F456929

General Info

Members Datasets Scaffolds Average Seq Length
509 269 1018 195

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100000670|Ga0068869_1000006709
Length 230
Sequence MLRRQTSNPAWTCDGGPGQSPLLWQAMGTRKERTEEVGKRPSVQRCRWVTGGSPLYMVYHDREWGKPQHDELVLFEFLILEGAQAGLSWSTILNKRENYRKAFLGFDPRKVARFDKEKINRLLRDPGIVRNRLKIEAAVVNARAFLKVQEEFGSFDAYVWEFVGGKPRRNAWTSPKQVPAFTAESDALSKNLKQRGFKFVGSTIMYAFMQATGMVNDHTVECFRWKQLQR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0
Rhizoplane 3.14
Rhizosphere 92.14
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100000670 3300005334 Bacteria 19377
2 Ga0065712_10237193 3300005290 Bacteria 958
3 Ga0065707_10195748 3300005295 Bacteria 1336
4 Ga0070676_10115509 3300005328 Bacteria 1677
5 Ga0070683_100087133 3300005329 Bacteria 2928
6 Ga0070683_100914266 3300005329 Bacteria 842
7 Ga0070690_100003217 3300005330 Bacteria 8909
8 Ga0070690_100268158 3300005330 Bacteria 1213
9 Ga0070670_100061254 3300005331 Bacteria 3231
10 Ga0070670_100249240 3300005331 Bacteria 1547
11 Ga0068869_100011449 3300005334 Bacteria 5817
12 Ga0070666_10005344 3300005335 Bacteria 7873
13 Ga0070682_100020185 3300005337 Bacteria 3918
14 Ga0068868_100009706 3300005338 Bacteria 6943
15 Ga0068868_100038063 3300005338 Bacteria 3733
16 Ga0068868_100074596 3300005338 Bacteria 2709
17 Ga0068868_100101553 3300005338 Bacteria 2328
18 Ga0070660_100047765 3300005339 Bacteria 3285
19 Ga0070689_100025127 3300005340 Bacteria 4474
20 Ga0070691_10002097 3300005341 Bacteria 8818
21 Ga0070661_100588377 3300005344 Bacteria 899
22 Ga0070692_10025582 3300005345 Bacteria 2910
23 Ga0070668_100010428 3300005347 Bacteria 6905
24 Ga0070668_100015716 3300005347 Bacteria 5662
25 Ga0070669_100062400 3300005353 Bacteria 2740
26 Ga0070675_100061620 3300005354 Bacteria 3098
27 Ga0070675_100093806 3300005354 Unclassified 2518
28 Ga0070675_100487762 3300005354 Bacteria 1109
29 Ga0070671_100047646 3300005355 Bacteria 3563
30 Ga0070671_100064734 3300005355 Bacteria 3045
31 Ga0070671_100268069 3300005355 Bacteria 1451
32 Ga0070671_100588498 3300005355 Bacteria 961
33 Ga0070671_100869540 3300005355 Bacteria 787
34 Ga0070674_100343902 3300005356 Bacteria 1203
35 Ga0070674_100409003 3300005356 Bacteria 1110
36 Ga0070673_101040431 3300005364 Bacteria 763
37 Ga0070688_100391391 3300005365 Bacteria 1027
38 Ga0070688_100800143 3300005365 Bacteria 737
39 Ga0070659_100032233 3300005366 Bacteria 4063
40 Ga0070659_100369535 3300005366 Bacteria 1206
41 Ga0070659_100442883 3300005366 Bacteria 1101
42 Ga0070667_100031522 3300005367 Bacteria 4420
43 Ga0070667_100056310 3300005367 Bacteria 3321
44 Ga0070667_100064162 3300005367 Bacteria 3116
45 Ga0070709_10147323 3300005434 Bacteria 1623
46 Ga0070713_100197938 3300005436 Bacteria 1813
47 Ga0070713_100863136 3300005436 Bacteria 869
48 Ga0070710_10032645 3300005437 Bacteria 2822
49 Ga0070701_10000303 3300005438 Bacteria 16174
50 Ga0070701_10287406 3300005438 Bacteria 1006
51 Ga0070705_100065506 3300005440 Bacteria 2175
52 Ga0070700_100005377 3300005441 Bacteria 6781
53 Ga0070708_100004413 3300005445 Bacteria 11055
54 Ga0070708_100011022 3300005445 Bacteria 7343
55 Ga0070708_100013106 3300005445 Bacteria 6781
56 Ga0070708_100075920 3300005445 Bacteria 3034
57 Ga0070663_100018624 3300005455 Bacteria 4556
58 Ga0070663_100102739 3300005455 Bacteria 2136
59 Ga0070663_100259796 3300005455 Bacteria 1377
60 Ga0070678_100036325 3300005456 Bacteria 3448
61 Ga0070678_100197517 3300005456 Bacteria 1658
62 Ga0070662_100005028 3300005457 Bacteria 8413
63 Ga0070662_100153320 3300005457 Bacteria 1796
64 Ga0070662_100195020 3300005457 Bacteria 1604
65 Ga0070681_10211441 3300005458 Bacteria 1856
66 Ga0068867_100012293 3300005459 Bacteria 6054
67 Ga0068867_100095189 3300005459 Bacteria 2265
68 Ga0068867_100160997 3300005459 Bacteria 1770
69 Ga0068867_100436287 3300005459 Bacteria 1113
70 Ga0070685_10036616 3300005466 Bacteria 2774
71 Ga0070706_100023074 3300005467 Bacteria 5731
72 Ga0070706_100392727 3300005467 Bacteria 1291
73 Ga0070706_100881199 3300005467 Bacteria 827
74 Ga0070707_100006138 3300005468 Bacteria 11197
75 Ga0070707_100154117 3300005468 Bacteria 2238
76 Ga0070707_100352490 3300005468 Bacteria 1429
77 Ga0070707_100514017 3300005468 Bacteria 1159
78 Ga0070707_100787711 3300005468 Bacteria 914
79 Ga0070698_100019980 3300005471 Bacteria 7024
80 Ga0070698_100327790 3300005471 Bacteria 1462
81 Ga0070698_100807967 3300005471 Bacteria 882
82 Ga0070699_100074182 3300005518 Bacteria 2960
83 Ga0070679_100241924 3300005530 Bacteria 1762
84 Ga0070679_100248979 3300005530 Bacteria 1733
85 Ga0070679_100357617 3300005530 Bacteria 1408
86 Ga0070679_100924347 3300005530 Bacteria 816
87 Ga0070684_100044358 3300005535 Bacteria 3846
88 Ga0070684_100082113 3300005535 Bacteria 2853
89 Ga0070684_100092368 3300005535 Bacteria 2693
