F456815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 508 | 243 | 496 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300020610|Ga0154015_1148275|Ga0154015_11482751 |
| Length | 208 |
| Sequence | MDFQLQSDQELIHQYISGEEAGLVELIRRYQTKIYTSIYLMVKDEALAEDIFQDTFIKVINTLKGGRYNEEGKFLPWVTRIAHNLVIDHFRREKRTPVVNTGEDFDIFDVLGEYDESTEERMVRDQTHKDLKVLIQRLPDEQKEVLIMRHYGDLSFKEIAEITDVSINTALGRMRYALNNLRKMMQAKELSLKNXEVIKLFYNIFXIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 83 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 134 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 137 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 144 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 145 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 146 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 152 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 154 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 156 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 157 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 164 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 168 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 169 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 229 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 231 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 232 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 233 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 234 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 235 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 236 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 238 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 239 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 240 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 243 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.73 |
| Metatranscriptomes | 5.91 |
| Isolates | 2.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.51 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 88.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001766 | 3300001904 | Bacteria | 3896 |
| 2 | JGI24740J21852_10025067 | 3300001979 | Bacteria | 2015 |
| 3 | JGI24740J21852_10030751 | 3300001979 | Bacteria | 1742 |
| 4 | JGI24740J21852_10068470 | 3300001979 | Bacteria | 958 |
| 5 | JGI24739J22299_10020360 | 3300001989 | Bacteria | 2371 |
| 6 | JGI24737J22298_10001214 | 3300001990 | Bacteria | 9089 |
| 7 | JGI24737J22298_10003502 | 3300001990 | Bacteria | 5536 |
| 8 | JGI24737J22298_10006820 | 3300001990 | Bacteria | 3881 |
| 9 | JGI24737J22298_10019388 | 3300001990 | Bacteria | 2175 |
| 10 | JGI24735J21928_10000015 | 3300002067 | Bacteria | 167231 |
| 11 | JGI24744J21845_10006095 | 3300002077 | Bacteria | 2500 |
| 12 | JGI25162J39368_1000016 | 3300002737 | Bacteria | 288734 |
| 13 | JGI25162J39368_1003655 | 3300002737 | Bacteria | 4218 |
| 14 | JGI25157J39369_1005425 | 3300002741 | Bacteria | 2082 |
| 15 | JGI25157J39369_1009335 | 3300002741 | Bacteria | 1324 |
| 16 | JGI25164J39214_1000962 | 3300002772 | Bacteria | 9240 |
| 17 | JGI25165J46597_1000728 | 3300003214 | Bacteria | 25784 |
| 18 | rootH1_10000740 | 3300003316 | Bacteria | 16773 |
| 19 | rootH2_10011116 | 3300003320 | Bacteria | 111907 |
| 20 | rootH2_10012129 | 3300003320 | Bacteria | 47530 |
| 21 | rootH2_10147513 | 3300003320 | Bacteria | 1335 |
| 22 | rootL2_10047353 | 3300003322 | Bacteria | 4681 |
| 23 | rootH1_10133606 | 3300003323 | Bacteria | 6159 |
| 24 | rootH1_10140936 | 3300003323 | Bacteria | 5548 |
| 25 | rootH1_10165777 | 3300003323 | Bacteria | 2053 |
| 26 | rootH1_10199878 | 3300003323 | Bacteria | 1437 |
| 27 | Ga0058863_11430240 | 3300004799 | Bacteria | 668 |
| 28 | Ga0058863_11881952 | 3300004799 | Bacteria | 1957 |
| 29 | Ga0058862_12631684 | 3300004803 | Bacteria | 742 |
| 30 | Ga0065714_10003459 | 3300005288 | Bacteria | 7433 |
| 31 | Ga0065714_10115178 | 3300005288 | Bacteria | 1419 |
| 32 | Ga0070658_10000041 | 3300005327 | Bacteria | 134208 |
| 33 | Ga0070658_10607045 | 3300005327 | Bacteria | 948 |
| 34 | Ga0070676_10001756 | 3300005328 | Bacteria | 11020 |
| 35 | Ga0070683_100113524 | 3300005329 | Bacteria | 2557 |
| 36 | Ga0070680_100041095 | 3300005336 | Bacteria | 3749 |
| 37 | Ga0068868_100007276 | 3300005338 | Bacteria | 7874 |
| 38 | Ga0068868_100116630 | 3300005338 | Bacteria | 2175 |
| 39 | Ga0070660_100015981 | 3300005339 | Bacteria | 5436 |
| 40 | Ga0070660_100169924 | 3300005339 | Bacteria | 1760 |
| 41 | Ga0070660_100242603 | 3300005339 | Bacteria | 1468 |
| 42 | Ga0070674_100187064 | 3300005356 | Bacteria | 1590 |
| 43 | Ga0070674_100380033 | 3300005356 | Bacteria | 1149 |
| 44 | Ga0070673_100005959 | 3300005364 | Bacteria | 7880 |
| 45 | Ga0070659_100001388 | 3300005366 | Bacteria | 17468 |
| 46 | Ga0070659_100034141 | 3300005366 | Bacteria | 3955 |
| 47 | Ga0070659_100088730 | 3300005366 | Bacteria | 2477 |
| 48 | Ga0070663_100010142 | 3300005455 | Bacteria | 5862 |
| 49 | Ga0070678_100005395 | 3300005456 | Bacteria | 7377 |
| 50 | Ga0070662_100000020 | 3300005457 | Bacteria | 99425 |
| 51 | Ga0070662_100341628 | 3300005457 | Bacteria | 1225 |
| 52 | Ga0070681_10008323 | 3300005458 | Bacteria | 10161 |
| 53 | Ga0068867_100000492 | 3300005459 | Bacteria | 26405 |
| 54 | Ga0070679_100018533 | 3300005530 | Bacteria | 6757 |
| 55 | Ga0070679_100078639 | 3300005530 | Bacteria | 3287 |
| 56 | Ga0070684_100265653 | 3300005535 | Bacteria | 1570 |
| 57 | Ga0068853_100099138 | 3300005539 | Bacteria | 2574 |
| 58 | Ga0068853_100154440 | 3300005539 | Bacteria | 2067 |
| 59 | Ga0068853_100538903 | 3300005539 | Bacteria | 1105 |
| 60 | Ga0070665_100000125 | 3300005548 | Bacteria | 146809 |
| 61 | Ga0068855_100000246 | 3300005563 | Bacteria | 68191 |
| 62 | Ga0068855_100000522 | 3300005563 | Bacteria | 47210 |
| 63 | Ga0068855_100078023 | 3300005563 | Bacteria | 3842 |
| 64 | Ga0068855_100181837 | 3300005563 | Bacteria | 2377 |
| 65 | Ga0068855_100459299 | 3300005563 | Bacteria | 1389 |
| 66 | Ga0068857_100004876 | 3300005577 | Bacteria | 11384 |
| 67 | Ga0068857_100183228 | 3300005577 | Bacteria | 1906 |
| 68 | Ga0068857_100402531 | 3300005577 | Bacteria | 1274 |
| 69 | Ga0068857_100773148 | 3300005577 | Bacteria | 916 |
| 70 | Ga0068856_100000021 | 3300005614 | Bacteria | 145017 |
| 71 | Ga0068856_100000690 | 3300005614 | Bacteria | 36629 |
| 72 | Ga0068856_100253757 | 3300005614 | Bacteria | 1774 |
| 73 | Ga0068856_100513236 | 3300005614 | Bacteria | 1220 |
| 74 | Ga0068852_100003213 | 3300005616 | Bacteria | 11411 |
| 75 | Ga0068852_100767304 | 3300005616 | Bacteria | 977 |
| 76 | Ga0068866_10029400 | 3300005718 | Bacteria | 2628 |
| 77 | Ga0068870_10189667 | 3300005840 | Bacteria | 1239 |
| 78 | Ga0068858_100540066 | 3300005842 | Bacteria | 1128 |
| 79 | Ga0070716_100479171 | 3300006173 | Bacteria | 913 |
| 80 | Ga0075366_10136834 | 3300006195 | Bacteria | 1479 |
| 81 | Ga0097621_100000087 | 3300006237 | Bacteria | 49983 |
| 82 | Ga0075370_10265805 | 3300006353 | Bacteria | 1018 |
| 83 | Ga0068871_100000316 | 3300006358 | Bacteria | 33595 |
| 84 | Ga0068865_100000037 | 3300006881 | Bacteria | 81388 |
| 85 | Ga0105240_10000128 | 3300009093 | Bacteria | 156107 |
| 86 | Ga0105240_10001151 | 3300009093 | Bacteria | 46302 |
| 87 | Ga0105240_10003925 | 3300009093 | Bacteria | 22967 |
| 88 | Ga0105240_10004108 | 3300009093 | Bacteria | 22346 |
| 89 | Ga0105240_10034971 | 3300009093 | Bacteria | 6478 |
| 90 | Ga0105240_10206630 | 3300009093 | Bacteria | 2298 |
| 91 | Ga0105240_10375067 | 3300009093 | Bacteria | 1608 |
| 92 | Ga0105240_10758288 | 3300009093 | Bacteria | 1054 |
| 93 | Ga0105240_11070151 | 3300009093 | Bacteria | 859 |
| 94 | Ga0105245_11407772 | 3300009098 | Bacteria | 747 |
| 95 | Ga0105241_10001158 | 3300009174 | Bacteria | 20034 |
| 96 | Ga0105241_10014600 | 3300009174 | Bacteria | 5751 |
| 97 | Ga0105241_10020376 | 3300009174 | Bacteria | 4899 |
| 98 | Ga0105241_10061477 | 3300009174 | Bacteria | 2892 |
| 99 | Ga0105241_10170731 | 3300009174 | Bacteria | 1796 |
| 100 | Ga0105241_10432756 | 3300009174 | Bacteria | 1160 |
| 101 | Ga0105241_10521429 | 3300009174 | Bacteria | 1063 |
| 102 | Ga0105241_10622322 | 3300009174 | Bacteria | 977 |
| 103 | Ga0105242_10080972 | 3300009176 | Bacteria | 2714 |
| 104 | Ga0105237_10001477 | 3300009545 | Bacteria | 30982 |
| 105 | Ga0105237_10003841 | 3300009545 | Bacteria | 17658 |
| 106 | Ga0105237_10030008 | 3300009545 | Bacteria | 5524 |
| 107 | Ga0105237_10066536 | 3300009545 | Bacteria | 3598 |
| 108 | Ga0105237_10123858 | 3300009545 | Bacteria | 2579 |
| 109 | Ga0105237_10153447 | 3300009545 | Bacteria | 2300 |
| 110 | Ga0105237_10302290 | 3300009545 | Bacteria | 1603 |
| 111 | Ga0105238_10020471 | 3300009551 | Bacteria | 6735 |
| 112 | Ga0105249_10727383 | 3300009553 | Bacteria | 1054 |
