125
390 3300025918 Ga0207662_10030660 Ga0207662_100306604 125
391 3300025918 Ga0207662_10030935 Ga0207662_100309352 125
392 3300025919 Ga0207657_10270251 Ga0207657_102702513 125
393 3300025920 Ga0207649_11580619 Ga0207649_115806191 125
394 3300025921 Ga0207652_10000360 Ga0207652_1000036025 125
395 3300025921 Ga0207652_10001885 Ga0207652_100018857 125
396 3300025921 Ga0207652_10264839 Ga0207652_102648391 125
397 3300025922 Ga0207646_11553617 Ga0207646_115536171 125
398 3300025923 Ga0207681_10002930 Ga0207681_100029304 125
399 3300025924 Ga0207694_10066993 Ga0207694_100669932 125
400 3300025925 Ga0207650_10035631 Ga0207650_100356314 125
401 3300025931 Ga0207644_10103741 Ga0207644_101037412 125
402 3300025931 Ga0207644_11130521 Ga0207644_111305212 125
403 3300025933 Ga0207706_10038448 Ga0207706_100384483 125
404 3300025935 Ga0207709_10129544 Ga0207709_101295443 125
405 3300025936 Ga0207670_10003609 Ga0207670_100036097 125
406 3300025936 Ga0207670_10035113 Ga0207670_100351132 125
407 3300025937 Ga0207669_10038520 Ga0207669_100385202 125
408 3300025937 Ga0207669_10171750 Ga0207669_101717502 125
409 3300025937 Ga0207669_10353674 Ga0207669_103536742 125
410 3300025938 Ga0207704_10001642 Ga0207704_100016429 125
411 3300025940 Ga0207691_10257872 Ga0207691_102578722 125
412 3300025941 Ga0207711_10471689 Ga0207711_104716893 125
413 3300025942 Ga0207689_10051614 Ga0207689_100516141 125
414 3300025944 Ga0207661_10176867 Ga0207661_101768673 125
415 3300025944 Ga0207661_10294990 Ga0207661_102949903 125
416 3300025949 Ga0207667_10195523 Ga0207667_101955233 125
417 3300025949 Ga0207667_10273233 Ga0207667_102732332 125
418 3300025960 Ga0207651_10000484 Ga0207651_1000048415 125
419 3300025960 Ga0207651_10205110 Ga0207651_102051102 125
420 3300025961 Ga0207712_10342196 Ga0207712_103421963 125
421 3300025972 Ga0207668_10042568 Ga0207668_100425682 125
422 3300025981 Ga0207640_11634366 Ga0207640_116343662 125
423 3300025986 Ga0207658_11743986 Ga0207658_117439861 125
424 3300026023 Ga0207677_10211661 Ga0207677_102116613 125
425 3300026023 Ga0207677_10214821 Ga0207677_102148212 125
426 3300026035 Ga0207703_10115620 Ga0207703_101156202 125
427 3300026075 Ga0207708_10004142 Ga0207708_100041422 125
428 3300026088 Ga0207641_10265597 Ga0207641_102655971 125
429 3300026095 Ga0207676_11045386 Ga0207676_110453861 125
430 3300026095 Ga0207676_11106155 Ga0207676_111061552 125
431 3300026142 Ga0207698_10604720 Ga0207698_106047201 125
432 3300026142 Ga0207698_12601875 Ga0207698_126018751 125
433 3300027617 Ga0210002_1040030 Ga0210002_10400301 125
434 3300028379 Ga0268266_10001935 Ga0268266_100019353 125
435 3300028381 Ga0268264_10150138 Ga0268264_101501382 125
436 3300028558 Ga0265326_10187299 Ga0265326_101872991 125
437 3300028563 Ga0265319_1057625 Ga0265319_10576252 125
438 3300028563 Ga0265319_1140138 Ga0265319_11401382 125
439 3300028666 Ga0265336_10147315 Ga0265336_101473151 125
440 3300028800 Ga0265338_10009440 Ga0265338_100094403 125
441 3300028800 Ga0265338_10086106 Ga0265338_100861063 125
442 3300028800 Ga0265338_10118251 Ga0265338_101182511 125
443 3300031239 Ga0265328_10000547 Ga0265328_100005478 125
444 3300031240 Ga0265320_10060216 Ga0265320_100602163 125
445 3300031242 Ga0265329_10096248 Ga0265329_100962481 125
446 3300031249 Ga0265339_10005010 Ga0265339_1000501010 125
447 3300031249 Ga0265339_10006602 Ga0265339_100066027 125
448 3300031548 Ga0307408_101019649 Ga0307408_1010196491 125
449 3300031595 Ga0265313_10007288 Ga0265313_100072888 125
450 3300031595 Ga0265313_10040160 Ga0265313_100401602 125
451 3300031711 Ga0265314_10009101 Ga0265314_100091014 125
452 3300031711 Ga0265314_10069043 Ga0265314_100690431 125
453 3300031712 Ga0265342_10000516 Ga0265342_100005161 125
454 3300031712 Ga0265342_10001028 Ga0265342_100010281 125
455 3300031901 Ga0307406_10016753 Ga0307406_100167535 125
456 3300035083 Ga0373926_0430681 Ga0373926_0430681_132_509 125
457 3300035111 Ga0373923_0109712 Ga0373923_0109712_761_1159 125
458 3300035111 Ga0373923_0129015 Ga0373923_0129015_85_462 125
459 3300035113 Ga0373936_0421144 Ga0373936_0421144_130_507 125
460 3300035116 Ga0373945_0332543 Ga0373945_0332543_89_466 125
461 3300035117 Ga0373953_0199919 Ga0373953_0199919_470_847 125
462 3300035118 Ga0373954_0030691 Ga0373954_0030691_545_922 125
463 3300035119 Ga0373956_0006448 Ga0373956_0006448_4286_4663 125
464 3300035119 Ga0373956_0027559 Ga0373956_0027559_178_555 125
465 3300035120 Ga0373957_0072287 Ga0373957_0072287_181_558 125
466 3300035120 Ga0373957_0093067 Ga0373957_0093067_206_583 125
467 3300035170 Ga0373943_0052723 Ga0373943_0052723_1008_1385 125
468 3300035170 Ga0373943_0349159 Ga0373943_0349159_294_692 125
469 3300035172 Ga0373955_0024942 Ga0373955_0024942_891_1268 125
470 3300035172 Ga0373955_0335771 Ga0373955_0335771_454_852 125
471 3300035410 Ga0373924_0486760 Ga0373924_0486760_60_437 125
472 3300035692 Ga0373935_0752445 Ga0373935_0752445_268_645 125
473 3300035692 Ga0373935_1172319 Ga0373935_1172319_156_533 125
474 3300035695 Ga0373927_0028289 Ga0373927_0028289_912_1289 125
475 3300035724 Ga0373933_0007290 Ga0373933_0007290_4455_4832 125
476 3300035725 Ga0373947_0119527 Ga0373947_0119527_470_847 125
477 3300036401 Ga0373937_0006468 Ga0373937_0006468_5496_5873 125
478 3300036401 Ga0373937_0074547 Ga0373937_0074547_2030_2428 125
479 3300037068 Ga0373925_0311518 Ga0373925_0311518_207_584 125
480 3300039453 Ga0436362_1172253 Ga0436362_1172253_183_572 125
481 3300041494 Ga0451837_1678537 Ga0451837_1678537_333_719 125
482 3300041512 Ga0451853_0601611 Ga0451853_0601611_385_762 125
483 3300041512 Ga0451853_3842606 Ga0451853_3842606_66_452 125
484 3300046462 Ga0495651_0876107 Ga0495651_0876107_57_434 125
485 3300046557 Ga0495622_0105999 Ga0495622_0105999_570_947 125
486 3300046559 Ga0495667_0763891 Ga0495667_0763891_174_551 125
487 3300046616 Ga0495668_0738243 Ga0495668_0738243_26_412 125
488 3300046663 Ga0495635_0598396 Ga0495635_0598396_247_624 125
489 3300046675 Ga0495657_0417208 Ga0495657_0417208_322_699 125
490 3300046683 Ga0495658_0761998 Ga0495658_0761998_86_463 125
491 3300047317 Ga0495604_0452179 Ga0495604_0452179_366_743 125
492 3300047322 Ga0495680_0242390 Ga0495680_0242390_807_1184 125
493 3300047472 Ga0495686_0020684 Ga0495686_0020684_3275_3670 125
494 3300048903 Ga0496100_0671070 Ga0496100_0671070_261_638 125
495 3300048907 Ga0496104_0335929 Ga0496104_0335929_339_722 125
496 3300048911 Ga0496108_0104858 Ga0496108_0104858_1482_1859 125
497 3300048911 Ga0496108_0548208 Ga0496108_0548208_468_893 125
498 3300048913 Ga0496110_0326720 Ga0496110_0326720_813_1190 125
499 3300048915 Ga0496112_0027700 Ga0496112_0027700_2644_3021 125
500 3300048915 Ga0496112_1371944 Ga0496112_1371944_74_451 125
501 3300048916 Ga0496113_0880416 Ga0496113_0880416_206_583 125
502 3300048918 Ga0496115_0101075 Ga0496115_0101075_1184_1609 125
503 3300049583 Ga0501067_0004630 Ga0501067_0004630_2864_3241 125
504 3300049590 Ga0501074_0115472 Ga0501074_0115472_1286_1672 125
505 3300053077 Ga0495601_0204531 Ga0495601_0204531_13_390 125
506 3300053077 Ga0495601_0325757 Ga0495601_0325757_37_477 125
507 3300053133 Ga0500655_029481 Ga0500655_029481_492_869 125
508 3300053139 Ga0500568_0004574 Ga0500568_0004574_6733_7155 125
509 3300059645 Ga0587076_118675 Ga0587076_118675_126_557 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