90 Ga0070684_100386793 3300005535 Bacteria 1289
91 Ga0070697_100190532 3300005536 Bacteria 1740
92 Ga0068853_100001165 3300005539 Bacteria 18691
93 Ga0068853_100157697 3300005539 Bacteria 2046
94 Ga0068853_100425291 3300005539 Bacteria 1246
95 Ga0070686_100000272 3300005544 Bacteria 35374
96 Ga0070695_100008565 3300005545 Bacteria 6075
97 Ga0070695_100055771 3300005545 Bacteria 2548
98 Ga0070696_100046851 3300005546 Bacteria 2999
99 Ga0070696_100665318 3300005546 Bacteria 846
100 Ga0070693_100036341 3300005547 Bacteria 2738
101 Ga0070693_100136153 3300005547 Bacteria 1541
102 Ga0070693_100407280 3300005547 Bacteria 944
103 Ga0070693_100550405 3300005547 Bacteria 826
104 Ga0070665_100084499 3300005548 Bacteria 3180
105 Ga0070665_100111816 3300005548 Bacteria 2734
106 Ga0070704_100338109 3300005549 Bacteria 1267
107 Ga0068855_100594328 3300005563 Bacteria 1194
108 Ga0068855_101180484 3300005563 Bacteria 797
109 Ga0070664_100034123 3300005564 Bacteria 4267
110 Ga0070664_100044133 3300005564 Bacteria 3764
111 Ga0070664_100225993 3300005564 Bacteria 1676
112 Ga0068857_100124171 3300005577 Bacteria 2326
113 Ga0068857_100165362 3300005577 Bacteria 2009
114 Ga0068857_100295708 3300005577 Bacteria 1492
115 Ga0068854_100040526 3300005578 Bacteria 3286
116 Ga0068854_100525426 3300005578 Bacteria 1000
117 Ga0068856_100366075 3300005614 Bacteria 1460
118 Ga0070702_100016788 3300005615 Bacteria 3764
119 Ga0068859_100031669 3300005617 Bacteria 5310
120 Ga0068859_100041416 3300005617 Bacteria 4626
121 Ga0068859_100056479 3300005617 Bacteria 3951
122 Ga0068859_100558099 3300005617 Bacteria 1239
123 Ga0068864_100018858 3300005618 Bacteria 5769
124 Ga0068864_100146548 3300005618 Bacteria 2135
125 Ga0068864_100160958 3300005618 Bacteria 2040
126 Ga0068864_100176593 3300005618 Bacteria 1950
127 Ga0068864_100844387 3300005618 Bacteria 902
128 Ga0068866_10000819 3300005718 Bacteria 13829
129 Ga0068861_100005293 3300005719 Bacteria 8707
130 Ga0068861_100254105 3300005719 Bacteria 1501
131 Ga0068851_10008984 3300005834 Bacteria 4636
132 Ga0068863_100193686 3300005841 Bacteria 1954
133 Ga0068863_100278911 3300005841 Bacteria 1619
134 Ga0068863_100596774 3300005841 Bacteria 1093
135 Ga0068863_100618671 3300005841 Bacteria 1073
136 Ga0068863_100748959 3300005841 Bacteria 973
137 Ga0068863_101199178 3300005841 Bacteria 765
138 Ga0068858_100003474 3300005842 Bacteria 15617
139 Ga0068858_100008741 3300005842 Bacteria 9718
140 Ga0068858_100085950 3300005842 Bacteria 2926
141 Ga0068858_100251283 3300005842 Bacteria 1679
142 Ga0068860_100033090 3300005843 Bacteria 4963
143 Ga0068862_100011102 3300005844 Bacteria 7439
144 Ga0068862_100076123 3300005844 Bacteria 2904
145 Ga0068862_100534496 3300005844 Unclassified 1117
146 Ga0068862_100844910 3300005844 Bacteria 897
147 Ga0068862_100896583 3300005844 Unclassified 871
148 Ga0070717_10034862 3300006028 Bacteria 4070
149 Ga0070717_10046172 3300006028 Bacteria 3563
150 Ga0070717_10296739 3300006028 Bacteria 1436
151 Ga0070717_10361976 3300006028 Bacteria 1298
152 Ga0075368_10010200 3300006042 Bacteria 3393
153 Ga0075364_10038184 3300006051 Bacteria 3111
154 Ga0075362_10010958 3300006177 Bacteria 3559
155 Ga0075369_10036845 3300006186 Bacteria 2082
156 Ga0075366_10011763 3300006195 Bacteria 4948
157 Ga0097621_100049035 3300006237 Bacteria 3429
158 Ga0097621_100193249 3300006237 Bacteria 1763
159 Ga0075370_10021767 3300006353 Bacteria 3514
160 Ga0068871_100001918 3300006358 Bacteria 14069
161 Ga0068871_100017430 3300006358 Bacteria 5435
162 Ga0068871_100093063 3300006358 Bacteria 2514
163 Ga0068871_100910156 3300006358 Bacteria 816
164 Ga0075431_100526930 3300006847 Bacteria 1170
165 Ga0075433_10121110 3300006852 Bacteria 2323
166 Ga0075433_10589976 3300006852 Bacteria 976
167 Ga0075434_100055104 3300006871 Bacteria 3951
168 Ga0075434_100582098 3300006871 Bacteria 1138
169 Ga0075429_100581201 3300006880 Bacteria 981
170 Ga0068865_100005434 3300006881 Bacteria 7729
171 Ga0068865_100562835 3300006881 Bacteria 959
172 Ga0097620_100031669 3300006931 Bacteria 5310
173 Ga0097620_100041416 3300006931 Bacteria 4626
174 Ga0097620_100056478 3300006931 Bacteria 3951
175 Ga0097620_100558100 3300006931 Bacteria 1239
176 Ga0105250_10150214 3300009092 Bacteria 969
177 Ga0105240_10004112 3300009093 Bacteria 22330
178 Ga0105240_10076210 3300009093 Bacteria 4135
179 Ga0105240_10189333 3300009093 Bacteria 2420
180 Ga0105240_10599962 3300009093 Bacteria 1212
181 Ga0111539_10037339 3300009094 Bacteria 5867
182 Ga0105245_10205958 3300009098 Bacteria 1891
183 Ga0105247_10019883 3300009101 Unclassified 4034
184 Ga0114129_10036040 3300009147 Bacteria 6987
185 Ga0114129_10270116 3300009147 Bacteria 2275
186 Ga0105243_10252966 3300009148 Bacteria 1574
187 Ga0105241_10335212 3300009174 Bacteria 1309