| 113 | Ga0105239_10000077 | 3300010375 | Bacteria | 135944 |
| 114 | Ga0105239_10000115 | 3300010375 | Bacteria | 113217 |
| 115 | Ga0105239_10001575 | 3300010375 | Bacteria | 30140 |
| 116 | Ga0105239_10099247 | 3300010375 | Bacteria | 3219 |
| 117 | Ga0105239_10138106 | 3300010375 | Bacteria | 2714 |
| 118 | Ga0105239_10146938 | 3300010375 | Bacteria | 2630 |
| 119 | Ga0105239_11391897 | 3300010375 | Bacteria | 810 |
| 120 | Ga0105246_10035615 | 3300011119 | Bacteria | 3328 |
| 121 | Ga0157373_10000037 | 3300013100 | Bacteria | 121670 |
| 122 | Ga0157373_10002091 | 3300013100 | Bacteria | 15131 |
| 123 | Ga0157373_10023410 | 3300013100 | Bacteria | 4478 |
| 124 | Ga0157371_10000779 | 3300013102 | Bacteria | 36655 |
| 125 | Ga0157371_10000789 | 3300013102 | Bacteria | 36476 |
| 126 | Ga0157371_10068651 | 3300013102 | Bacteria | 2509 |
| 127 | Ga0157371_10073693 | 3300013102 | Bacteria | 2418 |
| 128 | Ga0157370_10035542 | 3300013104 | Bacteria | 4841 |
| 129 | Ga0157370_10081488 | 3300013104 | Bacteria | 3045 |
| 130 | Ga0157370_10148604 | 3300013104 | Bacteria | 2181 |
| 131 | Ga0157369_10000494 | 3300013105 | Bacteria | 52196 |
| 132 | Ga0157369_10072627 | 3300013105 | Bacteria | 3693 |
| 133 | Ga0157369_10085380 | 3300013105 | Bacteria | 3373 |
| 134 | Ga0157369_10379930 | 3300013105 | Bacteria | 1466 |
| 135 | Ga0157374_10000079 | 3300013296 | Bacteria | 95883 |
| 136 | Ga0157374_10004489 | 3300013296 | Bacteria | 11720 |
| 137 | Ga0157374_10096271 | 3300013296 | Bacteria | 2831 |
| 138 | Ga0157374_10182002 | 3300013296 | Bacteria | 2053 |
| 139 | Ga0157378_10021489 | 3300013297 | Bacteria | 5675 |
| 140 | Ga0157378_10026462 | 3300013297 | Bacteria | 5114 |
| 141 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 142 | Ga0163162_10025521 | 3300013306 | Bacteria | 5840 |
| 143 | Ga0163162_10260064 | 3300013306 | Bacteria | 1867 |
| 144 | Ga0163162_10314113 | 3300013306 | Bacteria | 1700 |
| 145 | Ga0163162_11343842 | 3300013306 | Bacteria | 812 |
| 146 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 147 | Ga0157372_10000354 | 3300013307 | Bacteria | 50294 |
| 148 | Ga0157372_10002722 | 3300013307 | Bacteria | 19119 |
| 149 | Ga0157372_10080251 | 3300013307 | Bacteria | 3691 |
| 150 | Ga0157372_10127572 | 3300013307 | Bacteria | 2925 |
| 151 | Ga0157372_10153667 | 3300013307 | Bacteria | 2657 |
| 152 | Ga0157372_10178627 | 3300013307 | Bacteria | 2457 |
| 153 | Ga0157372_12044500 | 3300013307 | Bacteria | 658 |
| 154 | Ga0157375_10016359 | 3300013308 | Bacteria | 6660 |
| 155 | Ga0157375_10075441 | 3300013308 | Bacteria | 3397 |
| 156 | Ga0157376_10016641 | 3300014969 | Bacteria | 5588 |
| 157 | Ga0163161_10098802 | 3300017792 | Bacteria | 2170 |
| 158 | Ga0197907_10223406 | 3300020069 | Bacteria | 853 |
| 159 | Ga0197907_10383471 | 3300020069 | Bacteria | 769 |
| 160 | Ga0206356_10519719 | 3300020070 | Bacteria | 744 |
| 161 | Ga0206356_11383104 | 3300020070 | Bacteria | 1295 |
| 162 | Ga0206349_1163599 | 3300020075 | Bacteria | 905 |
| 163 | Ga0206355_1160990 | 3300020076 | Bacteria | 927 |
| 164 | Ga0206351_10172501 | 3300020077 | Bacteria | 851 |
| 165 | Ga0206351_10652130 | 3300020077 | Bacteria | 1072 |
| 166 | Ga0206351_10856690 | 3300020077 | Bacteria | 1387 |
| 167 | Ga0206352_10097503 | 3300020078 | Bacteria | 989 |
| 168 | Ga0206352_10109355 | 3300020078 | Bacteria | 845 |
| 169 | Ga0206352_10795031 | 3300020078 | Bacteria | 766 |
| 170 | Ga0206352_11322963 | 3300020078 | Bacteria | 1098 |
| 171 | Ga0206350_10926275 | 3300020080 | Bacteria | 1125 |
| 172 | Ga0206354_10869162 | 3300020081 | Bacteria | 782 |
| 173 | Ga0206353_10436112 | 3300020082 | Bacteria | 822 |
| 174 | Ga0206353_11307885 | 3300020082 | Bacteria | 739 |
| 175 | Ga0206353_11879347 | 3300020082 | Bacteria | 790 |
| 176 | Ga0154015_1148275 | 3300020610 | Bacteria | 1111 |
| 177 | Ga0154015_1391960 | 3300020610 | Bacteria | 903 |
| 178 | Ga0154015_1512965 | 3300020610 | Bacteria | 817 |
| 179 | Ga0213872_10003111 | 3300021361 | Bacteria | 9325 |
| 180 | Ga0224712_10032775 | 3300022467 | Bacteria | 1896 |
| 181 | Ga0224712_10193347 | 3300022467 | Bacteria | 922 |
| 182 | Ga0207427_100210 | 3300025231 | Bacteria | 53314 |
| 183 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 184 | Ga0209437_100119 | 3300025233 | Bacteria | 206549 |
| 185 | Ga0209258_109786 | 3300025242 | Bacteria | 1272 |
| 186 | Ga0209026_1000273 | 3300025250 | Bacteria | 61449 |
| 187 | Ga0209026_1002520 | 3300025250 | Bacteria | 6785 |
| 188 | Ga0209026_1009337 | 3300025250 | Bacteria | 1936 |
| 189 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 190 | Ga0209233_1016140 | 3300025261 | Bacteria | 2064 |
| 191 | Ga0209233_1019840 | 3300025261 | Bacteria | 1777 |
| 192 | Ga0209455_1004196 | 3300025272 | Bacteria | 4815 |
| 193 | Ga0207642_10096311 | 3300025899 | Bacteria | 1475 |
| 194 | Ga0207647_10000510 | 3300025904 | Bacteria | 30942 |
| 195 | Ga0207647_10002531 | 3300025904 | Bacteria | 13846 |
| 196 | Ga0207647_10039254 | 3300025904 | Bacteria | 2989 |
| 197 | Ga0207645_10000177 | 3300025907 | Bacteria | 51193 |
| 198 | Ga0207643_10149056 | 3300025908 | Bacteria | 1401 |
| 199 | Ga0207705_10000068 | 3300025909 | Bacteria | 134316 |
| 200 | Ga0207705_10243158 | 3300025909 | Bacteria | 1371 |
| 201 | Ga0207705_10346757 | 3300025909 | Bacteria | 1143 |
| 202 | Ga0207654_10040031 | 3300025911 | Bacteria | 2640 |
| 203 | Ga0207654_10111983 | 3300025911 | Bacteria | 1700 |
| 204 | Ga0207654_10201285 | 3300025911 | Bacteria | 1311 |
| 205 | Ga0207654_10328296 | 3300025911 | Bacteria | 1048 |
| 206 | Ga0207654_10546231 | 3300025911 | Bacteria | 822 |
| 207 | Ga0207707_10037119 | 3300025912 | Bacteria | 4258 |
| 208 | Ga0207695_10000179 | 3300025913 | Bacteria | 185564 |
| 209 | Ga0207695_10007041 | 3300025913 | Bacteria | 14430 |
| 210 | Ga0207695_10019972 | 3300025913 | Bacteria | 7690 |
| 211 | Ga0207695_10026913 | 3300025913 | Bacteria | 6410 |
| 212 | Ga0207695_10086228 | 3300025913 | Bacteria | 3167 |
| 213 | Ga0207695_10089358 | 3300025913 | Bacteria | 3098 |
| 214 | Ga0207695_10510434 | 3300025913 | Bacteria | 1084 |
| 215 | Ga0207695_10534123 | 3300025913 | Bacteria | 1054 |
| 216 | Ga0207695_10638457 | 3300025913 | Bacteria | 946 |
| 217 | Ga0207671_10000112 | 3300025914 | Bacteria | 125310 |
| 218 | Ga0207671_10000960 | 3300025914 | Bacteria | 35779 |
| 219 | Ga0207671_10005493 | 3300025914 | Bacteria | 11661 |
| 220 | Ga0207671_10008531 | 3300025914 | Bacteria | 8675 |
| 221 | Ga0207671_10009607 | 3300025914 | Bacteria | 8064 |
| 222 | Ga0207660_10144129 | 3300025917 | Bacteria | 1824 |
| 223 | Ga0207657_10056157 | 3300025919 | Bacteria | 3398 |
| 224 | Ga0207657_10060238 | 3300025919 | Bacteria | 3258 |
| 225 | Ga0207657_10230905 | 3300025919 | Bacteria | 1480 |
| 226 | Ga0207657_10369657 | 3300025919 | Bacteria | 1130 |
| 227 | Ga0207652_10067236 | 3300025921 | Bacteria | 3107 |
| 228 | Ga0207652_10535397 | 3300025921 | Bacteria | 1053 |
| 229 | Ga0207652_10616830 | 3300025921 | Bacteria | 972 |
| 230 | Ga0207694_10014678 | 3300025924 | Bacteria | 5905 |
| 231 | Ga0207690_10000451 | 3300025932 | Bacteria | 26612 |
| 232 | Ga0207690_10007155 | 3300025932 | Bacteria | 6627 |
| 233 | Ga0207690_10116339 | 3300025932 | Bacteria | 1934 |
| 234 | Ga0207706_10000044 | 3300025933 | Bacteria | 123576 |
| 235 | Ga0207706_10285634 | 3300025933 | Bacteria | 1439 |
| 236 | Ga0207704_10000023 | 3300025938 | Bacteria | 142638 |
| 237 | Ga0207689_10607957 | 3300025942 | Bacteria | 920 |
| 238 | Ga0207689_11011535 | 3300025942 | Bacteria | 701 |
| 239 | Ga0207661_10074947 | 3300025944 | Bacteria | 2775 |
| 240 | Ga0207667_10000197 | 3300025949 | Bacteria | 87987 |
| 241 | Ga0207667_10002511 | 3300025949 | Bacteria | 22878 |
| 242 | Ga0207667_10018698 | 3300025949 | Bacteria | 7764 |
| 243 | Ga0207667_10034683 | 3300025949 | Bacteria | 5417 |
| 244 | Ga0207667_10153235 | 3300025949 | Bacteria | 2372 |
| 245 | Ga0207667_10190540 | 3300025949 | Bacteria | 2104 |
| 246 | Ga0207667_10356377 | 3300025949 | Bacteria | 1492 |
| 247 | Ga0207651_10032634 | 3300025960 | Bacteria | 3348 |
| 248 | Ga0207677_10009389 | 3300026023 | Bacteria | 5505 |
| 249 | Ga0207677_10010261 | 3300026023 | Bacteria | 5295 |
| 250 | Ga0207703_10234413 | 3300026035 | Bacteria | 1647 |
| 251 | Ga0207639_10042513 | 3300026041 | Bacteria | 3406 |
| 252 | Ga0207639_10055929 | 3300026041 | Bacteria | 3022 |
| 253 | Ga0207639_10192522 | 3300026041 | Bacteria | 1743 |
| 254 | Ga0207678_10032612 | 3300026067 | Bacteria | 4540 |
| 255 | Ga0207702_10000217 | 3300026078 | Bacteria | 67356 |
| 256 | Ga0207702_10010662 | 3300026078 | Bacteria | 7678 |
| 257 | Ga0207702_10042533 | 3300026078 | Bacteria | 3811 |
| 258 | Ga0207702_11503483 | 3300026078 | Bacteria | 667 |