78

113

0.97

PF21157

DksA_N

DnaK suppressor protein DksA, N-terminal domain

5

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.9011 6 119
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.833 6 119
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.773 6 125
4ijj-assembly1.cif.gz_A structure of transcription factor dksa2 from pseudomonas aeruginosa 0.7547 8 122
4ijj-assembly3.cif.gz_C structure of transcription factor dksa2 from pseudomonas aeruginosa 0.745 1 122
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7547 8 122 1.20.120.910
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7175 6 125 1.20.120.910
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6823 6 125 1.20.120.910
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6822 8 122 1.20.120.910
2kq9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6651 4 116 1.20.120.910
ID Description Score Start End GO Terms
AF-A0A1V4X305-F1-model_v4 General stress protein 16O 0.8415 6 121 GO:0008270
AF-A0A1F5V074-F1-model_v4 Zinc finger DksA/TraR C4-type domain-containing protein 0.8401 2 116 GO:0008270
AF-A0A1V4X305-F1-model_v4 General stress protein 16O 0.8279 6 121 GO:0008270
AF-A0A7C6AL52-F1-model_v4 TraR/DksA family transcriptional regulator 0.8274 6 124 GO:0008270
AF-A0A2M7H953-F1-model_v4 RNA polymerase-binding protein DksA 0.8246 4 124 GO:0005737
GO:0008270

Feature Viewer

pLDDT pTM Quality
74.86 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map