188 Ga0105242_10030061 3300009176 Bacteria 4336
189 Ga0105242_10051144 3300009176 Bacteria 3366
190 Ga0105242_10079900 3300009176 Bacteria 2732
191 Ga0105242_10291918 3300009176 Bacteria 1485
192 Ga0105248_10040826 3300009177 Bacteria 5201
193 Ga0105248_10633996 3300009177 Bacteria 1206
194 Ga0105237_10851798 3300009545 Bacteria 918
195 Ga0105238_10117403 3300009551 Bacteria 2641
196 Ga0105238_10625950 3300009551 Bacteria 1085
197 Ga0105249_10000018 3300009553 Bacteria 275907
198 Ga0105249_10025733 3300009553 Bacteria 5299
199 Ga0105239_10155968 3300010375 Bacteria 2549
200 Ga0105239_10253735 3300010375 Bacteria 1976
201 Ga0105239_10526926 3300010375 Bacteria 1344
202 Ga0105246_10011577 3300011119 Bacteria 5475
203 Ga0157373_10086103 3300013100 Bacteria 2214
204 Ga0157373_10167684 3300013100 Bacteria 1545
205 Ga0157371_10010243 3300013102 Bacteria 7321
206 Ga0157371_10164324 3300013102 Bacteria 1585
207 Ga0157370_10156810 3300013104 Bacteria 2118
208 Ga0157370_10356900 3300013104 Bacteria 1347
209 Ga0157370_10671873 3300013104 Bacteria 946
210 Ga0157369_10102061 3300013105 Bacteria 3057
211 Ga0157369_10255973 3300013105 Bacteria 1826
212 Ga0157374_10021289 3300013296 Bacteria 5767
213 Ga0157374_10180011 3300013296 Unclassified 2064
214 Ga0157378_10037954 3300013297 Bacteria 4269
215 Ga0157378_10065098 3300013297 Bacteria 3262
216 Ga0163162_10000001 3300013306 Bacteria 751833
217 Ga0163162_10069571 3300013306 Bacteria 3571
218 Ga0163162_10331504 3300013306 Bacteria 1654
219 Ga0163162_10332756 3300013306 Bacteria 1651
220 Ga0163162_11906444 3300013306 Bacteria 680
221 Ga0157372_10030682 3300013307 Bacteria 5882
222 Ga0157372_10165160 3300013307 Bacteria 2560
223 Ga0157372_10322212 3300013307 Bacteria 1799
224 Ga0157372_10343469 3300013307 Bacteria 1739
225 Ga0157372_10895731 3300013307 Bacteria 1029
226 Ga0157372_10896459 3300013307 Bacteria 1029
227 Ga0157372_11077961 3300013307 Unclassified 930
228 Ga0157375_10052619 3300013308 Bacteria 4004
229 Ga0157375_10472105 3300013308 Bacteria 1420
230 Ga0157375_10814737 3300013308 Bacteria 1082
231 Ga0163163_10015357 3300014325 Bacteria 7077
232 Ga0163163_10185095 3300014325 Bacteria 2130
233 Ga0157380_10640474 3300014326 Bacteria 1058
234 Ga0157379_10069453 3300014968 Bacteria 3151
235 Ga0157376_10137008 3300014969 Bacteria 2192
236 Ga0157376_10643708 3300014969 Bacteria 1060
237 Ga0163161_10444276 3300017792 Bacteria 1047
238 Ga0213876_10198786 3300021384 Bacteria 1065
239 Ga0207656_10018050 3300025321 Bacteria 2772
240 Ga0207656_10066851 3300025321 Bacteria 1590
241 Ga0207692_10207203 3300025898 Bacteria 1156
242 Ga0207642_10023011 3300025899 Bacteria 2482
243 Ga0207680_10002558 3300025903 Bacteria 8480
244 Ga0207647_10369344 3300025904 Bacteria 811
245 Ga0207645_10025749 3300025907 Bacteria 3805
246 Ga0207645_10088076 3300025907 Unclassified 1995
247 Ga0207645_10486975 3300025907 Bacteria 834
248 Ga0207684_10013564 3300025910 Bacteria 7044
249 Ga0207684_10021602 3300025910 Bacteria 5495
250 Ga0207654_10081411 3300025911 Bacteria 1950
251 Ga0207654_10433247 3300025911 Bacteria 919
252 Ga0207707_10182086 3300025912 Bacteria 1834
253 Ga0207695_10004249 3300025913 Bacteria 19677
254 Ga0207695_10022285 3300025913 Bacteria 7198
255 Ga0207695_10425139 3300025913 Bacteria 1212
256 Ga0207671_10020794 3300025914 Bacteria 4991
257 Ga0207660_10205272 3300025917 Bacteria 1541
258 Ga0207662_10008255 3300025918 Bacteria 5698
259 Ga0207657_10000715 3300025919 Bacteria 35307
260 Ga0207649_10088410 3300025920 Bacteria 2023
261 Ga0207652_10550076 3300025921 Bacteria 1037
262 Ga0207652_10694881 3300025921 Bacteria 908
263 Ga0207646_10006744 3300025922 Bacteria 11820
264 Ga0207646_10007549 3300025922 Bacteria 11028
265 Ga0207646_10041832 3300025922 Bacteria 4117
266 Ga0207646_10257018 3300025922 Bacteria 1579
267 Ga0207646_10535522 3300025922 Bacteria 1054
268 Ga0207646_10656116 3300025922 Bacteria 940
269 Ga0207646_10802370 3300025922 Bacteria 838
270 Ga0207694_10075080 3300025924 Bacteria 2646
271 Ga0207694_10265267 3300025924 Bacteria 1407
272 Ga0207650_10004815 3300025925 Bacteria 9220
273 Ga0207650_10132654 3300025925 Bacteria 1951
274 Ga0207687_10005599 3300025927 Bacteria 8302
275 Ga0207687_10008681 3300025927 Bacteria 6639
276 Ga0207700_10015065 3300025928 Bacteria 5086
277 Ga0207700_10038598 3300025928 Bacteria 3467
278 Ga0207664_10105659 3300025929 Bacteria 2334
279 Ga0207644_10029281 3300025931 Bacteria 3819
280 Ga0207644_10358926 3300025931 Bacteria 1185
281 Ga0207644_10665490 3300025931 Bacteria 867
282 Ga0207690_10172661 3300025932 Bacteria 1621
283 Ga0207690_10488438 3300025932 Bacteria 995
284 Ga0207706_10000042 3300025933 Bacteria 125138
285 Ga0207706_10258342 3300025933 Bacteria 1521
286 Ga0207706_10286782 3300025933 Bacteria 1435
287 Ga0207706_10520338 3300025933 Bacteria 1026