| 259 | Ga0207648_10000774 | 3300026089 | Bacteria | 36044 |
| 260 | Ga0207674_10209112 | 3300026116 | Bacteria | 1900 |
| 261 | Ga0207674_10340141 | 3300026116 | Bacteria | 1451 |
| 262 | Ga0207683_10000934 | 3300026121 | Bacteria | 26876 |
| 263 | Ga0207698_10011046 | 3300026142 | Bacteria | 5838 |
| 264 | Ga0209995_1003843 | 3300027471 | Bacteria | 2396 |
| 265 | Ga0268266_10000132 | 3300028379 | Bacteria | 145563 |
| 266 | Ga0265337_1087770 | 3300028556 | Bacteria | 849 |
| 267 | Ga0265326_10013848 | 3300028558 | Bacteria | 2353 |
| 268 | Ga0265323_10045679 | 3300028653 | Bacteria | 1573 |
| 269 | Ga0265322_10045535 | 3300028654 | Bacteria | 1248 |
| 270 | Ga0265336_10029149 | 3300028666 | Bacteria | 1723 |
| 271 | Ga0307517_10003919 | 3300028786 | Bacteria | 23073 |
| 272 | Ga0307515_10001436 | 3300028794 | Bacteria | 53821 |
| 273 | Ga0265338_10001644 | 3300028800 | Bacteria | 35766 |
| 274 | Ga0265338_10092436 | 3300028800 | Bacteria | 2495 |
| 275 | Ga0265338_10151277 | 3300028800 | Bacteria | 1803 |
| 276 | Ga0316181_1085268 | 3300030744 | Bacteria | 1075 |
| 277 | Ga0265330_10105226 | 3300031235 | Bacteria | 1207 |
| 278 | Ga0265320_10036674 | 3300031240 | Bacteria | 2476 |
| 279 | Ga0265327_10000684 | 3300031251 | Bacteria | 54331 |
| 280 | Ga0265327_10201729 | 3300031251 | Bacteria | 900 |
| 281 | Ga0265316_10001738 | 3300031344 | Bacteria | 23105 |
| 282 | Ga0265316_10008450 | 3300031344 | Bacteria | 9552 |
| 283 | Ga0307513_10369573 | 3300031456 | Bacteria | 1177 |
| 284 | Ga0307408_100000333 | 3300031548 | Bacteria | 44985 |
| 285 | Ga0307408_100003885 | 3300031548 | Bacteria | 10171 |
| 286 | Ga0316579_10069616 | 3300031691 | Bacteria | 1665 |
| 287 | Ga0316576_10043392 | 3300031727 | Bacteria | 3244 |
| 288 | Ga0316576_10167046 | 3300031727 | Bacteria | 1660 |
| 289 | Ga0316578_10048391 | 3300031728 | Bacteria | 2483 |
| 290 | Ga0316578_10183704 | 3300031728 | Bacteria | 1260 |
| 291 | Ga0316577_10007652 | 3300031733 | Bacteria | 5766 |
| 292 | Ga0316577_10112091 | 3300031733 | Bacteria | 1531 |
| 293 | Ga0316577_10150274 | 3300031733 | Bacteria | 1313 |
| 294 | Ga0316577_10163678 | 3300031733 | Bacteria | 1255 |
| 295 | Ga0307412_10129143 | 3300031911 | Bacteria | 1833 |
| 296 | Ga0307416_100408956 | 3300032002 | Bacteria | 1397 |
| 297 | Ga0307414_10015976 | 3300032004 | Bacteria | 4549 |
| 298 | Ga0307414_10714305 | 3300032004 | Bacteria | 908 |
| 299 | Ga0307411_10004168 | 3300032005 | Bacteria | 6872 |
| 300 | Ga0316585_10073063 | 3300032137 | Unclassified | 1114 |
| 301 | Ga0316593_10083210 | 3300032168 | Bacteria | 1119 |
| 302 | Ga0307507_10000099 | 3300033179 | Bacteria | 139532 |
| 303 | Ga0316588_1075531 | 3300033528 | Bacteria | 830 |
| 304 | Ga0316574_0302800 | 3300035398 | Unclassified | 1016 |
| 305 | Ga0316574_0438982 | 3300035398 | Bacteria | 819 |
| 306 | Ga0316582_0024278 | 3300036647 | Bacteria | 3627 |
| 307 | Ga0316582_0109295 | 3300036647 | Bacteria | 1839 |
| 308 | Ga0316582_0308127 | 3300036647 | Bacteria | 1088 |
| 309 | Ga0316584_0002814 | 3300036712 | Bacteria | 11151 |
| 310 | Ga0316584_0017986 | 3300036712 | Bacteria | 5093 |
| 311 | Ga0316584_0243391 | 3300036712 | Unclassified | 1316 |
| 312 | Ga0316584_0295312 | 3300036712 | Bacteria | 1174 |
| 313 | Ga0316584_0456440 | 3300036712 | Bacteria | 903 |
| 314 | Ga0373925_0582840 | 3300037068 | Bacteria | 921 |
| 315 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 316 | Ga0395899_0000553 | 3300037312 | Bacteria | 40280 |
| 317 | Ga0395899_0003210 | 3300037312 | Bacteria | 12964 |
| 318 | Ga0395899_0030156 | 3300037312 | Bacteria | 4080 |
| 319 | Ga0395900_0000314 | 3300037418 | Bacteria | 71758 |
| 320 | Ga0395900_0001300 | 3300037418 | Bacteria | 30387 |
| 321 | Ga0395900_0091169 | 3300037418 | Bacteria | 3132 |
| 322 | Ga0395900_0124833 | 3300037418 | Bacteria | 2640 |
| 323 | Ga0395905_0000477 | 3300037471 | Bacteria | 55299 |
| 324 | Ga0395905_0000757 | 3300037471 | Bacteria | 42574 |
| 325 | Ga0395901_0005968 | 3300038443 | Bacteria | 12332 |
| 326 | Ga0395901_0105892 | 3300038443 | Bacteria | 2952 |
| 327 | Ga0400483_116008 | 3300039062 | Bacteria | 1333 |
| 328 | Ga0400489_30105 | 3300039093 | Bacteria | 2333 |
| 329 | Ga0400489_33891 | 3300039093 | Bacteria | 2870 |
| 330 | Ga0436361_0417016 | 3300039447 | Bacteria | 15796 |
| 331 | Ga0451793_1655927 | 3300041452 | Bacteria | 677 |
| 332 | Ga0451855_0832352 | 3300041511 | Bacteria | 1457 |
| 333 | Ga0439448_0001231 | 3300042005 | Bacteria | 6540 |
| 334 | Ga0439462_0047723 | 3300042015 | Bacteria | 1148 |
| 335 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 336 | Ga0451577_0004955 | 3300042876 | Bacteria | 13841 |
| 337 | Ga0451577_0005419 | 3300042876 | Bacteria | 13083 |
| 338 | Ga0451577_0012359 | 3300042876 | Bacteria | 8017 |
| 339 | Ga0451577_0323721 | 3300042876 | Bacteria | 1398 |
| 340 | Ga0451577_0388630 | 3300042876 | Bacteria | 1266 |
| 341 | Ga0451577_0448630 | 3300042876 | Bacteria | 1171 |
| 342 | Ga0451577_0507395 | 3300042876 | Bacteria | 1095 |
| 343 | Ga0451577_0879551 | 3300042876 | Bacteria | 807 |
| 344 | Ga0451577_0943037 | 3300042876 | Bacteria | 776 |
| 345 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 346 | Ga0453683_0000310 | 3300044673 | Bacteria | 61336 |
| 347 | Ga0453683_0004273 | 3300044673 | Bacteria | 10189 |
| 348 | Ga0453683_0179298 | 3300044673 | Bacteria | 1343 |
| 349 | Ga0453683_0462149 | 3300044673 | Bacteria | 821 |
| 350 | Ga0453683_0547773 | 3300044673 | Bacteria | 752 |
| 351 | Ga0453683_0557764 | 3300044673 | Bacteria | 745 |
| 352 | Ga0466966_0024494 | 3300044684 | Bacteria | 3946 |
| 353 | Ga0466961_0016933 | 3300044693 | Bacteria | 4684 |
| 354 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 355 | Ga0453684_0000628 | 3300044712 | Bacteria | 128416 |
| 356 | Ga0453684_0000771 | 3300044712 | Bacteria | 110664 |
| 357 | Ga0453684_0001093 | 3300044712 | Bacteria | 85531 |
| 358 | Ga0453684_0001226 | 3300044712 | Bacteria | 78620 |
| 359 | Ga0453684_0004535 | 3300044712 | Bacteria | 29128 |
| 360 | Ga0453684_0011107 | 3300044712 | Bacteria | 15193 |
| 361 | Ga0453684_0012143 | 3300044712 | Bacteria | 14289 |
| 362 | Ga0453684_0019447 | 3300044712 | Bacteria | 10341 |
| 363 | Ga0453684_0020001 | 3300044712 | Bacteria | 10145 |
| 364 | Ga0453684_0023016 | 3300044712 | Bacteria | 9208 |
| 365 | Ga0453684_0033679 | 3300044712 | Bacteria | 7134 |
| 366 | Ga0453684_0063426 | 3300044712 | Bacteria | 4727 |
| 367 | Ga0453684_0075361 | 3300044712 | Bacteria | 4241 |
| 368 | Ga0453684_0087321 | 3300044712 | Bacteria | 3866 |
| 369 | Ga0453684_0092525 | 3300044712 | Bacteria | 3727 |
| 370 | Ga0453684_0149583 | 3300044712 | Bacteria | 2777 |
| 371 | Ga0453684_0160316 | 3300044712 | Bacteria | 2661 |
| 372 | Ga0453684_0375907 | 3300044712 | Bacteria | 1596 |
| 373 | Ga0453684_0377590 | 3300044712 | Bacteria | 1592 |
| 374 | Ga0453684_0506198 | 3300044712 | Bacteria | 1336 |
| 375 | Ga0453684_0520074 | 3300044712 | Bacteria | 1315 |
| 376 | Ga0453684_0594726 | 3300044712 | Bacteria | 1213 |
| 377 | Ga0453684_0972508 | 3300044712 | Bacteria | 904 |
| 378 | Ga0453684_1383893 | 3300044712 | Bacteria | 730 |
| 379 | Ga0453684_1733594 | 3300044712 | Bacteria | 637 |
| 380 | Ga0466968_0162798 | 3300044735 | Bacteria | 1030 |
| 381 | Ga0466959_0109148 | 3300045049 | Bacteria | 1976 |
| 382 | Ga0451576_0000022 | 3300045051 | Bacteria | 495037 |
| 383 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 384 | Ga0451576_0000339 | 3300045051 | Bacteria | 112422 |
| 385 | Ga0451576_0001565 | 3300045051 | Bacteria | 38496 |
| 386 | Ga0451576_0004822 | 3300045051 | Bacteria | 17268 |
| 387 | Ga0451576_0010058 | 3300045051 | Bacteria | 10892 |
| 388 | Ga0451576_0054235 | 3300045051 | Bacteria | 4198 |
| 389 | Ga0451576_0145641 | 3300045051 | Bacteria | 2469 |
| 390 | Ga0451576_0153039 | 3300045051 | Bacteria | 2405 |
| 391 | Ga0451576_0178444 | 3300045051 | Bacteria | 2217 |
| 392 | Ga0451576_0262855 | 3300045051 | Unclassified | 1804 |
| 393 | Ga0451576_0544294 | 3300045051 | Bacteria | 1220 |
| 394 | Ga0451576_0853297 | 3300045051 | Unclassified | 956 |
| 395 | Ga0451576_1385915 | 3300045051 | Bacteria | 732 |
| 396 | Ga0466958_0152249 | 3300045836 | Bacteria | 1459 |
| 397 | Ga0495651_0207294 | 3300046462 | Bacteria | 1367 |
| 398 | Ga0495653_0559744 | 3300046463 | Bacteria | 707 |
| 399 | Ga0495650_0000144 | 3300046471 | Bacteria | 165957 |
| 400 | Ga0495650_0023355 | 3300046471 | Bacteria | 2946 |
| 401 | Ga0495650_0192828 | 3300046471 | Bacteria | 711 |
| 402 | Ga0495585_0000312 | 3300046492 | Bacteria | 48297 |
| 403 | Ga0495585_0000348 | 3300046492 | Bacteria | 44925 |
| 404 | Ga0495585_0133678 | 3300046492 | Bacteria | 1304 |
| 405 | Ga0495596_0012521 | 3300046500 | Bacteria | 3631 |
| 406 | Ga0495583_0013618 | 3300046506 | Bacteria | 4525 |
| 407 | Ga0495583_0191480 | 3300046506 | Bacteria | 834 |
| 408 | Ga0495606_0000926 | 3300046507 | Bacteria | 43259 |
| 409 | Ga0495606_0004458 | 3300046507 | Bacteria | 13979 |
| 410 | Ga0495606_0016626 | 3300046507 | Bacteria | 5600 |
| 411 | Ga0495606_0019604 | 3300046507 | Bacteria | 5023 |
| 412 | Ga0495606_0129698 | 3300046507 | Bacteria | 1500 |
| 413 | Ga0495610_0001817 | 3300046512 | Bacteria | 18559 |
| 414 | Ga0495616_0000915 | 3300046513 | Bacteria | 21238 |
| 415 | Ga0495616_0009552 | 3300046513 | Bacteria | 5663 |
| 416 | Ga0495631_0007237 | 3300046518 | Bacteria | 5658 |
| 417 | Ga0495632_0059924 | 3300046519 | Bacteria | 1851 |
| 418 | Ga0495637_0153327 | 3300046520 | Bacteria | 868 |
| 419 | Ga0495644_0002551 | 3300046523 | Bacteria | 7246 |
| 420 | Ga0495648_0006389 | 3300046524 | Bacteria | 9632 |
| 421 | Ga0495652_0075466 | 3300046529 | Bacteria | 2800 |
| 422 | Ga0495654_0067789 | 3300046530 | Bacteria | 1698 |
| 423 | Ga0495609_0051153 | 3300046538 | Bacteria | 1840 |
| 424 | Ga0495609_0084895 | 3300046538 | Bacteria | 1381 |
| 425 | Ga0495622_0125095 | 3300046557 | Bacteria | 1173 |
| 426 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 427 | Ga0495633_0001260 | 3300046558 | Bacteria | 20176 |
| 428 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 429 | Ga0495668_0095002 | 3300046616 | Bacteria | 1632 |
| 430 | Ga0495611_0036219 | 3300046648 | Bacteria | 2189 |
| 431 | Ga0495625_0000059 | 3300046660 | Bacteria | 180330 |
| 432 | Ga0495625_0000371 | 3300046660 | Bacteria | 68809 |
| 433 | Ga0495625_0002039 | 3300046660 | Bacteria | 22734 |
| 434 | Ga0495625_0013917 | 3300046660 | Bacteria | 6442 |
| 435 | Ga0495625_0083499 | 3300046660 | Bacteria | 2220 |
| 436 | Ga0495625_0086996 | 3300046660 | Bacteria | 2167 |
| 437 | Ga0495625_0106562 | 3300046660 | Bacteria | 1919 |
| 438 | Ga0495625_0160849 | 3300046660 | Bacteria | 1504 |
| 439 | Ga0495625_0277941 | 3300046660 | Bacteria | 1078 |
| 440 | Ga0495661_0005900 | 3300046665 | Bacteria | 8655 |
| 441 | Ga0495661_0011405 | 3300046665 | Bacteria | 6033 |
| 442 | Ga0495661_0023017 | 3300046665 | Bacteria | 4049 |
| 443 | Ga0495661_0195110 | 3300046665 | Bacteria | 1064 |
| 444 | Ga0495671_0129110 | 3300046692 | Bacteria | 1233 |
| 445 | Ga0495649_0000031 | 3300046694 | Bacteria | 151547 |
| 446 | Ga0495649_0159314 | 3300046694 | Bacteria | 1184 |
| 447 | Ga0495660_0021597 | 3300046810 | Bacteria | 3685 |
| 448 | Ga0495660_0096196 | 3300046810 | Bacteria | 1531 |
| 449 | Ga0495683_0141850 | 3300047323 | Bacteria | 1125 |
| 450 | Ga0495687_000601 | 3300047443 | Bacteria | 42037 |
| 451 | Ga0495687_000783 | 3300047443 | Bacteria | 34231 |
| 452 | Ga0495679_054800 | 3300047446 | Bacteria | 1186 |
| 453 | Ga0495673_0033046 | 3300047469 | Bacteria | 2405 |
| 454 | Ga0495686_0001365 | 3300047472 | Bacteria | 27228 |
| 455 | Ga0495686_0016930 | 3300047472 | Bacteria | 4925 |
| 456 | Ga0495686_0160705 | 3300047472 | Bacteria | 1313 |
| 457 | Ga0495686_0347225 | 3300047472 | Bacteria | 807 |
| 458 | Ga0495614_0008920 | 3300048089 | Bacteria | 4449 |
| 459 | Ga0496115_0046402 | 3300048918 | Bacteria | 3472 |
| 460 | Ga0495678_011997 | 3300049459 | Bacteria | 4124 |
| 461 | Ga0501031_0001144 | 3300049568 | Bacteria | 16132 |
| 462 | Ga0501032_0001137 | 3300049569 | Bacteria | 21289 |
| 463 | Ga0501032_0016665 | 3300049569 | Bacteria | 5165 |
| 464 | Ga0501032_0018914 | 3300049569 | Bacteria | 4820 |
| 465 | Ga0501033_0000045 | 3300049570 | Bacteria | 126661 |
| 466 | Ga0501034_0000682 | 3300049571 | Bacteria | 51648 |
| 467 | Ga0501034_0489919 | 3300049571 | Bacteria | 1144 |
| 468 | Ga0501036_0078269 | 3300049572 | Bacteria | 2796 |
| 469 | Ga0501037_0017262 | 3300049573 | Bacteria | 5314 |
| 470 | Ga0501038_0006162 | 3300049574 | Bacteria | 11095 |
| 471 | Ga0501038_0044033 | 3300049574 | Bacteria | 3880 |
| 472 | Ga0501039_0001690 | 3300049575 | Bacteria | 16270 |
| 473 | Ga0501048_0240343 | 3300049582 | Bacteria | 1285 |
| 474 | Ga0501067_0375167 | 3300049583 | Bacteria | 793 |
| 475 | Ga0501068_0011860 | 3300049584 | Bacteria | 4926 |
| 476 | Ga0501079_1185840 | 3300049741 | Unclassified | 601 |
| 477 | Ga0501035_0056652 | 3300049822 | Bacteria | 3496 |
| 478 | Ga0501035_1111876 | 3300049822 | Bacteria | 617 |
| 479 | Ga0501044_0000502 | 3300049823 | Bacteria | 47572 |
| 480 | Ga0501045_0000133 | 3300049824 | Bacteria | 39066 |
| 481 | nmdc:mga0k408_69534_c1 | 3300050493 | Bacteria | 2055 |
| 482 | nmdc:mga0k408_7957_c1 | 3300050493 | Bacteria | 5679 |
| 483 | nmdc:mga07m45_153735_c1 | 3300050496 | Bacteria | 1334 |
| 484 | nmdc:mga07m45_246495_c1 | 3300050496 | Bacteria | 1039 |
| 485 | Ga0500635_0000274 | 3300053080 | Bacteria | 19596 |
| 486 | Ga0500646_0030180 | 3300053090 | Bacteria | 1487 |
| 487 | Ga0500650_0045775 | 3300053098 | Bacteria | 2027 |
| 488 | Ga0500608_018660 | 3300053122 | Bacteria | 3168 |
| 489 | Ga0500614_003147 | 3300053123 | Bacteria | 3577 |
| 490 | Ga0500618_000018 | 3300053125 | Bacteria | 163272 |
| 491 | Ga0500564_137417 | 3300053138 | Bacteria | 1052 |
| 492 | Ga0500622_0011822 | 3300053156 | Bacteria | 4744 |
| 493 | Ga0500624_013495 | 3300053157 | Bacteria | 1223 |
| 494 | Ga0500634_0107315 | 3300053161 | Bacteria | 1385 |
| 495 | Ga0587098_025178 | 3300059604 | Bacteria | 785 |
| 496 | Ga0587067_078677 | 3300059640 | Bacteria | 726 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_1185840 | Ga0501079_1185840_70_591 | 169 |
| 2 | 3300049822 | Ga0501035_1111876 | Ga0501035_1111876_10_531 | 169 |
| 3 | 3300053090 | Ga0500646_0030180 | Ga0500646_0030180_12_521 | 169 |
| 4 | 3300001990 | JGI24737J22298_10019388 | JGI24737J22298_100193882 | 175 |
| 5 | 3300044712 | Ga0453684_0000771 | Ga0453684_0000771_12279_12812 | 175 |
| 6 | 3300044712 | Ga0453684_0972508 | Ga0453684_0972508_147_680 | 175 |
| 7 | 3300039093 | Ga0400489_33891 | Ga0400489_33891_1138_1671 | 176 |
| 8 | 3300044712 | Ga0453684_1383893 | Ga0453684_1383893_101_688 | 176 |
| 9 | 3300045051 | Ga0451576_0544294 | Ga0451576_0544294_443_1030 | 176 |
| 10 | 3300031733 | Ga0316577_10112091 | Ga0316577_101120911 | 177 |
| 11 | 3300036712 | Ga0316584_0243391 | Ga0316584_0243391_11_547 | 177 |
| 12 | 3300039093 | Ga0400489_30105 | Ga0400489_30105_1349_1885 | 177 |
| 13 | 3300013104 | Ga0157370_10081488 | Ga0157370_100814882 | 179 |
| 14 | 3300044712 | Ga0453684_0063426 | Ga0453684_0063426_3674_4219 | 179 |
| 15 | 3300049569 | Ga0501032_0016665 | Ga0501032_0016665_2252_2803 | 179 |
| 16 | 3300049584 | Ga0501068_0011860 | Ga0501068_0011860_1266_1817 | 179 |
| 17 | 3300028558 | Ga0265326_10013848 | Ga0265326_100138482 | 181 |
| 18 | 3300031240 | Ga0265320_10036674 | Ga0265320_100366742 | 181 |
| 19 | 3300031691 | Ga0316579_10069616 | Ga0316579_100696162 | 189 |
| 20 | 3300031728 | Ga0316578_10048391 | Ga0316578_100483912 | 189 |
| 21 | 3300044712 | Ga0453684_0012143 | Ga0453684_0012143_182_757 | 189 |
| 22 | 3300044712 | Ga0453684_0023016 | Ga0453684_0023016_6328_6900 | 189 |
| 23 | 3300044712 | Ga0453684_0375907 | Ga0453684_0375907_69_644 | 189 |
| 24 | 3300044712 | Ga0453684_1733594 | Ga0453684_1733594_15_590 | 189 |
| 25 | iso_pu_bacteria | 2599185184 | 2599481687 | 190 |
| 26 | iso_pu_bacteria | 2852623160 | 2852625869 | 190 |
| 27 | iso_pu_bacteria | 2857627736 | 2857631265 | 190 |
| 28 | iso_pu_bacteria | 2884933994 | 2884935608 | 190 |
| 29 | iso_pu_bacteria | 2890804823 | 2890805674 | 190 |
| 30 | iso_pu_bacteria | 2919437846 | 2919440499 | 190 |
| 31 | iso_pu_bacteria | 2928078545 | 2928082172 | 190 |
| 32 | iso_pu_bacteria | 2928147474 | 2928149252 | 190 |
| 33 | iso_pu_bacteria | 2932082852 | 2932087688 | 190 |
| 34 | iso_pu_bacteria | 2977232053 | 2977235333 | 190 |
| 35 | iso_pu_bacteria | 8036736890 | 8036738293 | 190 |
| 36 | iso_pu_bacteria | 8055588893 | 8055589958 | 190 |
| 37 | 3300031344 | Ga0265316_10001738 | Ga0265316_1000173818 | 192 |
| 38 | 3300031733 | Ga0316577_10007652 | Ga0316577_100076528 | 192 |
| 39 | 3300036647 | Ga0316582_0024278 | Ga0316582_0024278_539_1132 | 192 |
| 40 | 3300036712 | Ga0316584_0002814 | Ga0316584_0002814_8019_8612 | 192 |
| 41 | 3300001904 | JGI24736J21556_1001766 | JGI24736J21556_10017665 | 194 |
| 42 | 3300001979 | JGI24740J21852_10025067 | JGI24740J21852_100250674 | 194 |
| 43 | 3300001979 | JGI24740J21852_10030751 | JGI24740J21852_100307512 | 194 |
| 44 | 3300001979 | JGI24740J21852_10068470 | JGI24740J21852_100684701 | 194 |
| 45 | 3300001989 | JGI24739J22299_10020360 | JGI24739J22299_100203604 | 194 |
| 46 | 3300001990 | JGI24737J22298_10001214 | JGI24737J22298_100012148 | 194 |
| 47 | 3300001990 | JGI24737J22298_10003502 | JGI24737J22298_100035022 | 194 |
| 48 | 3300001990 | JGI24737J22298_10006820 | JGI24737J22298_100068203 | 194 |