288 Ga0207686_10001875 3300025934 Bacteria 11663
289 Ga0207686_10022496 3300025934 Bacteria 3632
290 Ga0207686_10053832 3300025934 Bacteria 2518
291 Ga0207686_10277412 3300025934 Bacteria 1236
292 Ga0207686_10455997 3300025934 Bacteria 984
293 Ga0207709_10007094 3300025935 Bacteria 6260
294 Ga0207709_10093654 3300025935 Bacteria 1970
295 Ga0207670_10025888 3300025936 Bacteria 3689
296 Ga0207669_10050163 3300025937 Bacteria 2493
297 Ga0207669_10389595 3300025937 Bacteria 1088
298 Ga0207704_10004080 3300025938 Bacteria 6654
299 Ga0207704_10069622 3300025938 Bacteria 2224
300 Ga0207704_10256262 3300025938 Bacteria 1316
301 Ga0207691_10265482 3300025940 Bacteria 1479
302 Ga0207691_10694318 3300025940 Unclassified 858
303 Ga0207711_10030601 3300025941 Bacteria 4541
304 Ga0207711_10046242 3300025941 Bacteria 3719
305 Ga0207689_10000262 3300025942 Bacteria 47258
306 Ga0207689_10010161 3300025942 Bacteria 8110
307 Ga0207689_10257687 3300025942 Bacteria 1443
308 Ga0207689_10331076 3300025942 Bacteria 1264
309 Ga0207661_10044875 3300025944 Bacteria 3496
310 Ga0207661_10105229 3300025944 Bacteria 2377
311 Ga0207679_10003415 3300025945 Bacteria 9801
312 Ga0207679_10058063 3300025945 Bacteria 2865
313 Ga0207667_10006011 3300025949 Bacteria 14772
314 Ga0207667_10011924 3300025949 Bacteria 10066
315 Ga0207651_10169154 3300025960 Bacteria 1722
316 Ga0207651_10182870 3300025960 Bacteria 1665
317 Ga0207712_10000022 3300025961 Bacteria 284365
318 Ga0207712_10114691 3300025961 Bacteria 2027
319 Ga0207712_10119536 3300025961 Bacteria 1991
320 Ga0207712_10495367 3300025961 Bacteria 1044
321 Ga0207712_10606237 3300025961 Bacteria 948
322 Ga0207712_10615093 3300025961 Bacteria 941
323 Ga0207668_10021615 3300025972 Bacteria 4106
324 Ga0207640_10016389 3300025981 Bacteria 4310
325 Ga0207640_10388065 3300025981 Bacteria 1133
326 Ga0207677_10042112 3300026023 Bacteria 3025
327 Ga0207703_10004505 3300026035 Bacteria 11437
328 Ga0207703_10014878 3300026035 Bacteria 6071
329 Ga0207703_11236040 3300026035 Bacteria 718
330 Ga0207639_10003395 3300026041 Bacteria 10710
331 Ga0207639_10042701 3300026041 Bacteria 3399
332 Ga0207639_10694896 3300026041 Bacteria 943
333 Ga0207678_10003560 3300026067 Bacteria 14011
334 Ga0207678_10397891 3300026067 Bacteria 1192
335 Ga0207678_10500768 3300026067 Bacteria 1059
336 Ga0207708_10002180 3300026075 Bacteria 14447
337 Ga0207702_10195649 3300026078 Bacteria 1871
338 Ga0207641_10062481 3300026088 Bacteria 3178
339 Ga0207641_10075897 3300026088 Bacteria 2904
340 Ga0207641_10091019 3300026088 Bacteria 2669
341 Ga0207641_10558706 3300026088 Bacteria 1117
342 Ga0207641_10601844 3300026088 Bacteria 1076
343 Ga0207641_10958432 3300026088 Bacteria 851
344 Ga0207648_10001297 3300026089 Bacteria 27879
345 Ga0207648_10002586 3300026089 Bacteria 19377
346 Ga0207648_10038434 3300026089 Bacteria 4211
347 Ga0207648_10181384 3300026089 Bacteria 1864
348 Ga0207648_10391610 3300026089 Bacteria 1258
349 Ga0207648_10924821 3300026089 Bacteria 815
350 Ga0207676_10028676 3300026095 Bacteria 4160
351 Ga0207676_10099548 3300026095 Bacteria 2406
352 Ga0207674_10004497 3300026116 Bacteria 16757
353 Ga0207674_10059898 3300026116 Bacteria 3852
354 Ga0207674_10286720 3300026116 Bacteria 1595
355 Ga0207675_100001238 3300026118 Bacteria 25498
356 Ga0207675_100121714 3300026118 Bacteria 2470
357 Ga0207675_100601709 3300026118 Bacteria 1102
358 Ga0207683_10025260 3300026121 Bacteria 5123
359 Ga0207683_10086026 3300026121 Bacteria 2795
360 Ga0207683_10281849 3300026121 Bacteria 1519
361 Ga0207698_10021027 3300026142 Bacteria 4506
362 Ga0207698_10033709 3300026142 Bacteria 3724
363 Ga0207698_10156366 3300026142 Bacteria 1987
364 Ga0209813_10002655 3300027866 Bacteria 4111
365 Ga0207428_10016140 3300027907 Bacteria 6432
366 Ga0268266_10293621 3300028379 Bacteria 1514
367 Ga0268265_10040054 3300028380 Bacteria 3458
368 Ga0268264_10013223 3300028381 Bacteria 6792
369 Ga0268264_10016171 3300028381 Bacteria 6111
370 Ga0268264_10054089 3300028381 Bacteria 3351
371 Ga0268264_10176747 3300028381 Bacteria 1935
372 Ga0268264_10634002 3300028381 Bacteria 1056
373 Ga0265336_10018061 3300028666 Bacteria 2289
374 Ga0265338_10262998 3300028800 Bacteria 1267
375 Ga0265320_10007003 3300031240 Bacteria 7028
376 Ga0265340_10027438 3300031247 Bacteria 2871
377 Ga0265339_10013175 3300031249 Bacteria 5017
378 Ga0265339_10197869 3300031249 Bacteria 993
379 Ga0265327_10116545 3300031251 Bacteria 1270
380 Ga0265316_10247891 3300031344 Bacteria 1309
381 Ga0265314_10008448 3300031711 Bacteria 8819
382 Ga0265314_10036560 3300031711 Bacteria 3567
383 Ga0265342_10000184 3300031712 Bacteria 69815
384 Ga0307405_10104065 3300031731 Bacteria 1910
385 Ga0307405_10286084 3300031731 Bacteria 1243
386 Ga0307413_10000731 3300031824 Bacteria 11314