| 49 | 3300002067 | JGI24735J21928_10000015 | JGI24735J21928_1000001586 | 194 |
| 50 | 3300002077 | JGI24744J21845_10006095 | JGI24744J21845_100060951 | 194 |
| 51 | 3300002737 | JGI25162J39368_1000016 | JGI25162J39368_1000016145 | 194 |
| 52 | 3300002737 | JGI25162J39368_1003655 | JGI25162J39368_10036552 | 194 |
| 53 | 3300002741 | JGI25157J39369_1005425 | JGI25157J39369_10054253 | 194 |
| 54 | 3300002741 | JGI25157J39369_1009335 | JGI25157J39369_10093352 | 194 |
| 55 | 3300002772 | JGI25164J39214_1000962 | JGI25164J39214_10009623 | 194 |
| 56 | 3300003214 | JGI25165J46597_1000728 | JGI25165J46597_100072822 | 194 |
| 57 | 3300003316 | rootH1_10000740 | rootH1_1000074017 | 194 |
| 58 | 3300003320 | rootH2_10011116 | rootH2_1001111640 | 194 |
| 59 | 3300003320 | rootH2_10012129 | rootH2_1001212920 | 194 |
| 60 | 3300003320 | rootH2_10147513 | rootH2_101475131 | 194 |
| 61 | 3300003322 | rootL2_10047353 | rootL2_100473534 | 194 |
| 62 | 3300003323 | rootH1_10133606 | rootH1_101336067 | 194 |
| 63 | 3300003323 | rootH1_10140936 | rootH1_101409362 | 194 |
| 64 | 3300003323 | rootH1_10165777 | rootH1_101657773 | 194 |
| 65 | 3300003323 | rootH1_10199878 | rootH1_101998782 | 194 |
| 66 | 3300004799 | Ga0058863_11430240 | Ga0058863_114302401 | 194 |
| 67 | 3300004799 | Ga0058863_11881952 | Ga0058863_118819523 | 194 |
| 68 | 3300004803 | Ga0058862_12631684 | Ga0058862_126316841 | 194 |
| 69 | 3300005288 | Ga0065714_10003459 | Ga0065714_100034594 | 194 |
| 70 | 3300005288 | Ga0065714_10115178 | Ga0065714_101151781 | 194 |
| 71 | 3300005327 | Ga0070658_10000041 | Ga0070658_10000041111 | 194 |
| 72 | 3300005327 | Ga0070658_10607045 | Ga0070658_106070451 | 194 |
| 73 | 3300005328 | Ga0070676_10001756 | Ga0070676_100017563 | 194 |
| 74 | 3300005329 | Ga0070683_100113524 | Ga0070683_1001135241 | 194 |
| 75 | 3300005336 | Ga0070680_100041095 | Ga0070680_1000410952 | 194 |
| 76 | 3300005338 | Ga0068868_100007276 | Ga0068868_1000072767 | 194 |
| 77 | 3300005338 | Ga0068868_100116630 | Ga0068868_1001166301 | 194 |
| 78 | 3300005339 | Ga0070660_100015981 | Ga0070660_1000159813 | 194 |
| 79 | 3300005339 | Ga0070660_100169924 | Ga0070660_1001699241 | 194 |
| 80 | 3300005339 | Ga0070660_100242603 | Ga0070660_1002426032 | 194 |
| 81 | 3300005356 | Ga0070674_100187064 | Ga0070674_1001870643 | 194 |
| 82 | 3300005356 | Ga0070674_100380033 | Ga0070674_1003800331 | 194 |
| 83 | 3300005364 | Ga0070673_100005959 | Ga0070673_1000059596 | 194 |
| 84 | 3300005366 | Ga0070659_100001388 | Ga0070659_1000013888 | 194 |
| 85 | 3300005366 | Ga0070659_100034141 | Ga0070659_1000341411 | 194 |
| 86 | 3300005366 | Ga0070659_100088730 | Ga0070659_1000887304 | 194 |
| 87 | 3300005455 | Ga0070663_100010142 | Ga0070663_1000101424 | 194 |
| 88 | 3300005456 | Ga0070678_100005395 | Ga0070678_1000053953 | 194 |
| 89 | 3300005457 | Ga0070662_100000020 | Ga0070662_10000002030 | 194 |
| 90 | 3300005457 | Ga0070662_100341628 | Ga0070662_1003416281 | 194 |
| 91 | 3300005458 | Ga0070681_10008323 | Ga0070681_100083238 | 194 |
| 92 | 3300005459 | Ga0068867_100000492 | Ga0068867_10000049222 | 194 |
| 93 | 3300005530 | Ga0070679_100018533 | Ga0070679_1000185332 | 194 |
| 94 | 3300005530 | Ga0070679_100078639 | Ga0070679_1000786392 | 194 |
| 95 | 3300005535 | Ga0070684_100265653 | Ga0070684_1002656531 | 194 |
| 96 | 3300005539 | Ga0068853_100099138 | Ga0068853_1000991383 | 194 |
| 97 | 3300005539 | Ga0068853_100154440 | Ga0068853_1001544403 | 194 |
| 98 | 3300005539 | Ga0068853_100538903 | Ga0068853_1005389031 | 194 |
| 99 | 3300005548 | Ga0070665_100000125 | Ga0070665_10000012530 | 194 |
| 100 | 3300005563 | Ga0068855_100000246 | Ga0068855_1000002463 | 194 |
| 101 | 3300005563 | Ga0068855_100000522 | Ga0068855_10000052236 | 194 |
| 102 | 3300005563 | Ga0068855_100078023 | Ga0068855_1000780234 | 194 |
| 103 | 3300005563 | Ga0068855_100181837 | Ga0068855_1001818372 | 194 |
| 104 | 3300005563 | Ga0068855_100459299 | Ga0068855_1004592993 | 194 |
| 105 | 3300005577 | Ga0068857_100004876 | Ga0068857_1000048766 | 194 |
| 106 | 3300005577 | Ga0068857_100183228 | Ga0068857_1001832284 | 194 |
| 107 | 3300005577 | Ga0068857_100402531 | Ga0068857_1004025311 | 194 |
| 108 | 3300005577 | Ga0068857_100773148 | Ga0068857_1007731481 | 194 |
| 109 | 3300005614 | Ga0068856_100000021 | Ga0068856_10000002135 | 194 |
| 110 | 3300005614 | Ga0068856_100000690 | Ga0068856_10000069013 | 194 |
| 111 | 3300005614 | Ga0068856_100253757 | Ga0068856_1002537572 | 194 |
| 112 | 3300005614 | Ga0068856_100513236 | Ga0068856_1005132362 | 194 |
| 113 | 3300005616 | Ga0068852_100003213 | Ga0068852_1000032135 | 194 |
| 114 | 3300005616 | Ga0068852_100767304 | Ga0068852_1007673041 | 194 |
| 115 | 3300005718 | Ga0068866_10029400 | Ga0068866_100294004 | 194 |
| 116 | 3300005840 | Ga0068870_10189667 | Ga0068870_101896672 | 194 |
| 117 | 3300005842 | Ga0068858_100540066 | Ga0068858_1005400661 | 194 |
| 118 | 3300006173 | Ga0070716_100479171 | Ga0070716_1004791711 | 194 |
| 119 | 3300006195 | Ga0075366_10136834 | Ga0075366_101368342 | 194 |
| 120 | 3300006237 | Ga0097621_100000087 | Ga0097621_1000000876 | 194 |
| 121 | 3300006353 | Ga0075370_10265805 | Ga0075370_102658051 | 194 |
| 122 | 3300006358 | Ga0068871_100000316 | Ga0068871_1000003166 | 194 |
| 123 | 3300006881 | Ga0068865_100000037 | Ga0068865_10000003720 | 194 |
| 124 | 3300009093 | Ga0105240_10000128 | Ga0105240_1000012822 | 194 |
| 125 | 3300009093 | Ga0105240_10001151 | Ga0105240_100011512 | 194 |
| 126 | 3300009093 | Ga0105240_10003925 | Ga0105240_1000392510 | 194 |
| 127 | 3300009093 | Ga0105240_10004108 | Ga0105240_100041085 | 194 |
| 128 | 3300009093 | Ga0105240_10034971 | Ga0105240_100349715 | 194 |
| 129 | 3300009093 | Ga0105240_10206630 | Ga0105240_102066301 | 194 |
| 130 | 3300009093 | Ga0105240_10375067 | Ga0105240_103750672 | 194 |
| 131 | 3300009093 | Ga0105240_10758288 | Ga0105240_107582881 | 194 |
| 132 | 3300009093 | Ga0105240_11070151 | Ga0105240_110701511 | 194 |
| 133 | 3300009098 | Ga0105245_11407772 | Ga0105245_114077721 | 194 |
| 134 | 3300009174 | Ga0105241_10001158 | Ga0105241_1000115816 | 194 |
| 135 | 3300009174 | Ga0105241_10014600 | Ga0105241_100146003 | 194 |
| 136 | 3300009174 | Ga0105241_10020376 | Ga0105241_100203762 | 194 |
| 137 | 3300009174 | Ga0105241_10061477 | Ga0105241_100614771 | 194 |
| 138 | 3300009174 | Ga0105241_10170731 | Ga0105241_101707313 | 194 |
| 139 | 3300009174 | Ga0105241_10432756 | Ga0105241_104327561 | 194 |
| 140 | 3300009174 | Ga0105241_10521429 | Ga0105241_105214291 | 194 |
| 141 | 3300009174 | Ga0105241_10622322 | Ga0105241_106223222 | 194 |
| 142 | 3300009176 | Ga0105242_10080972 | Ga0105242_100809723 | 194 |
| 143 | 3300009545 | Ga0105237_10001477 | Ga0105237_1000147724 | 194 |
| 144 | 3300009545 | Ga0105237_10003841 | Ga0105237_1000384114 | 194 |
| 145 | 3300009545 | Ga0105237_10030008 | Ga0105237_100300086 | 194 |
| 146 | 3300009545 | Ga0105237_10066536 | Ga0105237_100665362 | 194 |
| 147 | 3300009545 | Ga0105237_10123858 | Ga0105237_101238581 | 194 |
| 148 | 3300009545 | Ga0105237_10153447 | Ga0105237_101534473 | 194 |
| 149 | 3300009545 | Ga0105237_10302290 | Ga0105237_103022901 | 194 |
| 150 | 3300009551 | Ga0105238_10020471 | Ga0105238_100204713 | 194 |
| 151 | 3300009553 | Ga0105249_10727383 | Ga0105249_107273832 | 194 |
| 152 | 3300010375 | Ga0105239_10000077 | Ga0105239_1000007783 | 194 |
| 153 | 3300010375 | Ga0105239_10000115 | Ga0105239_1000011590 | 194 |
| 154 | 3300010375 | Ga0105239_10001575 | Ga0105239_100015759 | 194 |
| 155 | 3300010375 | Ga0105239_10099247 | Ga0105239_100992474 | 194 |
| 156 | 3300010375 | Ga0105239_10138106 | Ga0105239_101381062 | 194 |
| 157 | 3300010375 | Ga0105239_10146938 | Ga0105239_101469382 | 194 |
| 158 | 3300010375 | Ga0105239_11391897 | Ga0105239_113918971 | 194 |
| 159 | 3300011119 | Ga0105246_10035615 | Ga0105246_100356153 | 194 |
| 160 | 3300013100 | Ga0157373_10000037 | Ga0157373_1000003713 | 194 |
| 161 | 3300013100 | Ga0157373_10002091 | Ga0157373_1000209113 | 194 |
| 162 | 3300013100 | Ga0157373_10023410 | Ga0157373_100234105 | 194 |
| 163 | 3300013102 | Ga0157371_10000779 | Ga0157371_1000077913 | 194 |
| 164 | 3300013102 | Ga0157371_10000789 | Ga0157371_1000078920 | 194 |
| 165 | 3300013102 | Ga0157371_10068651 | Ga0157371_100686514 | 194 |
| 166 | 3300013102 | Ga0157371_10073693 | Ga0157371_100736932 | 194 |
| 167 | 3300013104 | Ga0157370_10035542 | Ga0157370_100355423 | 194 |
| 168 | 3300013104 | Ga0157370_10148604 | Ga0157370_101486042 | 194 |
| 169 | 3300013105 | Ga0157369_10000494 | Ga0157369_1000049452 | 194 |
| 170 | 3300013105 | Ga0157369_10072627 | Ga0157369_100726273 | 194 |
| 171 | 3300013105 | Ga0157369_10085380 | Ga0157369_100853801 | 194 |
| 172 | 3300013105 | Ga0157369_10379930 | Ga0157369_103799301 | 194 |
| 173 | 3300013296 | Ga0157374_10000079 | Ga0157374_1000007981 | 194 |
| 174 | 3300013296 | Ga0157374_10004489 | Ga0157374_100044899 | 194 |
| 175 | 3300013296 | Ga0157374_10096271 | Ga0157374_100962712 | 194 |
| 176 | 3300013296 | Ga0157374_10182002 | Ga0157374_101820023 | 194 |
| 177 | 3300013297 | Ga0157378_10021489 | Ga0157378_100214896 | 194 |
| 178 | 3300013297 | Ga0157378_10026462 | Ga0157378_100264624 | 194 |
| 179 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005106 | 194 |
| 180 | 3300013306 | Ga0163162_10025521 | Ga0163162_100255217 | 194 |
| 181 | 3300013306 | Ga0163162_10260064 | Ga0163162_102600641 | 194 |
| 182 | 3300013306 | Ga0163162_10314113 | Ga0163162_103141131 | 194 |
| 183 | 3300013306 | Ga0163162_11343842 | Ga0163162_113438421 | 194 |
| 184 | 3300013307 | Ga0157372_10000042 | Ga0157372_1000004236 | 194 |
| 185 | 3300013307 | Ga0157372_10000354 | Ga0157372_1000035420 | 194 |
| 186 | 3300013307 | Ga0157372_10002722 | Ga0157372_100027227 | 194 |
| 187 | 3300013307 | Ga0157372_10080251 | Ga0157372_100802514 | 194 |
| 188 | 3300013307 | Ga0157372_10127572 | Ga0157372_101275722 | 194 |
| 189 | 3300013307 | Ga0157372_10153667 | Ga0157372_101536674 | 194 |
| 190 | 3300013307 | Ga0157372_10178627 | Ga0157372_101786272 | 194 |
| 191 | 3300013307 | Ga0157372_12044500 | Ga0157372_120445001 | 194 |
| 192 | 3300013308 | Ga0157375_10016359 | Ga0157375_100163597 | 194 |
| 193 | 3300013308 | Ga0157375_10075441 | Ga0157375_100754413 | 194 |
| 194 | 3300014969 | Ga0157376_10016641 | Ga0157376_100166416 | 194 |
| 195 | 3300017792 | Ga0163161_10098802 | Ga0163161_100988021 | 194 |
| 196 | 3300020069 | Ga0197907_10223406 | Ga0197907_102234061 | 194 |
| 197 | 3300020069 | Ga0197907_10383471 | Ga0197907_103834711 | 194 |
| 198 | 3300020070 | Ga0206356_10519719 | Ga0206356_105197191 | 194 |
| 199 | 3300020070 | Ga0206356_11383104 | Ga0206356_113831042 | 194 |
| 200 | 3300020075 | Ga0206349_1163599 | Ga0206349_11635991 | 194 |
| 201 | 3300020076 | Ga0206355_1160990 | Ga0206355_11609901 | 194 |
| 202 | 3300020077 | Ga0206351_10172501 | Ga0206351_101725011 | 194 |
| 203 | 3300020077 | Ga0206351_10652130 | Ga0206351_106521301 | 194 |
| 204 | 3300020077 | Ga0206351_10856690 | Ga0206351_108566901 | 194 |
| 205 | 3300020078 | Ga0206352_10097503 | Ga0206352_100975031 | 194 |
| 206 | 3300020078 | Ga0206352_10109355 | Ga0206352_101093552 | 194 |
| 207 | 3300020078 | Ga0206352_10795031 | Ga0206352_107950311 | 194 |
| 208 | 3300020078 | Ga0206352_11322963 | Ga0206352_113229631 | 194 |
| 209 | 3300020080 | Ga0206350_10926275 | Ga0206350_109262752 | 194 |
| 210 | 3300020081 | Ga0206354_10869162 | Ga0206354_108691621 | 194 |
| 211 | 3300020082 | Ga0206353_10436112 | Ga0206353_104361121 | 194 |
| 212 | 3300020082 | Ga0206353_11307885 | Ga0206353_113078851 | 194 |
| 213 | 3300020082 | Ga0206353_11879347 | Ga0206353_118793471 | 194 |
| 214 | 3300020610 | Ga0154015_1148275 | Ga0154015_11482751 | 194 |
| 215 | 3300020610 | Ga0154015_1391960 | Ga0154015_13919601 | 194 |
| 216 | 3300020610 | Ga0154015_1512965 | Ga0154015_15129651 | 194 |
| 217 | 3300021361 | Ga0213872_10003111 | Ga0213872_100031113 | 194 |
| 218 | 3300022467 | Ga0224712_10032775 | Ga0224712_100327753 | 194 |
| 219 | 3300022467 | Ga0224712_10193347 | Ga0224712_101933471 | 194 |
| 220 | 3300025231 | Ga0207427_100210 | Ga0207427_10021046 | 194 |
| 221 | 3300025233 | Ga0209437_100021 | Ga0209437_100021631 | 194 |
| 222 | 3300025233 | Ga0209437_100119 | Ga0209437_10011962 | 194 |
| 223 | 3300025242 | Ga0209258_109786 | Ga0209258_1097861 | 194 |
| 224 | 3300025250 | Ga0209026_1000273 | Ga0209026_100027321 | 194 |
| 225 | 3300025250 | Ga0209026_1002520 | Ga0209026_10025202 | 194 |
| 226 | 3300025250 | Ga0209026_1009337 | Ga0209026_10093371 | 194 |
| 227 | 3300025261 | Ga0209233_1000035 | Ga0209233_10000356 | 194 |
| 228 | 3300025261 | Ga0209233_1016140 | Ga0209233_10161401 | 194 |
| 229 | 3300025261 | Ga0209233_1019840 | Ga0209233_10198402 | 194 |
| 230 | 3300025272 | Ga0209455_1004196 | Ga0209455_10041961 | 194 |
| 231 | 3300025899 | Ga0207642_10096311 | Ga0207642_100963112 | 194 |
| 232 | 3300025904 | Ga0207647_10000510 | Ga0207647_1000051029 | 194 |
| 233 | 3300025904 | Ga0207647_10002531 | Ga0207647_100025313 | 194 |
| 234 | 3300025904 | Ga0207647_10039254 | Ga0207647_100392542 | 194 |
| 235 | 3300025907 | Ga0207645_10000177 | Ga0207645_1000017712 | 194 |
| 236 | 3300025908 | Ga0207643_10149056 | Ga0207643_101490561 | 194 |
| 237 | 3300025909 | Ga0207705_10000068 | Ga0207705_1000006813 | 194 |
| 238 | 3300025909 | Ga0207705_10243158 | Ga0207705_102431582 | 194 |
| 239 | 3300025909 | Ga0207705_10346757 | Ga0207705_103467571 | 194 |
| 240 | 3300025911 | Ga0207654_10040031 | Ga0207654_100400314 | 194 |
| 241 | 3300025911 | Ga0207654_10111983 | Ga0207654_101119832 | 194 |
| 242 | 3300025911 | Ga0207654_10201285 | Ga0207654_102012852 | 194 |
| 243 | 3300025911 | Ga0207654_10328296 | Ga0207654_103282961 | 194 |
| 244 | 3300025911 | Ga0207654_10546231 | Ga0207654_105462311 | 194 |
| 245 | 3300025912 | Ga0207707_10037119 | Ga0207707_100371193 | 194 |
| 246 | 3300025913 | Ga0207695_10000179 | Ga0207695_10000179159 | 194 |
| 247 | 3300025913 | Ga0207695_10007041 | Ga0207695_100070416 | 194 |
| 248 | 3300025913 | Ga0207695_10019972 | Ga0207695_100199725 | 194 |
| 249 | 3300025913 | Ga0207695_10026913 | Ga0207695_100269136 | 194 |
| 250 | 3300025913 | Ga0207695_10086228 | Ga0207695_100862285 | 194 |
| 251 | 3300025913 | Ga0207695_10089358 | Ga0207695_100893582 | 194 |
| 252 | 3300025913 | Ga0207695_10510434 | Ga0207695_105104341 | 194 |
| 253 | 3300025913 | Ga0207695_10534123 | Ga0207695_105341231 | 194 |
| 254 | 3300025913 | Ga0207695_10638457 | Ga0207695_106384572 | 194 |
| 255 | 3300025914 | Ga0207671_10000112 | Ga0207671_100001122 | 194 |
| 256 | 3300025914 | Ga0207671_10000960 | Ga0207671_1000096024 | 194 |
| 257 | 3300025914 | Ga0207671_10005493 | Ga0207671_100054938 | 194 |
| 258 | 3300025914 | Ga0207671_10008531 | Ga0207671_100085311 | 194 |
| 259 | 3300025914 | Ga0207671_10009607 | Ga0207671_100096074 | 194 |
| 260 | 3300025917 | Ga0207660_10144129 | Ga0207660_101441293 | 194 |
| 261 | 3300025919 | Ga0207657_10056157 | Ga0207657_100561573 | 194 |
| 262 | 3300025919 | Ga0207657_10060238 | Ga0207657_100602383 | 194 |
| 263 | 3300025919 | Ga0207657_10230905 | Ga0207657_102309052 | 194 |
| 264 | 3300025919 | Ga0207657_10369657 | Ga0207657_103696571 | 194 |
| 265 | 3300025921 | Ga0207652_10067236 | Ga0207652_100672363 | 194 |
| 266 | 3300025921 | Ga0207652_10535397 | Ga0207652_105353971 | 194 |
| 267 | 3300025921 | Ga0207652_10616830 | Ga0207652_106168301 | 194 |
| 268 | 3300025924 | Ga0207694_10014678 | Ga0207694_100146781 | 194 |
| 269 | 3300025932 | Ga0207690_10000451 | Ga0207690_1000045126 | 194 |
| 270 | 3300025932 | Ga0207690_10007155 | Ga0207690_100071555 | 194 |
| 271 | 3300025932 | Ga0207690_10116339 | Ga0207690_101163393 | 194 |
| 272 | 3300025933 | Ga0207706_10000044 | Ga0207706_1000004452 | 194 |
| 273 | 3300025933 | Ga0207706_10285634 | Ga0207706_102856341 | 194 |
| 274 | 3300025938 | Ga0207704_10000023 | Ga0207704_1000002351 | 194 |
| 275 | 3300025942 | Ga0207689_10607957 | Ga0207689_106079571 | 194 |
| 276 | 3300025942 | Ga0207689_11011535 | Ga0207689_110115351 | 194 |
| 277 | 3300025944 | Ga0207661_10074947 | Ga0207661_100749474 | 194 |
| 278 | 3300025949 | Ga0207667_10000197 | Ga0207667_1000019743 | 194 |
| 279 | 3300025949 | Ga0207667_10002511 | Ga0207667_1000251114 | 194 |
| 280 | 3300025949 | Ga0207667_10018698 | Ga0207667_100186988 | 194 |
| 281 | 3300025949 | Ga0207667_10034683 | Ga0207667_100346836 | 194 |
| 282 | 3300025949 | Ga0207667_10153235 | Ga0207667_101532352 | 194 |
| 283 | 3300025949 | Ga0207667_10190540 | Ga0207667_101905403 | 194 |
| 284 | 3300025949 | Ga0207667_10356377 | Ga0207667_103563771 | 194 |
| 285 | 3300025960 | Ga0207651_10032634 | Ga0207651_100326343 | 194 |
| 286 | 3300026023 | Ga0207677_10009389 | Ga0207677_100093893 | 194 |
| 287 | 3300026023 | Ga0207677_10010261 | Ga0207677_100102613 | 194 |
| 288 | 3300026035 | Ga0207703_10234413 | Ga0207703_102344132 | 194 |
| 289 | 3300026041 | Ga0207639_10042513 | Ga0207639_100425133 | 194 |
| 290 | 3300026041 | Ga0207639_10055929 | Ga0207639_100559293 | 194 |
| 291 | 3300026041 | Ga0207639_10192522 | Ga0207639_101925224 | 194 |
| 292 | 3300026067 | Ga0207678_10032612 | Ga0207678_100326124 | 194 |
| 293 | 3300026078 | Ga0207702_10000217 | Ga0207702_1000021745 | 194 |
| 294 | 3300026078 | Ga0207702_10010662 | Ga0207702_100106627 | 194 |
| 295 | 3300026078 | Ga0207702_10042533 | Ga0207702_100425335 | 194 |
| 296 | 3300026078 | Ga0207702_11503483 | Ga0207702_115034831 | 194 |
| 297 | 3300026089 | Ga0207648_10000774 | Ga0207648_100007745 | 194 |
| 298 | 3300026116 | Ga0207674_10209112 | Ga0207674_102091122 | 194 |