387 Ga0307413_10011824 3300031824 Bacteria 4314
388 Ga0307413_10315486 3300031824 Bacteria 1192
389 Ga0307410_10002540 3300031852 Bacteria 8834
390 Ga0307410_10040021 3300031852 Bacteria 3082
391 Ga0307406_10022874 3300031901 Unclassified 3713
392 Ga0307406_10501784 3300031901 Unclassified 984
393 Ga0307407_10038798 3300031903 Bacteria 2643
394 Ga0307407_10270877 3300031903 Bacteria 1172
395 Ga0307412_10138491 3300031911 Bacteria 1779
396 Ga0307412_10147904 3300031911 Bacteria 1729
397 Ga0307412_10159772 3300031911 Bacteria 1673
398 Ga0307412_11011630 3300031911 Bacteria 735
399 Ga0307409_100000298 3300031995 Bacteria 20176
400 Ga0307409_100073648 3300031995 Bacteria 2725
401 Ga0307409_100081041 3300031995 Bacteria 2622
402 Ga0307416_100255325 3300032002 Bacteria 1709
403 Ga0307416_100828867 3300032002 Bacteria 1022
404 Ga0307414_10008921 3300032004 Bacteria 5729
405 Ga0307414_10199293 3300032004 Bacteria 1627
406 Ga0307414_10443619 3300032004 Unclassified 1137
407 Ga0307411_10010749 3300032005 Bacteria 4898
408 Ga0307415_100491769 3300032126 Bacteria 1070
409 Ga0373952_0104287 3300035092 Bacteria 751
410 Ga0373939_0161549 3300035114 Bacteria 823
411 Ga0373941_0061529 3300035115 Bacteria 1223
412 Ga0373953_0334072 3300035117 Bacteria 663
413 Ga0373956_0065983 3300035119 Bacteria 1645
414 Ga0373957_0084310 3300035120 Bacteria 1257
415 Ga0373960_0100902 3300035121 Bacteria 935
416 Ga0373955_0037819 3300035172 Bacteria 2568
417 Ga0373924_0280068 3300035410 Bacteria 740
418 Ga0373931_0019697 3300035691 Bacteria 3370
419 Ga0373931_0189322 3300035691 Bacteria 1223
420 Ga0373935_0259350 3300035692 Bacteria 1219
421 Ga0373927_0045053 3300035695 Bacteria 2854
422 Ga0373933_0004493 3300035724 Bacteria 7651
423 Ga0373925_0070585 3300037068 Bacteria 2641
424 Ga0395900_0373892 3300037418 Bacteria 1394
425 Ga0395901_0831513 3300038443 Bacteria 910
426 Ga0436365_0789990 3300039437 Bacteria 1655
427 Ga0436363_0171090 3300039450 Bacteria 880
428 Ga0436362_1265800 3300039453 Unclassified 1442
429 Ga0451791_0000913 3300041451 Bacteria 662
430 Ga0451843_0975439 3300041509 Bacteria 817
431 Ga0451853_0609682 3300041512 Bacteria 757
432 Ga0439441_000728 3300042001 Bacteria 3826
433 Ga0439448_0009301 3300042005 Bacteria 2894
434 Ga0451577_0000002 3300042876 Bacteria 1731375
435 Ga0466969_0008586 3300044656 Bacteria 5419
436 Ga0453683_0000003 3300044673 Bacteria 942572
437 Ga0453683_0000237 3300044673 Bacteria 73077
438 Ga0466965_0009174 3300044683 Bacteria 4595
439 Ga0466966_0002296 3300044684 Bacteria 12466
440 Ga0466961_0000873 3300044693 Bacteria 18753
441 Ga0453684_0000002 3300044712 Bacteria 1731375
442 Ga0453684_0223987 3300044712 Bacteria 2176
443 Ga0453684_0878112 3300044712 Unclassified 962
444 Ga0466959_0005181 3300045049 Bacteria 8885
445 Ga0451576_0000004 3300045051 Bacteria 1312238
446 Ga0451576_0186378 3300045051 Bacteria 2167
447 Ga0451576_0586376 3300045051 Bacteria 1172
448 Ga0495580_0016760 3300046472 Bacteria 5498
449 Ga0495652_0652360 3300046529 Bacteria 713
450 Ga0495658_0228682 3300046683 Bacteria 1166
451 Ga0496100_0054992 3300048903 Bacteria 2599
452 Ga0496101_0274029 3300048904 Bacteria 1318
453 Ga0496103_0062466 3300048906 Bacteria 2318
454 Ga0496104_0058069 3300048907 Bacteria 3662
455 Ga0496104_0398681 3300048907 Bacteria 1288
456 Ga0496105_0069188 3300048908 Bacteria 2917
457 Ga0496106_0108435 3300048909 Bacteria 2160
458 Ga0496109_0122215 3300048912 Bacteria 2426
459 Ga0496109_1093730 3300048912 Bacteria 734
460 Ga0496110_0051844 3300048913 Bacteria 3606
461 Ga0496110_0764375 3300048913 Bacteria 870
462 Ga0496111_0162958 3300048914 Bacteria 1656
463 Ga0496112_0011365 3300048915 Bacteria 8126
464 Ga0496114_0252111 3300048917 Bacteria 1553
465 Ga0496115_0181202 3300048918 Bacteria 1741
466 Ga0501034_0000638 3300049571 Bacteria 54454
467 Ga0501034_0002205 3300049571 Bacteria 24104
468 Ga0501039_0276257 3300049575 Bacteria 1321
469 Ga0501041_0236618 3300049577 Bacteria 1147
470 Ga0501068_0020072 3300049584 Bacteria 3889
471 Ga0501071_0005129 3300049587 Bacteria 8390
472 Ga0501072_0006991 3300049588 Bacteria 8570
473 Ga0501072_0034678 3300049588 Bacteria 3955
474 Ga0501073_0040031 3300049589 Bacteria 3319
475 Ga0501073_0057942 3300049589 Bacteria 2708
476 Ga0501073_0255945 3300049589 Bacteria 1208
477 Ga0501075_0379548 3300049591 Bacteria 1077
478 Ga0501259_039308 3300049688 Bacteria 924
479 Ga0501080_0011171 3300049742 Bacteria 8221
480 Ga0501081_0994216 3300049743 Bacteria 634
481 Ga0501044_0002349 3300049823 Bacteria 21581
482 Ga0501045_0067393 3300049824 Bacteria 2628
483 Ga0501045_0263631 3300049824 Bacteria 1283
484 nmdc:mga03683_101658_c1 3300050489 Bacteria 1264
485 nmdc:mga03n38_8847_c1 3300050490 Bacteria 3633
486 nmdc:mga00v17_31917_c1 3300050491 Bacteria 3110
487 nmdc:mga0yw44_11068_c1 3300050492 Bacteria 4638