| 299 | 3300026116 | Ga0207674_10340141 | Ga0207674_103401411 | 194 |
| 300 | 3300026121 | Ga0207683_10000934 | Ga0207683_100009347 | 194 |
| 301 | 3300026142 | Ga0207698_10011046 | Ga0207698_100110465 | 194 |
| 302 | 3300027471 | Ga0209995_1003843 | Ga0209995_10038432 | 194 |
| 303 | 3300028379 | Ga0268266_10000132 | Ga0268266_1000013224 | 194 |
| 304 | 3300028556 | Ga0265337_1087770 | Ga0265337_10877702 | 194 |
| 305 | 3300028653 | Ga0265323_10045679 | Ga0265323_100456791 | 194 |
| 306 | 3300028654 | Ga0265322_10045535 | Ga0265322_100455352 | 194 |
| 307 | 3300028666 | Ga0265336_10029149 | Ga0265336_100291492 | 194 |
| 308 | 3300028786 | Ga0307517_10003919 | Ga0307517_1000391912 | 194 |
| 309 | 3300028794 | Ga0307515_10001436 | Ga0307515_1000143649 | 194 |
| 310 | 3300028800 | Ga0265338_10001644 | Ga0265338_1000164417 | 194 |
| 311 | 3300028800 | Ga0265338_10092436 | Ga0265338_100924362 | 194 |
| 312 | 3300028800 | Ga0265338_10151277 | Ga0265338_101512772 | 194 |
| 313 | 3300030744 | Ga0316181_1085268 | Ga0316181_10852682 | 194 |
| 314 | 3300031235 | Ga0265330_10105226 | Ga0265330_101052261 | 194 |
| 315 | 3300031251 | Ga0265327_10000684 | Ga0265327_1000068417 | 194 |
| 316 | 3300031251 | Ga0265327_10201729 | Ga0265327_102017291 | 194 |
| 317 | 3300031344 | Ga0265316_10008450 | Ga0265316_100084503 | 194 |
| 318 | 3300031456 | Ga0307513_10369573 | Ga0307513_103695731 | 194 |
| 319 | 3300031548 | Ga0307408_100000333 | Ga0307408_10000033337 | 194 |
| 320 | 3300031548 | Ga0307408_100003885 | Ga0307408_1000038853 | 194 |
| 321 | 3300031727 | Ga0316576_10043392 | Ga0316576_100433922 | 194 |
| 322 | 3300031727 | Ga0316576_10167046 | Ga0316576_101670463 | 194 |
| 323 | 3300031728 | Ga0316578_10183704 | Ga0316578_101837042 | 194 |
| 324 | 3300031733 | Ga0316577_10150274 | Ga0316577_101502742 | 194 |
| 325 | 3300031733 | Ga0316577_10163678 | Ga0316577_101636782 | 194 |
| 326 | 3300031911 | Ga0307412_10129143 | Ga0307412_101291432 | 194 |
| 327 | 3300032002 | Ga0307416_100408956 | Ga0307416_1004089562 | 194 |
| 328 | 3300032004 | Ga0307414_10015976 | Ga0307414_100159761 | 194 |
| 329 | 3300032004 | Ga0307414_10714305 | Ga0307414_107143052 | 194 |
| 330 | 3300032005 | Ga0307411_10004168 | Ga0307411_100041681 | 194 |
| 331 | 3300032137 | Ga0316585_10073063 | Ga0316585_100730631 | 194 |
| 332 | 3300032168 | Ga0316593_10083210 | Ga0316593_100832101 | 194 |
| 333 | 3300033179 | Ga0307507_10000099 | Ga0307507_10000099106 | 194 |
| 334 | 3300033528 | Ga0316588_1075531 | Ga0316588_10755311 | 194 |
| 335 | 3300035398 | Ga0316574_0302800 | Ga0316574_0302800_342_932 | 194 |
| 336 | 3300035398 | Ga0316574_0438982 | Ga0316574_0438982_42_632 | 194 |
| 337 | 3300036647 | Ga0316582_0109295 | Ga0316582_0109295_1103_1693 | 194 |
| 338 | 3300036647 | Ga0316582_0308127 | Ga0316582_0308127_374_964 | 194 |
| 339 | 3300036712 | Ga0316584_0017986 | Ga0316584_0017986_2342_2932 | 194 |
| 340 | 3300036712 | Ga0316584_0295312 | Ga0316584_0295312_284_874 | 194 |
| 341 | 3300036712 | Ga0316584_0456440 | Ga0316584_0456440_297_887 | 194 |
| 342 | 3300037068 | Ga0373925_0582840 | Ga0373925_0582840_276_860 | 194 |
| 343 | 3300037312 | Ga0395899_0000011 | Ga0395899_0000011_367800_368384 | 194 |
| 344 | 3300037312 | Ga0395899_0000553 | Ga0395899_0000553_1744_2328 | 194 |
| 345 | 3300037312 | Ga0395899_0003210 | Ga0395899_0003210_10525_11109 | 194 |
| 346 | 3300037312 | Ga0395899_0030156 | Ga0395899_0030156_864_1448 | 194 |
| 347 | 3300037418 | Ga0395900_0000314 | Ga0395900_0000314_55580_56164 | 194 |
| 348 | 3300037418 | Ga0395900_0001300 | Ga0395900_0001300_2387_2971 | 194 |
| 349 | 3300037418 | Ga0395900_0091169 | Ga0395900_0091169_1959_2543 | 194 |
| 350 | 3300037418 | Ga0395900_0124833 | Ga0395900_0124833_861_1445 | 194 |
| 351 | 3300037471 | Ga0395905_0000477 | Ga0395905_0000477_10791_11375 | 194 |
| 352 | 3300037471 | Ga0395905_0000757 | Ga0395905_0000757_37319_37903 | 194 |
| 353 | 3300038443 | Ga0395901_0005968 | Ga0395901_0005968_6861_7445 | 194 |
| 354 | 3300038443 | Ga0395901_0105892 | Ga0395901_0105892_381_965 | 194 |
| 355 | 3300039062 | Ga0400483_116008 | Ga0400483_116008_18_605 | 194 |
| 356 | 3300039447 | Ga0436361_0417016 | Ga0436361_0417016_10262_10846 | 194 |
| 357 | 3300041452 | Ga0451793_1655927 | Ga0451793_1655927_19_603 | 194 |
| 358 | 3300041511 | Ga0451855_0832352 | Ga0451855_0832352_212_799 | 194 |
| 359 | 3300042005 | Ga0439448_0001231 | Ga0439448_0001231_5040_5624 | 194 |
| 360 | 3300042015 | Ga0439462_0047723 | Ga0439462_0047723_371_958 | 194 |
| 361 | 3300042876 | Ga0451577_0000092 | Ga0451577_0000092_52838_53431 | 194 |
| 362 | 3300042876 | Ga0451577_0004955 | Ga0451577_0004955_413_1006 | 194 |
| 363 | 3300042876 | Ga0451577_0005419 | Ga0451577_0005419_8744_9337 | 194 |
| 364 | 3300042876 | Ga0451577_0012359 | Ga0451577_0012359_2510_3103 | 194 |
| 365 | 3300042876 | Ga0451577_0323721 | Ga0451577_0323721_505_1095 | 194 |
| 366 | 3300042876 | Ga0451577_0388630 | Ga0451577_0388630_540_1133 | 194 |
| 367 | 3300042876 | Ga0451577_0448630 | Ga0451577_0448630_174_767 | 194 |
| 368 | 3300042876 | Ga0451577_0507395 | Ga0451577_0507395_118_711 | 194 |
| 369 | 3300042876 | Ga0451577_0879551 | Ga0451577_0879551_178_771 | 194 |
| 370 | 3300042876 | Ga0451577_0943037 | Ga0451577_0943037_76_669 | 194 |
| 371 | 3300044673 | Ga0453683_0000005 | Ga0453683_0000005_604823_605416 | 194 |
| 372 | 3300044673 | Ga0453683_0000310 | Ga0453683_0000310_60372_60965 | 194 |
| 373 | 3300044673 | Ga0453683_0004273 | Ga0453683_0004273_1820_2413 | 194 |
| 374 | 3300044673 | Ga0453683_0179298 | Ga0453683_0179298_70_663 | 194 |
| 375 | 3300044673 | Ga0453683_0462149 | Ga0453683_0462149_213_806 | 194 |
| 376 | 3300044673 | Ga0453683_0547773 | Ga0453683_0547773_98_691 | 194 |
| 377 | 3300044673 | Ga0453683_0557764 | Ga0453683_0557764_64_657 | 194 |
| 378 | 3300044684 | Ga0466966_0024494 | Ga0466966_0024494_2035_2619 | 194 |
| 379 | 3300044693 | Ga0466961_0016933 | Ga0466961_0016933_3432_4016 | 194 |
| 380 | 3300044712 | Ga0453684_0000506 | Ga0453684_0000506_98713_99306 | 194 |
| 381 | 3300044712 | Ga0453684_0000628 | Ga0453684_0000628_23793_24386 | 194 |
| 382 | 3300044712 | Ga0453684_0001093 | Ga0453684_0001093_23068_23661 | 194 |
| 383 | 3300044712 | Ga0453684_0001226 | Ga0453684_0001226_69276_69869 | 194 |
| 384 | 3300044712 | Ga0453684_0004535 | Ga0453684_0004535_19042_19629 | 194 |
| 385 | 3300044712 | Ga0453684_0011107 | Ga0453684_0011107_4622_5209 | 194 |
| 386 | 3300044712 | Ga0453684_0019447 | Ga0453684_0019447_1554_2147 | 194 |
| 387 | 3300044712 | Ga0453684_0020001 | Ga0453684_0020001_364_963 | 194 |
| 388 | 3300044712 | Ga0453684_0033679 | Ga0453684_0033679_3427_4014 | 194 |
| 389 | 3300044712 | Ga0453684_0075361 | Ga0453684_0075361_2688_3281 | 194 |
| 390 | 3300044712 | Ga0453684_0087321 | Ga0453684_0087321_1266_1856 | 194 |
| 391 | 3300044712 | Ga0453684_0092525 | Ga0453684_0092525_1310_1903 | 194 |
| 392 | 3300044712 | Ga0453684_0149583 | Ga0453684_0149583_1189_1776 | 194 |
| 393 | 3300044712 | Ga0453684_0160316 | Ga0453684_0160316_48_641 | 194 |
| 394 | 3300044712 | Ga0453684_0377590 | Ga0453684_0377590_685_1278 | 194 |
| 395 | 3300044712 | Ga0453684_0506198 | Ga0453684_0506198_663_1256 | 194 |
| 396 | 3300044712 | Ga0453684_0520074 | Ga0453684_0520074_494_1087 | 194 |
| 397 | 3300044712 | Ga0453684_0594726 | Ga0453684_0594726_46_633 | 194 |
| 398 | 3300044735 | Ga0466968_0162798 | Ga0466968_0162798_229_813 | 194 |
| 399 | 3300045049 | Ga0466959_0109148 | Ga0466959_0109148_1123_1707 | 194 |
| 400 | 3300045051 | Ga0451576_0000022 | Ga0451576_0000022_136914_137498 | 194 |
| 401 | 3300045051 | Ga0451576_0000204 | Ga0451576_0000204_52838_53431 | 194 |
| 402 | 3300045051 | Ga0451576_0000339 | Ga0451576_0000339_14964_15557 | 194 |
| 403 | 3300045051 | Ga0451576_0001565 | Ga0451576_0001565_27898_28491 | 194 |
| 404 | 3300045051 | Ga0451576_0004822 | Ga0451576_0004822_2890_3483 | 194 |
| 405 | 3300045051 | Ga0451576_0010058 | Ga0451576_0010058_8306_8896 | 194 |
| 406 | 3300045051 | Ga0451576_0054235 | Ga0451576_0054235_3441_4034 | 194 |
| 407 | 3300045051 | Ga0451576_0145641 | Ga0451576_0145641_310_930 | 194 |
| 408 | 3300045051 | Ga0451576_0153039 | Ga0451576_0153039_1121_1714 | 194 |
| 409 | 3300045051 | Ga0451576_0178444 | Ga0451576_0178444_408_1001 | 194 |
| 410 | 3300045051 | Ga0451576_0262855 | Ga0451576_0262855_1166_1765 | 194 |
| 411 | 3300045051 | Ga0451576_0853297 | Ga0451576_0853297_60_647 | 194 |
| 412 | 3300045051 | Ga0451576_1385915 | Ga0451576_1385915_89_682 | 194 |
| 413 | 3300045836 | Ga0466958_0152249 | Ga0466958_0152249_540_1124 | 194 |
| 414 | 3300046462 | Ga0495651_0207294 | Ga0495651_0207294_341_925 | 194 |
| 415 | 3300046463 | Ga0495653_0559744 | Ga0495653_0559744_88_672 | 194 |