488 nmdc:mga0k408_6724_c1 3300050493 Bacteria 6133
489 nmdc:mga04h51_6241_c1 3300050495 Bacteria 3079
490 nmdc:mga07m45_33445_c1 3300050496 Bacteria 2855
491 nmdc:mga07m45_81086_c1 3300050496 Bacteria 1853
492 nmdc:mga05p37_1090200_c1 3300050507 Bacteria 837
493 nmdc:mga05p37_274848_c1 3300050507 Bacteria 2012
494 nmdc:mga05p37_33514_c1 3300050507 Bacteria 6290
495 nmdc:mga09592_714620_c1 3300050508 Bacteria 852
496 nmdc:mga06r32_14617_c1 3300050510 Bacteria 7126
497 nmdc:mga06r32_26181_c1 3300050510 Bacteria 5435
498 nmdc:mga08y16_178182_c1 3300050511 Bacteria 2208
499 nmdc:mga0n895_49162_c1 3300050512 Bacteria 4130
500 nmdc:mga0n895_594531_c1 3300050512 Bacteria 1109
501 nmdc:mga0a205_160746_c1 3300050515 Bacteria 2143
502 nmdc:mga0a205_323300_c1 3300050515 Bacteria 1413
503 nmdc:mga0a205_326088_c1 3300050515 Bacteria 1406
504 nmdc:mga0sz30_22162_c1 3300050516 Bacteria 2576
505 Ga0500610_0202295 3300053079 Bacteria 956
506 Ga0500562_020877 3300053108 Bacteria 1701
507 Ga0500595_000009 3300053119 Bacteria 278382
508 Ga0501084_0001475 3300054114 Bacteria 18682
509 Ga0501082_0311757 3300060353 Bacteria 1370
510 Ga0068869_100000670
511 Ga0065712_10237193
512 Ga0065707_10195748
513 Ga0070676_10115509
514 Ga0070683_100087133
515 Ga0070683_100914266
516 Ga0070690_100003217
517 Ga0070690_100268158
518 Ga0070670_100061254
519 Ga0070670_100249240
520 Ga0068869_100011449
521 Ga0070666_10005344
522 Ga0070682_100020185
523 Ga0068868_100009706
524 Ga0068868_100038063
525 Ga0068868_100074596
526 Ga0068868_100101553
527 Ga0070660_100047765
528 Ga0070689_100025127
529 Ga0070691_10002097
530 Ga0070661_100588377
531 Ga0070692_10025582
532 Ga0070668_100010428
533 Ga0070668_100015716
534 Ga0070669_100062400
535 Ga0070675_100061620
536 Ga0070675_100093806
537 Ga0070675_100487762
538 Ga0070671_100047646
539 Ga0070671_100064734
540 Ga0070671_100268069
541 Ga0070671_100588498
542 Ga0070671_100869540
543 Ga0070674_100343902
544 Ga0070674_100409003
545 Ga0070673_101040431
546 Ga0070688_100391391
547 Ga0070688_100800143
548 Ga0070659_100032233
549 Ga0070659_100369535
550 Ga0070659_100442883
551 Ga0070667_100031522
552 Ga0070667_100056310
553 Ga0070667_100064162
554 Ga0070709_10147323
555 Ga0070713_100197938
556 Ga0070713_100863136
557 Ga0070710_10032645
558 Ga0070701_10000303
559 Ga0070701_10287406
560 Ga0070705_100065506
561 Ga0070700_100005377
562 Ga0070708_100004413
563 Ga0070708_100011022
564 Ga0070708_100013106
565 Ga0070708_100075920
566 Ga0070663_100018624
567 Ga0070663_100102739
568 Ga0070663_100259796
569 Ga0070678_100036325
570 Ga0070678_100197517
571 Ga0070662_100005028
572 Ga0070662_100153320
573 Ga0070662_100195020
574 Ga0070681_10211441
575 Ga0068867_100012293
576 Ga0068867_100095189
577 Ga0068867_100160997
578 Ga0068867_100436287
579 Ga0070685_10036616
580 Ga0070706_100023074
581 Ga0070706_100392727
582 Ga0070706_100881199
583 Ga0070707_100006138
584 Ga0070707_100154117
585 Ga0070707_100352490
586 Ga0070707_100514017
587 Ga0070707_100787711
588 Ga0070698_100019980
589 Ga0070698_100327790
590 Ga0070698_100807967
591 Ga0070699_100074182
592 Ga0070679_100241924
593 Ga0070679_100248979
594 Ga0070679_100357617
595 Ga0070679_100924347
596 Ga0070684_100044358
597 Ga0070684_100082113
598 Ga0070684_100092368
599 Ga0070684_100386793
600 Ga0070697_100190532
601 Ga0068853_100001165
602 Ga0068853_100157697
603 Ga0068853_100425291
604 Ga0070686_100000272
605 Ga0070695_100008565
606 Ga0070695_100055771
607 Ga0070696_100046851
608 Ga0070696_100665318
609 Ga0070693_100036341
610 Ga0070693_100136153
611 Ga0070693_100407280
612 Ga0070693_100550405
613 Ga0070665_100084499
614 Ga0070665_100111816
615 Ga0070704_100338109
616 Ga0068855_100594328
617 Ga0068855_101180484
618 Ga0070664_100034123
619 Ga0070664_100044133
620 Ga0070664_100225993
621 Ga0068857_100124171
622 Ga0068857_100165362
623 Ga0068857_100295708
624 Ga0068854_100040526
625 Ga0068854_100525426
626 Ga0068856_100366075
627 Ga0070702_100016788
628 Ga0068859_100031669
629 Ga0068859_100041416
630 Ga0068859_100056479
631 Ga0068859_100558099
632 Ga0068864_100018858
633 Ga0068864_100146548
634 Ga0068864_100160958
635 Ga0068864_100176593
636 Ga0068864_100844387
637 Ga0068866_10000819
638 Ga0068861_100005293
639 Ga0068861_100254105
640 Ga0068851_10008984
641 Ga0068863_100193686
642 Ga0068863_100278911
643 Ga0068863_100596774
644 Ga0068863_100618671
645 Ga0068863_100748959
646 Ga0068863_101199178
647 Ga0068858_100003474
648 Ga0068858_100008741
649 Ga0068858_100085950
650 Ga0068858_100251283
651 Ga0068860_100033090
652 Ga0068862_100011102
653 Ga0068862_100076123
654 Ga0068862_100534496
655 Ga0068862_100844910
656 Ga0068862_100896583
657 Ga0070717_10034862
658 Ga0070717_10046172
659 Ga0070717_10296739
660 Ga0070717_10361976
661 Ga0075368_10010200
662 Ga0075364_10038184
663 Ga0075362_10010958
664 Ga0075369_10036845
665 Ga0075366_10011763
666 Ga0097621_100049035
667 Ga0097621_100193249
668 Ga0075370_10021767
669 Ga0068871_100001918
670 Ga0068871_100017430
671 Ga0068871_100093063
672 Ga0068871_100910156
673 Ga0075431_100526930
674 Ga0075433_10121110
675 Ga0075433_10589976
676 Ga0075434_100055104
677 Ga0075434_100582098
678 Ga0075429_100581201
679 Ga0068865_100005434
680 Ga0068865_100562835
681 Ga0097620_100031669
682 Ga0097620_100041416
683 Ga0097620_100056478
684 Ga0097620_100558100
685 Ga0105250_10150214
686 Ga0105240_10004112
687 Ga0105240_10076210
688 Ga0105240_10189333
689 Ga0105240_10599962
690 Ga0111539_10037339
691 Ga0105245_10205958
692 Ga0105247_10019883
693 Ga0114129_10036040
694 Ga0114129_10270116
695 Ga0105243_10252966
696 Ga0105241_10335212
697 Ga0105242_10030061
698 Ga0105242_10051144
699 Ga0105242_10079900
700 Ga0105242_10291918
701 Ga0105248_10040826
702 Ga0105248_10633996
703 Ga0105237_10851798
704 Ga0105238_10117403
705 Ga0105238_10625950
706 Ga0105249_10000018
707 Ga0105249_10025733
708 Ga0105239_10155968
709 Ga0105239_10253735
710 Ga0105239_10526926
711 Ga0105246_10011577
712 Ga0157373_10086103
713 Ga0157373_10167684
714 Ga0157371_10010243
715 Ga0157371_10164324
716 Ga0157370_10156810
717 Ga0157370_10356900
718 Ga0157370_10671873
719 Ga0157369_10102061
720 Ga0157369_10255973
721 Ga0157374_10021289
722 Ga0157374_10180011
723 Ga0157378_10037954
724 Ga0157378_10065098
725 Ga0163162_10000001
726 Ga0163162_10069571
727 Ga0163162_10331504
728 Ga0163162_10332756
729 Ga0163162_11906444
730 Ga0157372_10030682
731 Ga0157372_10165160
732 Ga0157372_10322212
733 Ga0157372_10343469
734 Ga0157372_10895731
735 Ga0157372_10896459
736 Ga0157372_11077961
737 Ga0157375_10052619
738 Ga0157375_10472105
739 Ga0157375_10814737
740 Ga0163163_10015357
741 Ga0163163_10185095
742 Ga0157380_10640474
743 Ga0157379_10069453
744 Ga0157376_10137008
745 Ga0157376_10643708
746 Ga0163161_10444276
747 Ga0213876_10198786
748 Ga0207656_10018050
749 Ga0207656_10066851
750 Ga0207692_10207203
751 Ga0207642_10023011
752 Ga0207680_10002558
753 Ga0207647_10369344
754 Ga0207645_10025749
755 Ga0207645_10088076
756 Ga0207645_10486975
757 Ga0207684_10013564
758 Ga0207684_10021602
759 Ga0207654_10081411
760 Ga0207654_10433247
761 Ga0207707_10182086
762 Ga0207695_10004249
763 Ga0207695_10022285
764 Ga0207695_10425139
765 Ga0207671_10020794
766 Ga0207660_10205272
767 Ga0207662_10008255
768 Ga0207657_10000715
769 Ga0207649_10088410
770 Ga0207652_10550076
771 Ga0207652_10694881
772 Ga0207646_10006744
773 Ga0207646_10007549
774 Ga0207646_10041832
775 Ga0207646_10257018
776 Ga0207646_10535522
777 Ga0207646_10656116
778 Ga0207646_10802370
779 Ga0207694_10075080
780 Ga0207694_10265267
781 Ga0207650_10004815
782 Ga0207650_10132654
783 Ga0207687_10005599
784 Ga0207687_10008681
785 Ga0207700_10015065
786 Ga0207700_10038598
787 Ga0207664_10105659
788 Ga0207644_10029281
789 Ga0207644_10358926
790 Ga0207644_10665490
791 Ga0207690_10172661
792 Ga0207690_10488438
793 Ga0207706_10000042
794 Ga0207706_10258342
795 Ga0207706_10286782
796 Ga0207706_10520338
797 Ga0207686_10001875
798 Ga0207686_10022496
799 Ga0207686_10053832
800 Ga0207686_10277412
801 Ga0207686_10455997
802 Ga0207709_10007094
803 Ga0207709_10093654
804 Ga0207670_10025888
805 Ga0207669_10050163
806 Ga0207669_10389595
807 Ga0207704_10004080
808 Ga0207704_10069622
809 Ga0207704_10256262
810 Ga0207691_10265482
811 Ga0207691_10694318
812 Ga0207711_10030601
813 Ga0207711_10046242
814 Ga0207689_10000262
815 Ga0207689_10010161
816 Ga0207689_10257687
817 Ga0207689_10331076
818 Ga0207661_10044875
819 Ga0207661_10105229
820 Ga0207679_10003415
821 Ga0207679_10058063
822 Ga0207667_10006011
823 Ga0207667_10011924
824 Ga0207651_10169154
825 Ga0207651_10182870
826 Ga0207712_10000022
827 Ga0207712_10114691
828 Ga0207712_10119536
829 Ga0207712_10495367
830 Ga0207712_10606237
831 Ga0207712_10615093
832 Ga0207668_10021615
833 Ga0207640_10016389
834 Ga0207640_10388065
835 Ga0207677_10042112
836 Ga0207703_10004505
837 Ga0207703_10014878
838 Ga0207703_11236040
839 Ga0207639_10003395
840 Ga0207639_10042701
841 Ga0207639_10694896
842 Ga0207678_10003560
843 Ga0207678_10397891
844 Ga0207678_10500768
845 Ga0207708_10002180
846 Ga0207702_10195649
847 Ga0207641_10062481
848 Ga0207641_10075897
849 Ga0207641_10091019
850 Ga0207641_10558706
851 Ga0207641_10601844
852 Ga0207641_10958432
853 Ga0207648_10001297
854 Ga0207648_10002586
855 Ga0207648_10038434
856 Ga0207648_10181384
857 Ga0207648_10391610
858 Ga0207648_10924821
859 Ga0207676_10028676
860 Ga0207676_10099548
861 Ga0207674_10004497
862 Ga0207674_10059898
863 Ga0207674_10286720
864 Ga0207675_100001238
865 Ga0207675_100121714
866 Ga0207675_100601709
867 Ga0207683_10025260
868 Ga0207683_10086026
869 Ga0207683_10281849
870 Ga0207698_10021027
871 Ga0207698_10033709
872 Ga0207698_10156366
873 Ga0209813_10002655
874 Ga0207428_10016140
875 Ga0268266_10293621
876 Ga0268265_10040054
877 Ga0268264_10013223
878 Ga0268264_10016171
879 Ga0268264_10054089
880 Ga0268264_10176747
881 Ga0268264_10634002
882 Ga0265336_10018061
883 Ga0265338_10262998
884 Ga0265320_10007003
885 Ga0265340_10027438
886 Ga0265339_10013175
887 Ga0265339_10197869
888 Ga0265327_10116545
889 Ga0265316_10247891
890 Ga0265314_10008448
891 Ga0265314_10036560
892 Ga0265342_10000184
893 Ga0307405_10104065
894 Ga0307405_10286084
895 Ga0307413_10000731
896 Ga0307413_10011824
897 Ga0307413_10315486
898 Ga0307410_10002540
899 Ga0307410_10040021
900 Ga0307406_10022874
901 Ga0307406_10501784
902 Ga0307407_10038798
903 Ga0307407_10270877
904 Ga0307412_10138491
905 Ga0307412_10147904
906 Ga0307412_10159772
907 Ga0307412_11011630
908 Ga0307409_100000298
909 Ga0307409_100073648
910 Ga0307409_100081041
911 Ga0307416_100255325
912 Ga0307416_100828867
913 Ga0307414_10008921
914 Ga0307414_10199293
915 Ga0307414_10443619
916 Ga0307411_10010749
917 Ga0307415_100491769
918 Ga0373952_0104287
919 Ga0373939_0161549
920 Ga0373941_0061529
921 Ga0373953_0334072
922 Ga0373956_0065983
923 Ga0373957_0084310
924 Ga0373960_0100902
925 Ga0373955_0037819
926 Ga0373924_0280068
927 Ga0373931_0019697
928 Ga0373931_0189322
929 Ga0373935_0259350
930 Ga0373927_0045053
931 Ga0373933_0004493
932 Ga0373925_0070585
933 Ga0395900_0373892
934 Ga0395901_0831513
935 Ga0436365_0789990
936 Ga0436363_0171090
937 Ga0436362_1265800
938 Ga0451791_0000913
939 Ga0451843_0975439
940 Ga0451853_0609682
941 Ga0439441_000728
942 Ga0439448_0009301
943 Ga0451577_0000002
944 Ga0466969_0008586
945 Ga0453683_0000003
946 Ga0453683_0000237
947 Ga0466965_0009174
948 Ga0466966_0002296
949 Ga0466961_0000873
950 Ga0453684_0000002
951 Ga0453684_0223987
952 Ga0453684_0878112
953 Ga0466959_0005181
954 Ga0451576_0000004
955 Ga0451576_0186378
956 Ga0451576_0586376
957 Ga0495580_0016760
958 Ga0495652_0652360
959 Ga0495658_0228682
960 Ga0496100_0054992
961 Ga0496101_0274029
962 Ga0496103_0062466
963 Ga0496104_0058069
964 Ga0496104_0398681
965 Ga0496105_0069188
966 Ga0496106_0108435
967 Ga0496109_0122215
968 Ga0496109_1093730
969 Ga0496110_0051844
970 Ga0496110_0764375
971 Ga0496111_0162958
972 Ga0496112_0011365
973 Ga0496114_0252111
974 Ga0496115_0181202
975 Ga0501034_0000638
976 Ga0501034_0002205
977 Ga0501039_0276257
978 Ga0501041_0236618
979 Ga0501068_0020072
980 Ga0501071_0005129
981 Ga0501072_0006991
982 Ga0501072_0034678
983 Ga0501073_0040031
984 Ga0501073_0057942
985 Ga0501073_0255945
986 Ga0501075_0379548
987 Ga0501259_039308
988 Ga0501080_0011171
989 Ga0501081_0994216
990 Ga0501044_0002349
991 Ga0501045_0067393
992 Ga0501045_0263631
993 nmdc:mga03683_101658_c1
994 nmdc:mga03n38_8847_c1
995 nmdc:mga00v17_31917_c1
996 nmdc:mga0yw44_11068_c1
997 nmdc:mga0k408_6724_c1
998 nmdc:mga04h51_6241_c1
999 nmdc:mga07m45_33445_c1
1000 nmdc:mga07m45_81086_c1
1001 nmdc:mga05p37_1090200_c1
1002 nmdc:mga05p37_274848_c1
1003 nmdc:mga05p37_33514_c1
1004 nmdc:mga09592_714620_c1
1005 nmdc:mga06r32_14617_c1
1006 nmdc:mga06r32_26181_c1
1007 nmdc:mga08y16_178182_c1
1008 nmdc:mga0n895_49162_c1
1009 nmdc:mga0n895_594531_c1
1010 nmdc:mga0a205_160746_c1
1011 nmdc:mga0a205_323300_c1
1012 nmdc:mga0a205_326088_c1
1013 nmdc:mga0sz30_22162_c1
1014 Ga0500610_0202295
1015 Ga0500562_020877
1016 Ga0500595_000009
1017 Ga0501084_0001475
1018 Ga0501082_0311757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

48

225

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9719 1 179
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9715 2 179
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9683 1 179
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9597 1 179
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9455 2 179
ID Description Score Start End Superfamily
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9767 1 181 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9752 1 178 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9687 1 179 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9508 1 181 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.928 1 179 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A1F5ANT2-F1-model_v4 DNA-3-methyladenine glycosylase 0.9983 13 180 GO:0006284
GO:0008725
GO:0046872
AF-A0A1F4AVK4-F1-model_v4 DNA-3-methyladenine glycosylase 0.9973 24 184 GO:0006284
GO:0008725
GO:0046872
AF-A0A496UUB5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.997 19 184 GO:0006284
GO:0008725
GO:0046872
AF-A0A357VPW6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9968 27 184 GO:0006284
GO:0008725
GO:0046872
AF-A0A838NVA1-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9967 2 184 GO:0006284
GO:0008725
GO:0046872

Map