| 416 | 3300046471 | Ga0495650_0000144 | Ga0495650_0000144_33166_33750 | 194 |
| 417 | 3300046471 | Ga0495650_0023355 | Ga0495650_0023355_770_1354 | 194 |
| 418 | 3300046471 | Ga0495650_0192828 | Ga0495650_0192828_75_659 | 194 |
| 419 | 3300046492 | Ga0495585_0000312 | Ga0495585_0000312_8309_8893 | 194 |
| 420 | 3300046492 | Ga0495585_0000348 | Ga0495585_0000348_12482_13066 | 194 |
| 421 | 3300046492 | Ga0495585_0133678 | Ga0495585_0133678_73_657 | 194 |
| 422 | 3300046500 | Ga0495596_0012521 | Ga0495596_0012521_2227_2811 | 194 |
| 423 | 3300046506 | Ga0495583_0013618 | Ga0495583_0013618_228_812 | 194 |
| 424 | 3300046506 | Ga0495583_0191480 | Ga0495583_0191480_207_791 | 194 |
| 425 | 3300046507 | Ga0495606_0000926 | Ga0495606_0000926_6658_7242 | 194 |
| 426 | 3300046507 | Ga0495606_0004458 | Ga0495606_0004458_7516_8100 | 194 |
| 427 | 3300046507 | Ga0495606_0016626 | Ga0495606_0016626_1721_2305 | 194 |
| 428 | 3300046507 | Ga0495606_0019604 | Ga0495606_0019604_2167_2751 | 194 |
| 429 | 3300046507 | Ga0495606_0129698 | Ga0495606_0129698_554_1138 | 194 |
| 430 | 3300046512 | Ga0495610_0001817 | Ga0495610_0001817_2090_2674 | 194 |
| 431 | 3300046513 | Ga0495616_0000915 | Ga0495616_0000915_16715_17299 | 194 |
| 432 | 3300046513 | Ga0495616_0009552 | Ga0495616_0009552_1510_2094 | 194 |
| 433 | 3300046518 | Ga0495631_0007237 | Ga0495631_0007237_1942_2526 | 194 |
| 434 | 3300046519 | Ga0495632_0059924 | Ga0495632_0059924_800_1384 | 194 |
| 435 | 3300046520 | Ga0495637_0153327 | Ga0495637_0153327_10_594 | 194 |
| 436 | 3300046523 | Ga0495644_0002551 | Ga0495644_0002551_2982_3566 | 194 |
| 437 | 3300046524 | Ga0495648_0006389 | Ga0495648_0006389_7650_8234 | 194 |
| 438 | 3300046529 | Ga0495652_0075466 | Ga0495652_0075466_601_1185 | 194 |
| 439 | 3300046530 | Ga0495654_0067789 | Ga0495654_0067789_978_1562 | 194 |
| 440 | 3300046538 | Ga0495609_0051153 | Ga0495609_0051153_113_697 | 194 |
| 441 | 3300046538 | Ga0495609_0084895 | Ga0495609_0084895_515_1099 | 194 |
| 442 | 3300046557 | Ga0495622_0125095 | Ga0495622_0125095_67_651 | 194 |
| 443 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_50915_51499 | 194 |
| 444 | 3300046558 | Ga0495633_0001260 | Ga0495633_0001260_676_1260 | 194 |
| 445 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_8364_8948 | 194 |
| 446 | 3300046616 | Ga0495668_0095002 | Ga0495668_0095002_340_924 | 194 |
| 447 | 3300046648 | Ga0495611_0036219 | Ga0495611_0036219_108_692 | 194 |
| 448 | 3300046660 | Ga0495625_0000059 | Ga0495625_0000059_144714_145298 | 194 |
| 449 | 3300046660 | Ga0495625_0000371 | Ga0495625_0000371_392_976 | 194 |
| 450 | 3300046660 | Ga0495625_0002039 | Ga0495625_0002039_978_1562 | 194 |
| 451 | 3300046660 | Ga0495625_0013917 | Ga0495625_0013917_2537_3121 | 194 |
| 452 | 3300046660 | Ga0495625_0083499 | Ga0495625_0083499_1048_1632 | 194 |
| 453 | 3300046660 | Ga0495625_0086996 | Ga0495625_0086996_306_890 | 194 |
| 454 | 3300046660 | Ga0495625_0106562 | Ga0495625_0106562_303_887 | 194 |
| 455 | 3300046660 | Ga0495625_0160849 | Ga0495625_0160849_771_1355 | 194 |
| 456 | 3300046660 | Ga0495625_0277941 | Ga0495625_0277941_355_939 | 194 |
| 457 | 3300046665 | Ga0495661_0005900 | Ga0495661_0005900_2050_2634 | 194 |
| 458 | 3300046665 | Ga0495661_0011405 | Ga0495661_0011405_272_856 | 194 |
| 459 | 3300046665 | Ga0495661_0023017 | Ga0495661_0023017_2967_3551 | 194 |
| 460 | 3300046665 | Ga0495661_0195110 | Ga0495661_0195110_163_747 | 194 |
| 461 | 3300046692 | Ga0495671_0129110 | Ga0495671_0129110_417_1001 | 194 |
| 462 | 3300046694 | Ga0495649_0000031 | Ga0495649_0000031_115939_116523 | 194 |
| 463 | 3300046694 | Ga0495649_0159314 | Ga0495649_0159314_381_965 | 194 |
| 464 | 3300046810 | Ga0495660_0021597 | Ga0495660_0021597_2867_3451 | 194 |
| 465 | 3300046810 | Ga0495660_0096196 | Ga0495660_0096196_908_1492 | 194 |
| 466 | 3300047323 | Ga0495683_0141850 | Ga0495683_0141850_508_1092 | 194 |
| 467 | 3300047443 | Ga0495687_000601 | Ga0495687_000601_13585_14169 | 194 |
| 468 | 3300047443 | Ga0495687_000783 | Ga0495687_000783_9994_10578 | 194 |
| 469 | 3300047446 | Ga0495679_054800 | Ga0495679_054800_235_819 | 194 |
| 470 | 3300047469 | Ga0495673_0033046 | Ga0495673_0033046_1480_2064 | 194 |
| 471 | 3300047472 | Ga0495686_0001365 | Ga0495686_0001365_16305_16889 | 194 |
| 472 | 3300047472 | Ga0495686_0016930 | Ga0495686_0016930_248_832 | 194 |
| 473 | 3300047472 | Ga0495686_0160705 | Ga0495686_0160705_296_880 | 194 |
| 474 | 3300047472 | Ga0495686_0347225 | Ga0495686_0347225_21_605 | 194 |
| 475 | 3300048089 | Ga0495614_0008920 | Ga0495614_0008920_1581_2165 | 194 |
| 476 | 3300048918 | Ga0496115_0046402 | Ga0496115_0046402_1752_2339 | 194 |
| 477 | 3300049459 | Ga0495678_011997 | Ga0495678_011997_1085_1669 | 194 |
| 478 | 3300049568 | Ga0501031_0001144 | Ga0501031_0001144_6599_7186 | 194 |
| 479 | 3300049569 | Ga0501032_0001137 | Ga0501032_0001137_4140_4727 | 194 |
| 480 | 3300049569 | Ga0501032_0018914 | Ga0501032_0018914_1452_2039 | 194 |
| 481 | 3300049570 | Ga0501033_0000045 | Ga0501033_0000045_81198_81785 | 194 |
| 482 | 3300049571 | Ga0501034_0000682 | Ga0501034_0000682_13799_14386 | 194 |
| 483 | 3300049571 | Ga0501034_0489919 | Ga0501034_0489919_540_1127 | 194 |
| 484 | 3300049572 | Ga0501036_0078269 | Ga0501036_0078269_1106_1693 | 194 |
| 485 | 3300049573 | Ga0501037_0017262 | Ga0501037_0017262_45_632 | 194 |
| 486 | 3300049574 | Ga0501038_0006162 | Ga0501038_0006162_6373_6960 | 194 |
| 487 | 3300049574 | Ga0501038_0044033 | Ga0501038_0044033_88_675 | 194 |
| 488 | 3300049575 | Ga0501039_0001690 | Ga0501039_0001690_4159_4746 | 194 |
| 489 | 3300049582 | Ga0501048_0240343 | Ga0501048_0240343_571_1158 | 194 |
| 490 | 3300049583 | Ga0501067_0375167 | Ga0501067_0375167_32_619 | 194 |
| 491 | 3300049822 | Ga0501035_0056652 | Ga0501035_0056652_1780_2367 | 194 |
| 492 | 3300049823 | Ga0501044_0000502 | Ga0501044_0000502_33853_34440 | 194 |
| 493 | 3300049824 | Ga0501045_0000133 | Ga0501045_0000133_762_1349 | 194 |
| 494 | 3300050493 | nmdc:mga0k408_69534_c1 | nmdc:mga0k408_69534_c1_77_661 | 194 |
| 495 | 3300050493 | nmdc:mga0k408_7957_c1 | nmdc:mga0k408_7957_c1_78_662 | 194 |
| 496 | 3300050496 | nmdc:mga07m45_153735_c1 | nmdc:mga07m45_153735_c1_66_650 | 194 |
| 497 | 3300050496 | nmdc:mga07m45_246495_c1 | nmdc:mga07m45_246495_c1_356_940 | 194 |
| 498 | 3300053080 | Ga0500635_0000274 | Ga0500635_0000274_12879_13463 | 194 |
| 499 | 3300053098 | Ga0500650_0045775 | Ga0500650_0045775_1008_1592 | 194 |
| 500 | 3300053122 | Ga0500608_018660 | Ga0500608_018660_777_1361 | 194 |
| 501 | 3300053123 | Ga0500614_003147 | Ga0500614_003147_431_1015 | 194 |
| 502 | 3300053125 | Ga0500618_000018 | Ga0500618_000018_52078_52662 | 194 |
| 503 | 3300053138 | Ga0500564_137417 | Ga0500564_137417_202_786 | 194 |
| 504 | 3300053156 | Ga0500622_0011822 | Ga0500622_0011822_2245_2829 | 194 |
| 505 | 3300053157 | Ga0500624_013495 | Ga0500624_013495_185_769 | 194 |
| 506 | 3300053161 | Ga0500634_0107315 | Ga0500634_0107315_208_792 | 194 |
| 507 | 3300059604 | Ga0587098_025178 | Ga0587098_025178_18_602 | 194 |
| 508 | 3300059640 | Ga0587067_078677 | Ga0587067_078677_55_639 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bhy-assembly1.cif.gz_B | dna-binding domain of deor in complex with the dna operator | 0.9982 | 141 | 179 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9693 | 126 | 181 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9685 | 126 | 181 |
| 4go1-assembly1.cif.gz_B-2 | crystal structure of full length transcription repressor lsrr from e. coli. | 0.9642 | 141 | 179 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9581 | 138 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l5jA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9757 | 141 | 179 | 1.10.10.10 |
| 3vepH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9752 | 133 | 187 | 1.10.10.10 |
| 3vepE00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9747 | 133 | 188 | 1.10.10.10 |
| 4l5jC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9726 | 141 | 179 | 1.10.10.10 |
| 3hugO00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9696 | 131 | 187 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A101HJH5-F1-model_v4 | RNA polymerase sigma-70 region 2 domain-containing protein | 0.9854 | 1 | 88 |
GO:0006352
GO:0016987 |
| AF-A0A101HJH5-F1-model_v4 | RNA polymerase sigma-70 region 2 domain-containing protein | 0.9532 | 1 | 88 |
GO:0006352
GO:0016987 |
| AF-A0A3C1Y7H4-F1-model_v4 | RNA polymerase subunit sigma-24 | 0.9195 | 1 | 105 |
GO:0006352
GO:0016987 |
| AF-A0A4Q3EGK4-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.9142 | 1 | 106 |
GO:0006352
GO:0016987 |
| AF-A0A4Q3EGK4-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.9057 | 1 | 106 |
GO:0006352
GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar