F456815

General Info

Members Datasets Scaffolds Average Seq Length
508 243 496 194

Family's Representative Sequence

Representative Sequence 3300020610|Ga0154015_1148275|Ga0154015_11482751
Length 208
Sequence MDFQLQSDQELIHQYISGEEAGLVELIRRYQTKIYTSIYLMVKDEALAEDIFQDTFIKVINTLKGGRYNEEGKFLPWVTRIAHNLVIDHFRREKRTPVVNTGEDFDIFDVLGEYDESTEERMVRDQTHKDLKVLIQRLPDEQKEVLIMRHYGDLSFKEIAEITDVSINTALGRMRYALNNLRKMMQAKELSLKNXEVIKLFYNIFXIL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
152 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
164 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
240 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
243 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.73
Metatranscriptomes 5.91
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0
Rhizoplane 0.59
Rhizosphere 88.78
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001766 3300001904 Bacteria 3896
2 JGI24740J21852_10025067 3300001979 Bacteria 2015
3 JGI24740J21852_10030751 3300001979 Bacteria 1742
4 JGI24740J21852_10068470 3300001979 Bacteria 958
5 JGI24739J22299_10020360 3300001989 Bacteria 2371
6 JGI24737J22298_10001214 3300001990 Bacteria 9089
7 JGI24737J22298_10003502 3300001990 Bacteria 5536
8 JGI24737J22298_10006820 3300001990 Bacteria 3881
9 JGI24737J22298_10019388 3300001990 Bacteria 2175
10 JGI24735J21928_10000015 3300002067 Bacteria 167231
11 JGI24744J21845_10006095 3300002077 Bacteria 2500
12 JGI25162J39368_1000016 3300002737 Bacteria 288734
13 JGI25162J39368_1003655 3300002737 Bacteria 4218
14 JGI25157J39369_1005425 3300002741 Bacteria 2082
15 JGI25157J39369_1009335 3300002741 Bacteria 1324
16 JGI25164J39214_1000962 3300002772 Bacteria 9240
17 JGI25165J46597_1000728 3300003214 Bacteria 25784
18 rootH1_10000740 3300003316 Bacteria 16773
19 rootH2_10011116 3300003320 Bacteria 111907
20 rootH2_10012129 3300003320 Bacteria 47530
21 rootH2_10147513 3300003320 Bacteria 1335
22 rootL2_10047353 3300003322 Bacteria 4681
23 rootH1_10133606 3300003323 Bacteria 6159
24 rootH1_10140936 3300003323 Bacteria 5548
25 rootH1_10165777 3300003323 Bacteria 2053
26 rootH1_10199878 3300003323 Bacteria 1437
27 Ga0058863_11430240 3300004799 Bacteria 668
28 Ga0058863_11881952 3300004799 Bacteria 1957
29 Ga0058862_12631684 3300004803 Bacteria 742
30 Ga0065714_10003459 3300005288 Bacteria 7433
31 Ga0065714_10115178 3300005288 Bacteria 1419
32 Ga0070658_10000041 3300005327 Bacteria 134208
33 Ga0070658_10607045 3300005327 Bacteria 948
34 Ga0070676_10001756 3300005328 Bacteria 11020
35 Ga0070683_100113524 3300005329 Bacteria 2557
36 Ga0070680_100041095 3300005336 Bacteria 3749
37 Ga0068868_100007276 3300005338 Bacteria 7874
38 Ga0068868_100116630 3300005338 Bacteria 2175
39 Ga0070660_100015981 3300005339 Bacteria 5436
40 Ga0070660_100169924 3300005339 Bacteria 1760
41 Ga0070660_100242603 3300005339 Bacteria 1468
42 Ga0070674_100187064 3300005356 Bacteria 1590
43 Ga0070674_100380033 3300005356 Bacteria 1149
44 Ga0070673_100005959 3300005364 Bacteria 7880
45 Ga0070659_100001388 3300005366 Bacteria 17468
46 Ga0070659_100034141 3300005366 Bacteria 3955
47 Ga0070659_100088730 3300005366 Bacteria 2477
48 Ga0070663_100010142 3300005455 Bacteria 5862
49 Ga0070678_100005395 3300005456 Bacteria 7377
50 Ga0070662_100000020 3300005457 Bacteria 99425
51 Ga0070662_100341628 3300005457 Bacteria 1225
52 Ga0070681_10008323 3300005458 Bacteria 10161
53 Ga0068867_100000492 3300005459 Bacteria 26405
54 Ga0070679_100018533 3300005530 Bacteria 6757
55 Ga0070679_100078639 3300005530 Bacteria 3287
56 Ga0070684_100265653 3300005535 Bacteria 1570
57 Ga0068853_100099138 3300005539 Bacteria 2574
58 Ga0068853_100154440 3300005539 Bacteria 2067
59 Ga0068853_100538903 3300005539 Bacteria 1105
60 Ga0070665_100000125 3300005548 Bacteria 146809
61 Ga0068855_100000246 3300005563 Bacteria 68191
62 Ga0068855_100000522 3300005563 Bacteria 47210
63 Ga0068855_100078023 3300005563 Bacteria 3842
64 Ga0068855_100181837 3300005563 Bacteria 2377
65 Ga0068855_100459299 3300005563 Bacteria 1389
66 Ga0068857_100004876 3300005577 Bacteria 11384
67 Ga0068857_100183228 3300005577 Bacteria 1906
68 Ga0068857_100402531 3300005577 Bacteria 1274
69 Ga0068857_100773148 3300005577 Bacteria 916
70 Ga0068856_100000021 3300005614 Bacteria 145017
71 Ga0068856_100000690 3300005614 Bacteria 36629
72 Ga0068856_100253757 3300005614 Bacteria 1774
73 Ga0068856_100513236 3300005614 Bacteria 1220
74 Ga0068852_100003213 3300005616 Bacteria 11411
75 Ga0068852_100767304 3300005616 Bacteria 977
76 Ga0068866_10029400 3300005718 Bacteria 2628
77 Ga0068870_10189667 3300005840 Bacteria 1239
78 Ga0068858_100540066 3300005842 Bacteria 1128
79 Ga0070716_100479171 3300006173 Bacteria 913
80 Ga0075366_10136834 3300006195 Bacteria 1479
81 Ga0097621_100000087 3300006237 Bacteria 49983
82 Ga0075370_10265805 3300006353 Bacteria 1018
83 Ga0068871_100000316 3300006358 Bacteria 33595
84 Ga0068865_100000037 3300006881 Bacteria 81388
85 Ga0105240_10000128 3300009093 Bacteria 156107
86 Ga0105240_10001151 3300009093 Bacteria 46302
87 Ga0105240_10003925 3300009093 Bacteria 22967
88 Ga0105240_10004108 3300009093 Bacteria 22346
89 Ga0105240_10034971 3300009093 Bacteria 6478
90 Ga0105240_10206630 3300009093 Bacteria 2298
91 Ga0105240_10375067 3300009093 Bacteria 1608
92 Ga0105240_10758288 3300009093 Bacteria 1054
93 Ga0105240_11070151 3300009093 Bacteria 859
94 Ga0105245_11407772 3300009098 Bacteria 747
95 Ga0105241_10001158 3300009174 Bacteria 20034
96 Ga0105241_10014600 3300009174 Bacteria 5751
97 Ga0105241_10020376 3300009174 Bacteria 4899
98 Ga0105241_10061477 3300009174 Bacteria 2892
99 Ga0105241_10170731 3300009174 Bacteria 1796
100 Ga0105241_10432756 3300009174 Bacteria 1160
101 Ga0105241_10521429 3300009174 Bacteria 1063
102 Ga0105241_10622322 3300009174 Bacteria 977
103 Ga0105242_10080972 3300009176 Bacteria 2714
104 Ga0105237_10001477 3300009545 Bacteria 30982
105 Ga0105237_10003841 3300009545 Bacteria 17658
106 Ga0105237_10030008 3300009545 Bacteria 5524
107 Ga0105237_10066536 3300009545 Bacteria 3598
108 Ga0105237_10123858 3300009545 Bacteria 2579
109 Ga0105237_10153447 3300009545 Bacteria 2300
110 Ga0105237_10302290 3300009545 Bacteria 1603
111 Ga0105238_10020471 3300009551 Bacteria 6735
112 Ga0105249_10727383 3300009553 Bacteria 1054
113 Ga0105239_10000077 3300010375 Bacteria 135944
114 Ga0105239_10000115 3300010375 Bacteria 113217
115 Ga0105239_10001575 3300010375 Bacteria 30140
116 Ga0105239_10099247 3300010375 Bacteria 3219
117 Ga0105239_10138106 3300010375 Bacteria 2714
118 Ga0105239_10146938 3300010375 Bacteria 2630
119 Ga0105239_11391897 3300010375 Bacteria 810
120 Ga0105246_10035615 3300011119 Bacteria 3328
121 Ga0157373_10000037 3300013100 Bacteria 121670
122 Ga0157373_10002091 3300013100 Bacteria 15131
123 Ga0157373_10023410 3300013100 Bacteria 4478
124 Ga0157371_10000779 3300013102 Bacteria 36655
125 Ga0157371_10000789 3300013102 Bacteria 36476
126 Ga0157371_10068651 3300013102 Bacteria 2509
127 Ga0157371_10073693 3300013102 Bacteria 2418
128 Ga0157370_10035542 3300013104 Bacteria 4841
129 Ga0157370_10081488 3300013104 Bacteria 3045
130 Ga0157370_10148604 3300013104 Bacteria 2181
131 Ga0157369_10000494 3300013105 Bacteria 52196
132 Ga0157369_10072627 3300013105 Bacteria 3693
133 Ga0157369_10085380 3300013105 Bacteria 3373
134 Ga0157369_10379930 3300013105 Bacteria 1466
135 Ga0157374_10000079 3300013296 Bacteria 95883
136 Ga0157374_10004489 3300013296 Bacteria 11720
137 Ga0157374_10096271 3300013296 Bacteria 2831
138 Ga0157374_10182002 3300013296 Bacteria 2053
139 Ga0157378_10021489 3300013297 Bacteria 5675
140 Ga0157378_10026462 3300013297 Bacteria 5114
141 Ga0163162_10000005 3300013306 Bacteria 447195
142 Ga0163162_10025521 3300013306 Bacteria 5840
143 Ga0163162_10260064 3300013306 Bacteria 1867
144 Ga0163162_10314113 3300013306 Bacteria 1700
145 Ga0163162_11343842 3300013306 Bacteria 812
146 Ga0157372_10000042 3300013307 Bacteria 157651
147 Ga0157372_10000354 3300013307 Bacteria 50294
148 Ga0157372_10002722 3300013307 Bacteria 19119
149 Ga0157372_10080251 3300013307 Bacteria 3691
150 Ga0157372_10127572 3300013307 Bacteria 2925
151 Ga0157372_10153667 3300013307 Bacteria 2657
152 Ga0157372_10178627 3300013307 Bacteria 2457
153 Ga0157372_12044500 3300013307 Bacteria 658
154 Ga0157375_10016359 3300013308 Bacteria 6660
155 Ga0157375_10075441 3300013308 Bacteria 3397
156 Ga0157376_10016641 3300014969 Bacteria 5588
157 Ga0163161_10098802 3300017792 Bacteria 2170
158 Ga0197907_10223406 3300020069 Bacteria 853
159 Ga0197907_10383471 3300020069 Bacteria 769
160 Ga0206356_10519719 3300020070 Bacteria 744
161 Ga0206356_11383104 3300020070 Bacteria 1295
162 Ga0206349_1163599 3300020075 Bacteria 905
163 Ga0206355_1160990 3300020076 Bacteria 927
164 Ga0206351_10172501 3300020077 Bacteria 851
165 Ga0206351_10652130 3300020077 Bacteria 1072
166 Ga0206351_10856690 3300020077 Bacteria 1387
167 Ga0206352_10097503 3300020078 Bacteria 989
168 Ga0206352_10109355 3300020078 Bacteria 845
169 Ga0206352_10795031 3300020078 Bacteria 766
170 Ga0206352_11322963 3300020078 Bacteria 1098
171 Ga0206350_10926275 3300020080 Bacteria 1125
172 Ga0206354_10869162 3300020081 Bacteria 782
173 Ga0206353_10436112 3300020082 Bacteria 822
174 Ga0206353_11307885 3300020082 Bacteria 739
175 Ga0206353_11879347 3300020082 Bacteria 790
176 Ga0154015_1148275 3300020610 Bacteria 1111
177 Ga0154015_1391960 3300020610 Bacteria 903
178 Ga0154015_1512965 3300020610 Bacteria 817
179 Ga0213872_10003111 3300021361 Bacteria 9325
180 Ga0224712_10032775 3300022467 Bacteria 1896
181 Ga0224712_10193347 3300022467 Bacteria 922
182 Ga0207427_100210 3300025231 Bacteria 53314
183 Ga0209437_100021 3300025233 Bacteria 646400
184 Ga0209437_100119 3300025233 Bacteria 206549
185 Ga0209258_109786 3300025242 Bacteria 1272
186 Ga0209026_1000273 3300025250 Bacteria 61449
187 Ga0209026_1002520 3300025250 Bacteria 6785
188 Ga0209026_1009337 3300025250 Bacteria 1936
189 Ga0209233_1000035 3300025261 Bacteria 568478
190 Ga0209233_1016140 3300025261 Bacteria 2064
191 Ga0209233_1019840 3300025261 Bacteria 1777
192 Ga0209455_1004196 3300025272 Bacteria 4815
193 Ga0207642_10096311 3300025899 Bacteria 1475
194 Ga0207647_10000510 3300025904 Bacteria 30942
195 Ga0207647_10002531 3300025904 Bacteria 13846
196 Ga0207647_10039254 3300025904 Bacteria 2989
197 Ga0207645_10000177 3300025907 Bacteria 51193
198 Ga0207643_10149056 3300025908 Bacteria 1401
199 Ga0207705_10000068 3300025909 Bacteria 134316
200 Ga0207705_10243158 3300025909 Bacteria 1371
201 Ga0207705_10346757 3300025909 Bacteria 1143
202 Ga0207654_10040031 3300025911 Bacteria 2640
203 Ga0207654_10111983 3300025911 Bacteria 1700
204 Ga0207654_10201285 3300025911 Bacteria 1311
205 Ga0207654_10328296 3300025911 Bacteria 1048
206 Ga0207654_10546231 3300025911 Bacteria 822
207 Ga0207707_10037119 3300025912 Bacteria 4258
208 Ga0207695_10000179 3300025913 Bacteria 185564
209 Ga0207695_10007041 3300025913 Bacteria 14430
210 Ga0207695_10019972 3300025913 Bacteria 7690
211 Ga0207695_10026913 3300025913 Bacteria 6410
212 Ga0207695_10086228 3300025913 Bacteria 3167
213 Ga0207695_10089358 3300025913 Bacteria 3098
214 Ga0207695_10510434 3300025913 Bacteria 1084
215 Ga0207695_10534123 3300025913 Bacteria 1054
216 Ga0207695_10638457 3300025913 Bacteria 946
217 Ga0207671_10000112 3300025914 Bacteria 125310
218 Ga0207671_10000960 3300025914 Bacteria 35779
219 Ga0207671_10005493 3300025914 Bacteria 11661
220 Ga0207671_10008531 3300025914 Bacteria 8675
221 Ga0207671_10009607 3300025914 Bacteria 8064
222 Ga0207660_10144129 3300025917 Bacteria 1824
223 Ga0207657_10056157 3300025919 Bacteria 3398
224 Ga0207657_10060238 3300025919 Bacteria 3258
225 Ga0207657_10230905 3300025919 Bacteria 1480
226 Ga0207657_10369657 3300025919 Bacteria 1130
227 Ga0207652_10067236 3300025921 Bacteria 3107
228 Ga0207652_10535397 3300025921 Bacteria 1053
229 Ga0207652_10616830 3300025921 Bacteria 972
230 Ga0207694_10014678 3300025924 Bacteria 5905
231 Ga0207690_10000451 3300025932 Bacteria 26612
232 Ga0207690_10007155 3300025932 Bacteria 6627
233 Ga0207690_10116339 3300025932 Bacteria 1934
234 Ga0207706_10000044 3300025933 Bacteria 123576
235 Ga0207706_10285634 3300025933 Bacteria 1439
236 Ga0207704_10000023 3300025938 Bacteria 142638
237 Ga0207689_10607957 3300025942 Bacteria 920
238 Ga0207689_11011535 3300025942 Bacteria 701
239 Ga0207661_10074947 3300025944 Bacteria 2775
240 Ga0207667_10000197 3300025949 Bacteria 87987
241 Ga0207667_10002511 3300025949 Bacteria 22878
242 Ga0207667_10018698 3300025949 Bacteria 7764
243 Ga0207667_10034683 3300025949 Bacteria 5417
244 Ga0207667_10153235 3300025949 Bacteria 2372
245 Ga0207667_10190540 3300025949 Bacteria 2104
246 Ga0207667_10356377 3300025949 Bacteria 1492
247 Ga0207651_10032634 3300025960 Bacteria 3348
248 Ga0207677_10009389 3300026023 Bacteria 5505
249 Ga0207677_10010261 3300026023 Bacteria 5295
250 Ga0207703_10234413 3300026035 Bacteria 1647
251 Ga0207639_10042513 3300026041 Bacteria 3406
252 Ga0207639_10055929 3300026041 Bacteria 3022
253 Ga0207639_10192522 3300026041 Bacteria 1743
254 Ga0207678_10032612 3300026067 Bacteria 4540
255 Ga0207702_10000217 3300026078 Bacteria 67356
256 Ga0207702_10010662 3300026078 Bacteria 7678
257 Ga0207702_10042533 3300026078 Bacteria 3811
258 Ga0207702_11503483 3300026078 Bacteria 667
259 Ga0207648_10000774 3300026089 Bacteria 36044
260 Ga0207674_10209112 3300026116 Bacteria 1900
261 Ga0207674_10340141 3300026116 Bacteria 1451
262 Ga0207683_10000934 3300026121 Bacteria 26876
263 Ga0207698_10011046 3300026142 Bacteria 5838
264 Ga0209995_1003843 3300027471 Bacteria 2396
265 Ga0268266_10000132 3300028379 Bacteria 145563
266 Ga0265337_1087770 3300028556 Bacteria 849
267 Ga0265326_10013848 3300028558 Bacteria 2353
268 Ga0265323_10045679 3300028653 Bacteria 1573
269 Ga0265322_10045535 3300028654 Bacteria 1248
270 Ga0265336_10029149 3300028666 Bacteria 1723
271 Ga0307517_10003919 3300028786 Bacteria 23073
272 Ga0307515_10001436 3300028794 Bacteria 53821
273 Ga0265338_10001644 3300028800 Bacteria 35766
274 Ga0265338_10092436 3300028800 Bacteria 2495
275 Ga0265338_10151277 3300028800 Bacteria 1803
276 Ga0316181_1085268 3300030744 Bacteria 1075
277 Ga0265330_10105226 3300031235 Bacteria 1207
278 Ga0265320_10036674 3300031240 Bacteria 2476
279 Ga0265327_10000684 3300031251 Bacteria 54331
280 Ga0265327_10201729 3300031251 Bacteria 900
281 Ga0265316_10001738 3300031344 Bacteria 23105
282 Ga0265316_10008450 3300031344 Bacteria 9552
283 Ga0307513_10369573 3300031456 Bacteria 1177
284 Ga0307408_100000333 3300031548 Bacteria 44985
285 Ga0307408_100003885 3300031548 Bacteria 10171
286 Ga0316579_10069616 3300031691 Bacteria 1665
287 Ga0316576_10043392 3300031727 Bacteria 3244
288 Ga0316576_10167046 3300031727 Bacteria 1660
289 Ga0316578_10048391 3300031728 Bacteria 2483
290 Ga0316578_10183704 3300031728 Bacteria 1260
291 Ga0316577_10007652 3300031733 Bacteria 5766
292 Ga0316577_10112091 3300031733 Bacteria 1531
293 Ga0316577_10150274 3300031733 Bacteria 1313
294 Ga0316577_10163678 3300031733 Bacteria 1255
295 Ga0307412_10129143 3300031911 Bacteria 1833
296 Ga0307416_100408956 3300032002 Bacteria 1397
297 Ga0307414_10015976 3300032004 Bacteria 4549
298 Ga0307414_10714305 3300032004 Bacteria 908
299 Ga0307411_10004168 3300032005 Bacteria 6872
300 Ga0316585_10073063 3300032137 Unclassified 1114
301 Ga0316593_10083210 3300032168 Bacteria 1119
302 Ga0307507_10000099 3300033179 Bacteria 139532
303 Ga0316588_1075531 3300033528 Bacteria 830
304 Ga0316574_0302800 3300035398 Unclassified 1016
305 Ga0316574_0438982 3300035398 Bacteria 819
306 Ga0316582_0024278 3300036647 Bacteria 3627
307 Ga0316582_0109295 3300036647 Bacteria 1839
308 Ga0316582_0308127 3300036647 Bacteria 1088
309 Ga0316584_0002814 3300036712 Bacteria 11151
310 Ga0316584_0017986 3300036712 Bacteria 5093
311 Ga0316584_0243391 3300036712 Unclassified 1316
312 Ga0316584_0295312 3300036712 Bacteria 1174
313 Ga0316584_0456440 3300036712 Bacteria 903
314 Ga0373925_0582840 3300037068 Bacteria 921
315 Ga0395899_0000011 3300037312 Bacteria 521331
316 Ga0395899_0000553 3300037312 Bacteria 40280
317 Ga0395899_0003210 3300037312 Bacteria 12964
318 Ga0395899_0030156 3300037312 Bacteria 4080
319 Ga0395900_0000314 3300037418 Bacteria 71758
320 Ga0395900_0001300 3300037418 Bacteria 30387
321 Ga0395900_0091169 3300037418 Bacteria 3132
322 Ga0395900_0124833 3300037418 Bacteria 2640
323 Ga0395905_0000477 3300037471 Bacteria 55299
324 Ga0395905_0000757 3300037471 Bacteria 42574
325 Ga0395901_0005968 3300038443 Bacteria 12332
326 Ga0395901_0105892 3300038443 Bacteria 2952
327 Ga0400483_116008 3300039062 Bacteria 1333
328 Ga0400489_30105 3300039093 Bacteria 2333
329 Ga0400489_33891 3300039093 Bacteria 2870
330 Ga0436361_0417016 3300039447 Bacteria 15796
331 Ga0451793_1655927 3300041452 Bacteria 677
332 Ga0451855_0832352 3300041511 Bacteria 1457
333 Ga0439448_0001231 3300042005 Bacteria 6540
334 Ga0439462_0047723 3300042015 Bacteria 1148
335 Ga0451577_0000092 3300042876 Bacteria 198898
336 Ga0451577_0004955 3300042876 Bacteria 13841
337 Ga0451577_0005419 3300042876 Bacteria 13083
338 Ga0451577_0012359 3300042876 Bacteria 8017
339 Ga0451577_0323721 3300042876 Bacteria 1398
340 Ga0451577_0388630 3300042876 Bacteria 1266
341 Ga0451577_0448630 3300042876 Bacteria 1171
342 Ga0451577_0507395 3300042876 Bacteria 1095
343 Ga0451577_0879551 3300042876 Bacteria 807
344 Ga0451577_0943037 3300042876 Bacteria 776
345 Ga0453683_0000005 3300044673 Bacteria 741657
346 Ga0453683_0000310 3300044673 Bacteria 61336
347 Ga0453683_0004273 3300044673 Bacteria 10189
348 Ga0453683_0179298 3300044673 Bacteria 1343
349 Ga0453683_0462149 3300044673 Bacteria 821
350 Ga0453683_0547773 3300044673 Bacteria 752
351 Ga0453683_0557764 3300044673 Bacteria 745
352 Ga0466966_0024494 3300044684 Bacteria 3946
353 Ga0466961_0016933 3300044693 Bacteria 4684
354 Ga0453684_0000506 3300044712 Bacteria 152143
355 Ga0453684_0000628 3300044712 Bacteria 128416
356 Ga0453684_0000771 3300044712 Bacteria 110664
357 Ga0453684_0001093 3300044712 Bacteria 85531
358 Ga0453684_0001226 3300044712 Bacteria 78620
359 Ga0453684_0004535 3300044712 Bacteria 29128
360 Ga0453684_0011107 3300044712 Bacteria 15193
361 Ga0453684_0012143 3300044712 Bacteria 14289
362 Ga0453684_0019447 3300044712 Bacteria 10341
363 Ga0453684_0020001 3300044712 Bacteria 10145
364 Ga0453684_0023016 3300044712 Bacteria 9208
365 Ga0453684_0033679 3300044712 Bacteria 7134
366 Ga0453684_0063426 3300044712 Bacteria 4727
367 Ga0453684_0075361 3300044712 Bacteria 4241
368 Ga0453684_0087321 3300044712 Bacteria 3866
369 Ga0453684_0092525 3300044712 Bacteria 3727
370 Ga0453684_0149583 3300044712 Bacteria 2777
371 Ga0453684_0160316 3300044712 Bacteria 2661
372 Ga0453684_0375907 3300044712 Bacteria 1596
373 Ga0453684_0377590 3300044712 Bacteria 1592
374 Ga0453684_0506198 3300044712 Bacteria 1336
375 Ga0453684_0520074 3300044712 Bacteria 1315
376 Ga0453684_0594726 3300044712 Bacteria 1213
377 Ga0453684_0972508 3300044712 Bacteria 904
378 Ga0453684_1383893 3300044712 Bacteria 730
379 Ga0453684_1733594 3300044712 Bacteria 637
380 Ga0466968_0162798 3300044735 Bacteria 1030
381 Ga0466959_0109148 3300045049 Bacteria 1976
382 Ga0451576_0000022 3300045051 Bacteria 495037
383 Ga0451576_0000204 3300045051 Bacteria 149459
384 Ga0451576_0000339 3300045051 Bacteria 112422
385 Ga0451576_0001565 3300045051 Bacteria 38496
386 Ga0451576_0004822 3300045051 Bacteria 17268
387 Ga0451576_0010058 3300045051 Bacteria 10892
388 Ga0451576_0054235 3300045051 Bacteria 4198
389 Ga0451576_0145641 3300045051 Bacteria 2469
390 Ga0451576_0153039 3300045051 Bacteria 2405
391 Ga0451576_0178444 3300045051 Bacteria 2217
392 Ga0451576_0262855 3300045051 Unclassified 1804
393 Ga0451576_0544294 3300045051 Bacteria 1220
394 Ga0451576_0853297 3300045051 Unclassified 956
395 Ga0451576_1385915 3300045051 Bacteria 732
396 Ga0466958_0152249 3300045836 Bacteria 1459
397 Ga0495651_0207294 3300046462 Bacteria 1367
398 Ga0495653_0559744 3300046463 Bacteria 707
399 Ga0495650_0000144 3300046471 Bacteria 165957
400 Ga0495650_0023355 3300046471 Bacteria 2946
401 Ga0495650_0192828 3300046471 Bacteria 711
402 Ga0495585_0000312 3300046492 Bacteria 48297
403 Ga0495585_0000348 3300046492 Bacteria 44925
404 Ga0495585_0133678 3300046492 Bacteria 1304
405 Ga0495596_0012521 3300046500 Bacteria 3631
406 Ga0495583_0013618 3300046506 Bacteria 4525
407 Ga0495583_0191480 3300046506 Bacteria 834
408 Ga0495606_0000926 3300046507 Bacteria 43259
409 Ga0495606_0004458 3300046507 Bacteria 13979
410 Ga0495606_0016626 3300046507 Bacteria 5600
411 Ga0495606_0019604 3300046507 Bacteria 5023
412 Ga0495606_0129698 3300046507 Bacteria 1500
413 Ga0495610_0001817 3300046512 Bacteria 18559
414 Ga0495616_0000915 3300046513 Bacteria 21238
415 Ga0495616_0009552 3300046513 Bacteria 5663
416 Ga0495631_0007237 3300046518 Bacteria 5658
417 Ga0495632_0059924 3300046519 Bacteria 1851
418 Ga0495637_0153327 3300046520 Bacteria 868
419 Ga0495644_0002551 3300046523 Bacteria 7246
420 Ga0495648_0006389 3300046524 Bacteria 9632
421 Ga0495652_0075466 3300046529 Bacteria 2800
422 Ga0495654_0067789 3300046530 Bacteria 1698
423 Ga0495609_0051153 3300046538 Bacteria 1840
424 Ga0495609_0084895 3300046538 Bacteria 1381
425 Ga0495622_0125095 3300046557 Bacteria 1173
426 Ga0495633_0000006 3300046558 Bacteria 326774
427 Ga0495633_0001260 3300046558 Bacteria 20176
428 Ga0495668_0000011 3300046616 Bacteria 472186
429 Ga0495668_0095002 3300046616 Bacteria 1632
430 Ga0495611_0036219 3300046648 Bacteria 2189
431 Ga0495625_0000059 3300046660 Bacteria 180330
432 Ga0495625_0000371 3300046660 Bacteria 68809
433 Ga0495625_0002039 3300046660 Bacteria 22734
434 Ga0495625_0013917 3300046660 Bacteria 6442
435 Ga0495625_0083499 3300046660 Bacteria 2220
436 Ga0495625_0086996 3300046660 Bacteria 2167
437 Ga0495625_0106562 3300046660 Bacteria 1919
438 Ga0495625_0160849 3300046660 Bacteria 1504
439 Ga0495625_0277941 3300046660 Bacteria 1078
440 Ga0495661_0005900 3300046665 Bacteria 8655
441 Ga0495661_0011405 3300046665 Bacteria 6033
442 Ga0495661_0023017 3300046665 Bacteria 4049
443 Ga0495661_0195110 3300046665 Bacteria 1064
444 Ga0495671_0129110 3300046692 Bacteria 1233
445 Ga0495649_0000031 3300046694 Bacteria 151547
446 Ga0495649_0159314 3300046694 Bacteria 1184
447 Ga0495660_0021597 3300046810 Bacteria 3685
448 Ga0495660_0096196 3300046810 Bacteria 1531
449 Ga0495683_0141850 3300047323 Bacteria 1125
450 Ga0495687_000601 3300047443 Bacteria 42037
451 Ga0495687_000783 3300047443 Bacteria 34231
452 Ga0495679_054800 3300047446 Bacteria 1186
453 Ga0495673_0033046 3300047469 Bacteria 2405
454 Ga0495686_0001365 3300047472 Bacteria 27228
455 Ga0495686_0016930 3300047472 Bacteria 4925
456 Ga0495686_0160705 3300047472 Bacteria 1313
457 Ga0495686_0347225 3300047472 Bacteria 807
458 Ga0495614_0008920 3300048089 Bacteria 4449
459 Ga0496115_0046402 3300048918 Bacteria 3472
460 Ga0495678_011997 3300049459 Bacteria 4124
461 Ga0501031_0001144 3300049568 Bacteria 16132
462 Ga0501032_0001137 3300049569 Bacteria 21289
463 Ga0501032_0016665 3300049569 Bacteria 5165
464 Ga0501032_0018914 3300049569 Bacteria 4820
465 Ga0501033_0000045 3300049570 Bacteria 126661
466 Ga0501034_0000682 3300049571 Bacteria 51648
467 Ga0501034_0489919 3300049571 Bacteria 1144
468 Ga0501036_0078269 3300049572 Bacteria 2796
469 Ga0501037_0017262 3300049573 Bacteria 5314
470 Ga0501038_0006162 3300049574 Bacteria 11095
471 Ga0501038_0044033 3300049574 Bacteria 3880
472 Ga0501039_0001690 3300049575 Bacteria 16270
473 Ga0501048_0240343 3300049582 Bacteria 1285
474 Ga0501067_0375167 3300049583 Bacteria 793
475 Ga0501068_0011860 3300049584 Bacteria 4926
476 Ga0501079_1185840 3300049741 Unclassified 601
477 Ga0501035_0056652 3300049822 Bacteria 3496
478 Ga0501035_1111876 3300049822 Bacteria 617
479 Ga0501044_0000502 3300049823 Bacteria 47572
480 Ga0501045_0000133 3300049824 Bacteria 39066
481 nmdc:mga0k408_69534_c1 3300050493 Bacteria 2055
482 nmdc:mga0k408_7957_c1 3300050493 Bacteria 5679
483 nmdc:mga07m45_153735_c1 3300050496 Bacteria 1334
484 nmdc:mga07m45_246495_c1 3300050496 Bacteria 1039
485 Ga0500635_0000274 3300053080 Bacteria 19596
486 Ga0500646_0030180 3300053090 Bacteria 1487
487 Ga0500650_0045775 3300053098 Bacteria 2027
488 Ga0500608_018660 3300053122 Bacteria 3168
489 Ga0500614_003147 3300053123 Bacteria 3577
490 Ga0500618_000018 3300053125 Bacteria 163272
491 Ga0500564_137417 3300053138 Bacteria 1052
492 Ga0500622_0011822 3300053156 Bacteria 4744
493 Ga0500624_013495 3300053157 Bacteria 1223
494 Ga0500634_0107315 3300053161 Bacteria 1385
495 Ga0587098_025178 3300059604 Bacteria 785
496 Ga0587067_078677 3300059640 Bacteria 726

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_1185840 Ga0501079_1185840_70_591 169
2 3300049822 Ga0501035_1111876 Ga0501035_1111876_10_531 169
3 3300053090 Ga0500646_0030180 Ga0500646_0030180_12_521 169
4 3300001990 JGI24737J22298_10019388 JGI24737J22298_100193882 175
5 3300044712 Ga0453684_0000771 Ga0453684_0000771_12279_12812 175
6 3300044712 Ga0453684_0972508 Ga0453684_0972508_147_680 175
7 3300039093 Ga0400489_33891 Ga0400489_33891_1138_1671 176
8 3300044712 Ga0453684_1383893 Ga0453684_1383893_101_688 176
9 3300045051 Ga0451576_0544294 Ga0451576_0544294_443_1030 176
10 3300031733 Ga0316577_10112091 Ga0316577_101120911 177
11 3300036712 Ga0316584_0243391 Ga0316584_0243391_11_547 177
12 3300039093 Ga0400489_30105 Ga0400489_30105_1349_1885 177
13 3300013104 Ga0157370_10081488 Ga0157370_100814882 179
14 3300044712 Ga0453684_0063426 Ga0453684_0063426_3674_4219 179
15 3300049569 Ga0501032_0016665 Ga0501032_0016665_2252_2803 179
16 3300049584 Ga0501068_0011860 Ga0501068_0011860_1266_1817 179
17 3300028558 Ga0265326_10013848 Ga0265326_100138482 181
18 3300031240 Ga0265320_10036674 Ga0265320_100366742 181
19 3300031691 Ga0316579_10069616 Ga0316579_100696162 189
20 3300031728 Ga0316578_10048391 Ga0316578_100483912 189
21 3300044712 Ga0453684_0012143 Ga0453684_0012143_182_757 189
22 3300044712 Ga0453684_0023016 Ga0453684_0023016_6328_6900 189
23 3300044712 Ga0453684_0375907 Ga0453684_0375907_69_644 189
24 3300044712 Ga0453684_1733594 Ga0453684_1733594_15_590 189
25 iso_pu_bacteria 2599185184 2599481687 190
26 iso_pu_bacteria 2852623160 2852625869 190
27 iso_pu_bacteria 2857627736 2857631265 190
28 iso_pu_bacteria 2884933994 2884935608 190
29 iso_pu_bacteria 2890804823 2890805674 190
30 iso_pu_bacteria 2919437846 2919440499 190
31 iso_pu_bacteria 2928078545 2928082172 190
32 iso_pu_bacteria 2928147474 2928149252 190
33 iso_pu_bacteria 2932082852 2932087688 190
34 iso_pu_bacteria 2977232053 2977235333 190
35 iso_pu_bacteria 8036736890 8036738293 190
36 iso_pu_bacteria 8055588893 8055589958 190
37 3300031344 Ga0265316_10001738 Ga0265316_1000173818 192
38 3300031733 Ga0316577_10007652 Ga0316577_100076528 192
39 3300036647 Ga0316582_0024278 Ga0316582_0024278_539_1132 192
40 3300036712 Ga0316584_0002814 Ga0316584_0002814_8019_8612 192
41 3300001904 JGI24736J21556_1001766 JGI24736J21556_10017665 194
42 3300001979 JGI24740J21852_10025067 JGI24740J21852_100250674 194
43 3300001979 JGI24740J21852_10030751 JGI24740J21852_100307512 194
44 3300001979 JGI24740J21852_10068470 JGI24740J21852_100684701 194
45 3300001989 JGI24739J22299_10020360 JGI24739J22299_100203604 194
46 3300001990 JGI24737J22298_10001214 JGI24737J22298_100012148 194
47 3300001990 JGI24737J22298_10003502 JGI24737J22298_100035022 194
48 3300001990 JGI24737J22298_10006820 JGI24737J22298_100068203 194
49 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001586 194
50 3300002077 JGI24744J21845_10006095 JGI24744J21845_100060951 194
51 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016145 194
52 3300002737 JGI25162J39368_1003655 JGI25162J39368_10036552 194
53 3300002741 JGI25157J39369_1005425 JGI25157J39369_10054253 194
54 3300002741 JGI25157J39369_1009335 JGI25157J39369_10093352 194
55 3300002772 JGI25164J39214_1000962 JGI25164J39214_10009623 194
56 3300003214 JGI25165J46597_1000728 JGI25165J46597_100072822 194
57 3300003316 rootH1_10000740 rootH1_1000074017 194
58 3300003320 rootH2_10011116 rootH2_1001111640 194
59 3300003320 rootH2_10012129 rootH2_1001212920 194
60 3300003320 rootH2_10147513 rootH2_101475131 194
61 3300003322 rootL2_10047353 rootL2_100473534 194
62 3300003323 rootH1_10133606 rootH1_101336067 194
63 3300003323 rootH1_10140936 rootH1_101409362 194
64 3300003323 rootH1_10165777 rootH1_101657773 194
65 3300003323 rootH1_10199878 rootH1_101998782 194
66 3300004799 Ga0058863_11430240 Ga0058863_114302401 194
67 3300004799 Ga0058863_11881952 Ga0058863_118819523 194
68 3300004803 Ga0058862_12631684 Ga0058862_126316841 194
69 3300005288 Ga0065714_10003459 Ga0065714_100034594 194
70 3300005288 Ga0065714_10115178 Ga0065714_101151781 194
71 3300005327 Ga0070658_10000041 Ga0070658_10000041111 194
72 3300005327 Ga0070658_10607045 Ga0070658_106070451 194
73 3300005328 Ga0070676_10001756 Ga0070676_100017563 194
74 3300005329 Ga0070683_100113524 Ga0070683_1001135241 194
75 3300005336 Ga0070680_100041095 Ga0070680_1000410952 194
76 3300005338 Ga0068868_100007276 Ga0068868_1000072767 194
77 3300005338 Ga0068868_100116630 Ga0068868_1001166301 194
78 3300005339 Ga0070660_100015981 Ga0070660_1000159813 194
79 3300005339 Ga0070660_100169924 Ga0070660_1001699241 194
80 3300005339 Ga0070660_100242603 Ga0070660_1002426032 194
81 3300005356 Ga0070674_100187064 Ga0070674_1001870643 194
82 3300005356 Ga0070674_100380033 Ga0070674_1003800331 194
83 3300005364 Ga0070673_100005959 Ga0070673_1000059596 194
84 3300005366 Ga0070659_100001388 Ga0070659_1000013888 194
85 3300005366 Ga0070659_100034141 Ga0070659_1000341411 194
86 3300005366 Ga0070659_100088730 Ga0070659_1000887304 194
87 3300005455 Ga0070663_100010142 Ga0070663_1000101424 194
88 3300005456 Ga0070678_100005395 Ga0070678_1000053953 194
89 3300005457 Ga0070662_100000020 Ga0070662_10000002030 194
90 3300005457 Ga0070662_100341628 Ga0070662_1003416281 194
91 3300005458 Ga0070681_10008323 Ga0070681_100083238 194
92 3300005459 Ga0068867_100000492 Ga0068867_10000049222 194
93 3300005530 Ga0070679_100018533 Ga0070679_1000185332 194
94 3300005530 Ga0070679_100078639 Ga0070679_1000786392 194
95 3300005535 Ga0070684_100265653 Ga0070684_1002656531 194
96 3300005539 Ga0068853_100099138 Ga0068853_1000991383 194
97 3300005539 Ga0068853_100154440 Ga0068853_1001544403 194
98 3300005539 Ga0068853_100538903 Ga0068853_1005389031 194
99 3300005548 Ga0070665_100000125 Ga0070665_10000012530 194
100 3300005563 Ga0068855_100000246 Ga0068855_1000002463 194
101 3300005563 Ga0068855_100000522 Ga0068855_10000052236 194
102 3300005563 Ga0068855_100078023 Ga0068855_1000780234 194
103 3300005563 Ga0068855_100181837 Ga0068855_1001818372 194
104 3300005563 Ga0068855_100459299 Ga0068855_1004592993 194
105 3300005577 Ga0068857_100004876 Ga0068857_1000048766 194
106 3300005577 Ga0068857_100183228 Ga0068857_1001832284 194
107 3300005577 Ga0068857_100402531 Ga0068857_1004025311 194
108 3300005577 Ga0068857_100773148 Ga0068857_1007731481 194
109 3300005614 Ga0068856_100000021 Ga0068856_10000002135 194
110 3300005614 Ga0068856_100000690 Ga0068856_10000069013 194
111 3300005614 Ga0068856_100253757 Ga0068856_1002537572 194
112 3300005614 Ga0068856_100513236 Ga0068856_1005132362 194
113 3300005616 Ga0068852_100003213 Ga0068852_1000032135 194
114 3300005616 Ga0068852_100767304 Ga0068852_1007673041 194
115 3300005718 Ga0068866_10029400 Ga0068866_100294004 194
116 3300005840 Ga0068870_10189667 Ga0068870_101896672 194
117 3300005842 Ga0068858_100540066 Ga0068858_1005400661 194
118 3300006173 Ga0070716_100479171 Ga0070716_1004791711 194
119 3300006195 Ga0075366_10136834 Ga0075366_101368342 194
120 3300006237 Ga0097621_100000087 Ga0097621_1000000876 194
121 3300006353 Ga0075370_10265805 Ga0075370_102658051 194
122 3300006358 Ga0068871_100000316 Ga0068871_1000003166 194
123 3300006881 Ga0068865_100000037 Ga0068865_10000003720 194
124 3300009093 Ga0105240_10000128 Ga0105240_1000012822 194
125 3300009093 Ga0105240_10001151 Ga0105240_100011512 194
126 3300009093 Ga0105240_10003925 Ga0105240_1000392510 194
127 3300009093 Ga0105240_10004108 Ga0105240_100041085 194
128 3300009093 Ga0105240_10034971 Ga0105240_100349715 194
129 3300009093 Ga0105240_10206630 Ga0105240_102066301 194
130 3300009093 Ga0105240_10375067 Ga0105240_103750672 194
131 3300009093 Ga0105240_10758288 Ga0105240_107582881 194
132 3300009093 Ga0105240_11070151 Ga0105240_110701511 194
133 3300009098 Ga0105245_11407772 Ga0105245_114077721 194
134 3300009174 Ga0105241_10001158 Ga0105241_1000115816 194
135 3300009174 Ga0105241_10014600 Ga0105241_100146003 194
136 3300009174 Ga0105241_10020376 Ga0105241_100203762 194
137 3300009174 Ga0105241_10061477 Ga0105241_100614771 194
138 3300009174 Ga0105241_10170731 Ga0105241_101707313 194
139 3300009174 Ga0105241_10432756 Ga0105241_104327561 194
140 3300009174 Ga0105241_10521429 Ga0105241_105214291 194
141 3300009174 Ga0105241_10622322 Ga0105241_106223222 194
142 3300009176 Ga0105242_10080972 Ga0105242_100809723 194
143 3300009545 Ga0105237_10001477 Ga0105237_1000147724 194
144 3300009545 Ga0105237_10003841 Ga0105237_1000384114 194
145 3300009545 Ga0105237_10030008 Ga0105237_100300086 194
146 3300009545 Ga0105237_10066536 Ga0105237_100665362 194
147 3300009545 Ga0105237_10123858 Ga0105237_101238581 194
148 3300009545 Ga0105237_10153447 Ga0105237_101534473 194
149 3300009545 Ga0105237_10302290 Ga0105237_103022901 194
150 3300009551 Ga0105238_10020471 Ga0105238_100204713 194
151 3300009553 Ga0105249_10727383 Ga0105249_107273832 194
152 3300010375 Ga0105239_10000077 Ga0105239_1000007783 194
153 3300010375 Ga0105239_10000115 Ga0105239_1000011590 194
154 3300010375 Ga0105239_10001575 Ga0105239_100015759 194
155 3300010375 Ga0105239_10099247 Ga0105239_100992474 194
156 3300010375 Ga0105239_10138106 Ga0105239_101381062 194
157 3300010375 Ga0105239_10146938 Ga0105239_101469382 194
158 3300010375 Ga0105239_11391897 Ga0105239_113918971 194
159 3300011119 Ga0105246_10035615 Ga0105246_100356153 194
160 3300013100 Ga0157373_10000037 Ga0157373_1000003713 194
161 3300013100 Ga0157373_10002091 Ga0157373_1000209113 194
162 3300013100 Ga0157373_10023410 Ga0157373_100234105 194
163 3300013102 Ga0157371_10000779 Ga0157371_1000077913 194
164 3300013102 Ga0157371_10000789 Ga0157371_1000078920 194
165 3300013102 Ga0157371_10068651 Ga0157371_100686514 194
166 3300013102 Ga0157371_10073693 Ga0157371_100736932 194
167 3300013104 Ga0157370_10035542 Ga0157370_100355423 194
168 3300013104 Ga0157370_10148604 Ga0157370_101486042 194
169 3300013105 Ga0157369_10000494 Ga0157369_1000049452 194
170 3300013105 Ga0157369_10072627 Ga0157369_100726273 194
171 3300013105 Ga0157369_10085380 Ga0157369_100853801 194
172 3300013105 Ga0157369_10379930 Ga0157369_103799301 194
173 3300013296 Ga0157374_10000079 Ga0157374_1000007981 194
174 3300013296 Ga0157374_10004489 Ga0157374_100044899 194
175 3300013296 Ga0157374_10096271 Ga0157374_100962712 194
176 3300013296 Ga0157374_10182002 Ga0157374_101820023 194
177 3300013297 Ga0157378_10021489 Ga0157378_100214896 194
178 3300013297 Ga0157378_10026462 Ga0157378_100264624 194
179 3300013306 Ga0163162_10000005 Ga0163162_10000005106 194
180 3300013306 Ga0163162_10025521 Ga0163162_100255217 194
181 3300013306 Ga0163162_10260064 Ga0163162_102600641 194
182 3300013306 Ga0163162_10314113 Ga0163162_103141131 194
183 3300013306 Ga0163162_11343842 Ga0163162_113438421 194
184 3300013307 Ga0157372_10000042 Ga0157372_1000004236 194
185 3300013307 Ga0157372_10000354 Ga0157372_1000035420 194
186 3300013307 Ga0157372_10002722 Ga0157372_100027227 194
187 3300013307 Ga0157372_10080251 Ga0157372_100802514 194
188 3300013307 Ga0157372_10127572 Ga0157372_101275722 194
189 3300013307 Ga0157372_10153667 Ga0157372_101536674 194
190 3300013307 Ga0157372_10178627 Ga0157372_101786272 194
191 3300013307 Ga0157372_12044500 Ga0157372_120445001 194
192 3300013308 Ga0157375_10016359 Ga0157375_100163597 194
193 3300013308 Ga0157375_10075441 Ga0157375_100754413 194
194 3300014969 Ga0157376_10016641 Ga0157376_100166416 194
195 3300017792 Ga0163161_10098802 Ga0163161_100988021 194
196 3300020069 Ga0197907_10223406 Ga0197907_102234061 194
197 3300020069 Ga0197907_10383471 Ga0197907_103834711 194
198 3300020070 Ga0206356_10519719 Ga0206356_105197191 194
199 3300020070 Ga0206356_11383104 Ga0206356_113831042 194
200 3300020075 Ga0206349_1163599 Ga0206349_11635991 194
201 3300020076 Ga0206355_1160990 Ga0206355_11609901 194
202 3300020077 Ga0206351_10172501 Ga0206351_101725011 194
203 3300020077 Ga0206351_10652130 Ga0206351_106521301 194
204 3300020077 Ga0206351_10856690 Ga0206351_108566901 194
205 3300020078 Ga0206352_10097503 Ga0206352_100975031 194
206 3300020078 Ga0206352_10109355 Ga0206352_101093552 194
207 3300020078 Ga0206352_10795031 Ga0206352_107950311 194
208 3300020078 Ga0206352_11322963 Ga0206352_113229631 194
209 3300020080 Ga0206350_10926275 Ga0206350_109262752 194
210 3300020081 Ga0206354_10869162 Ga0206354_108691621 194
211 3300020082 Ga0206353_10436112 Ga0206353_104361121 194
212 3300020082 Ga0206353_11307885 Ga0206353_113078851 194
213 3300020082 Ga0206353_11879347 Ga0206353_118793471 194
214 3300020610 Ga0154015_1148275 Ga0154015_11482751 194
215 3300020610 Ga0154015_1391960 Ga0154015_13919601 194
216 3300020610 Ga0154015_1512965 Ga0154015_15129651 194
217 3300021361 Ga0213872_10003111 Ga0213872_100031113 194
218 3300022467 Ga0224712_10032775 Ga0224712_100327753 194
219 3300022467 Ga0224712_10193347 Ga0224712_101933471 194
220 3300025231 Ga0207427_100210 Ga0207427_10021046 194
221 3300025233 Ga0209437_100021 Ga0209437_100021631 194
222 3300025233 Ga0209437_100119 Ga0209437_10011962 194
223 3300025242 Ga0209258_109786 Ga0209258_1097861 194
224 3300025250 Ga0209026_1000273 Ga0209026_100027321 194
225 3300025250 Ga0209026_1002520 Ga0209026_10025202 194
226 3300025250 Ga0209026_1009337 Ga0209026_10093371 194
227 3300025261 Ga0209233_1000035 Ga0209233_10000356 194
228 3300025261 Ga0209233_1016140 Ga0209233_10161401 194
229 3300025261 Ga0209233_1019840 Ga0209233_10198402 194
230 3300025272 Ga0209455_1004196 Ga0209455_10041961 194
231 3300025899 Ga0207642_10096311 Ga0207642_100963112 194
232 3300025904 Ga0207647_10000510 Ga0207647_1000051029 194
233 3300025904 Ga0207647_10002531 Ga0207647_100025313 194
234 3300025904 Ga0207647_10039254 Ga0207647_100392542 194
235 3300025907 Ga0207645_10000177 Ga0207645_1000017712 194
236 3300025908 Ga0207643_10149056 Ga0207643_101490561 194
237 3300025909 Ga0207705_10000068 Ga0207705_1000006813 194
238 3300025909 Ga0207705_10243158 Ga0207705_102431582 194
239 3300025909 Ga0207705_10346757 Ga0207705_103467571 194
240 3300025911 Ga0207654_10040031 Ga0207654_100400314 194
241 3300025911 Ga0207654_10111983 Ga0207654_101119832 194
242 3300025911 Ga0207654_10201285 Ga0207654_102012852 194
243 3300025911 Ga0207654_10328296 Ga0207654_103282961 194
244 3300025911 Ga0207654_10546231 Ga0207654_105462311 194
245 3300025912 Ga0207707_10037119 Ga0207707_100371193 194
246 3300025913 Ga0207695_10000179 Ga0207695_10000179159 194
247 3300025913 Ga0207695_10007041 Ga0207695_100070416 194
248 3300025913 Ga0207695_10019972 Ga0207695_100199725 194
249 3300025913 Ga0207695_10026913 Ga0207695_100269136 194
250 3300025913 Ga0207695_10086228 Ga0207695_100862285 194
251 3300025913 Ga0207695_10089358 Ga0207695_100893582 194
252 3300025913 Ga0207695_10510434 Ga0207695_105104341 194
253 3300025913 Ga0207695_10534123 Ga0207695_105341231 194
254 3300025913 Ga0207695_10638457 Ga0207695_106384572 194
255 3300025914 Ga0207671_10000112 Ga0207671_100001122 194
256 3300025914 Ga0207671_10000960 Ga0207671_1000096024 194
257 3300025914 Ga0207671_10005493 Ga0207671_100054938 194
258 3300025914 Ga0207671_10008531 Ga0207671_100085311 194
259 3300025914 Ga0207671_10009607 Ga0207671_100096074 194
260 3300025917 Ga0207660_10144129 Ga0207660_101441293 194
261 3300025919 Ga0207657_10056157 Ga0207657_100561573 194
262 3300025919 Ga0207657_10060238 Ga0207657_100602383 194
263 3300025919 Ga0207657_10230905 Ga0207657_102309052 194
264 3300025919 Ga0207657_10369657 Ga0207657_103696571 194
265 3300025921 Ga0207652_10067236 Ga0207652_100672363 194
266 3300025921 Ga0207652_10535397 Ga0207652_105353971 194
267 3300025921 Ga0207652_10616830 Ga0207652_106168301 194
268 3300025924 Ga0207694_10014678 Ga0207694_100146781 194
269 3300025932 Ga0207690_10000451 Ga0207690_1000045126 194
270 3300025932 Ga0207690_10007155 Ga0207690_100071555 194
271 3300025932 Ga0207690_10116339 Ga0207690_101163393 194
272 3300025933 Ga0207706_10000044 Ga0207706_1000004452 194
273 3300025933 Ga0207706_10285634 Ga0207706_102856341 194
274 3300025938 Ga0207704_10000023 Ga0207704_1000002351 194
275 3300025942 Ga0207689_10607957 Ga0207689_106079571 194
276 3300025942 Ga0207689_11011535 Ga0207689_110115351 194
277 3300025944 Ga0207661_10074947 Ga0207661_100749474 194
278 3300025949 Ga0207667_10000197 Ga0207667_1000019743 194
279 3300025949 Ga0207667_10002511 Ga0207667_1000251114 194
280 3300025949 Ga0207667_10018698 Ga0207667_100186988 194
281 3300025949 Ga0207667_10034683 Ga0207667_100346836 194
282 3300025949 Ga0207667_10153235 Ga0207667_101532352 194
283 3300025949 Ga0207667_10190540 Ga0207667_101905403 194
284 3300025949 Ga0207667_10356377 Ga0207667_103563771 194
285 3300025960 Ga0207651_10032634 Ga0207651_100326343 194
286 3300026023 Ga0207677_10009389 Ga0207677_100093893 194
287 3300026023 Ga0207677_10010261 Ga0207677_100102613 194
288 3300026035 Ga0207703_10234413 Ga0207703_102344132 194
289 3300026041 Ga0207639_10042513 Ga0207639_100425133 194
290 3300026041 Ga0207639_10055929 Ga0207639_100559293 194
291 3300026041 Ga0207639_10192522 Ga0207639_101925224 194
292 3300026067 Ga0207678_10032612 Ga0207678_100326124 194
293 3300026078 Ga0207702_10000217 Ga0207702_1000021745 194
294 3300026078 Ga0207702_10010662 Ga0207702_100106627 194
295 3300026078 Ga0207702_10042533 Ga0207702_100425335 194
296 3300026078 Ga0207702_11503483 Ga0207702_115034831 194
297 3300026089 Ga0207648_10000774 Ga0207648_100007745 194
298 3300026116 Ga0207674_10209112 Ga0207674_102091122 194
299 3300026116 Ga0207674_10340141 Ga0207674_103401411 194
300 3300026121 Ga0207683_10000934 Ga0207683_100009347 194
301 3300026142 Ga0207698_10011046 Ga0207698_100110465 194
302 3300027471 Ga0209995_1003843 Ga0209995_10038432 194
303 3300028379 Ga0268266_10000132 Ga0268266_1000013224 194
304 3300028556 Ga0265337_1087770 Ga0265337_10877702 194
305 3300028653 Ga0265323_10045679 Ga0265323_100456791 194
306 3300028654 Ga0265322_10045535 Ga0265322_100455352 194
307 3300028666 Ga0265336_10029149 Ga0265336_100291492 194
308 3300028786 Ga0307517_10003919 Ga0307517_1000391912 194
309 3300028794 Ga0307515_10001436 Ga0307515_1000143649 194
310 3300028800 Ga0265338_10001644 Ga0265338_1000164417 194
311 3300028800 Ga0265338_10092436 Ga0265338_100924362 194
312 3300028800 Ga0265338_10151277 Ga0265338_101512772 194
313 3300030744 Ga0316181_1085268 Ga0316181_10852682 194
314 3300031235 Ga0265330_10105226 Ga0265330_101052261 194
315 3300031251 Ga0265327_10000684 Ga0265327_1000068417 194
316 3300031251 Ga0265327_10201729 Ga0265327_102017291 194
317 3300031344 Ga0265316_10008450 Ga0265316_100084503 194
318 3300031456 Ga0307513_10369573 Ga0307513_103695731 194
319 3300031548 Ga0307408_100000333 Ga0307408_10000033337 194
320 3300031548 Ga0307408_100003885 Ga0307408_1000038853 194
321 3300031727 Ga0316576_10043392 Ga0316576_100433922 194
322 3300031727 Ga0316576_10167046 Ga0316576_101670463 194
323 3300031728 Ga0316578_10183704 Ga0316578_101837042 194
324 3300031733 Ga0316577_10150274 Ga0316577_101502742 194
325 3300031733 Ga0316577_10163678 Ga0316577_101636782 194
326 3300031911 Ga0307412_10129143 Ga0307412_101291432 194
327 3300032002 Ga0307416_100408956 Ga0307416_1004089562 194
328 3300032004 Ga0307414_10015976 Ga0307414_100159761 194
329 3300032004 Ga0307414_10714305 Ga0307414_107143052 194
330 3300032005 Ga0307411_10004168 Ga0307411_100041681 194
331 3300032137 Ga0316585_10073063 Ga0316585_100730631 194
332 3300032168 Ga0316593_10083210 Ga0316593_100832101 194
333 3300033179 Ga0307507_10000099 Ga0307507_10000099106 194
334 3300033528 Ga0316588_1075531 Ga0316588_10755311 194
335 3300035398 Ga0316574_0302800 Ga0316574_0302800_342_932 194
336 3300035398 Ga0316574_0438982 Ga0316574_0438982_42_632 194
337 3300036647 Ga0316582_0109295 Ga0316582_0109295_1103_1693 194
338 3300036647 Ga0316582_0308127 Ga0316582_0308127_374_964 194
339 3300036712 Ga0316584_0017986 Ga0316584_0017986_2342_2932 194
340 3300036712 Ga0316584_0295312 Ga0316584_0295312_284_874 194
341 3300036712 Ga0316584_0456440 Ga0316584_0456440_297_887 194
342 3300037068 Ga0373925_0582840 Ga0373925_0582840_276_860 194
343 3300037312 Ga0395899_0000011 Ga0395899_0000011_367800_368384 194
344 3300037312 Ga0395899_0000553 Ga0395899_0000553_1744_2328 194
345 3300037312 Ga0395899_0003210 Ga0395899_0003210_10525_11109 194
346 3300037312 Ga0395899_0030156 Ga0395899_0030156_864_1448 194
347 3300037418 Ga0395900_0000314 Ga0395900_0000314_55580_56164 194
348 3300037418 Ga0395900_0001300 Ga0395900_0001300_2387_2971 194
349 3300037418 Ga0395900_0091169 Ga0395900_0091169_1959_2543 194
350 3300037418 Ga0395900_0124833 Ga0395900_0124833_861_1445 194
351 3300037471 Ga0395905_0000477 Ga0395905_0000477_10791_11375 194
352 3300037471 Ga0395905_0000757 Ga0395905_0000757_37319_37903 194
353 3300038443 Ga0395901_0005968 Ga0395901_0005968_6861_7445 194
354 3300038443 Ga0395901_0105892 Ga0395901_0105892_381_965 194
355 3300039062 Ga0400483_116008 Ga0400483_116008_18_605 194
356 3300039447 Ga0436361_0417016 Ga0436361_0417016_10262_10846 194
357 3300041452 Ga0451793_1655927 Ga0451793_1655927_19_603 194
358 3300041511 Ga0451855_0832352 Ga0451855_0832352_212_799 194
359 3300042005 Ga0439448_0001231 Ga0439448_0001231_5040_5624 194
360 3300042015 Ga0439462_0047723 Ga0439462_0047723_371_958 194
361 3300042876 Ga0451577_0000092 Ga0451577_0000092_52838_53431 194
362 3300042876 Ga0451577_0004955 Ga0451577_0004955_413_1006 194
363 3300042876 Ga0451577_0005419 Ga0451577_0005419_8744_9337 194
364 3300042876 Ga0451577_0012359 Ga0451577_0012359_2510_3103 194
365 3300042876 Ga0451577_0323721 Ga0451577_0323721_505_1095 194
366 3300042876 Ga0451577_0388630 Ga0451577_0388630_540_1133 194
367 3300042876 Ga0451577_0448630 Ga0451577_0448630_174_767 194
368 3300042876 Ga0451577_0507395 Ga0451577_0507395_118_711 194
369 3300042876 Ga0451577_0879551 Ga0451577_0879551_178_771 194
370 3300042876 Ga0451577_0943037 Ga0451577_0943037_76_669 194
371 3300044673 Ga0453683_0000005 Ga0453683_0000005_604823_605416 194
372 3300044673 Ga0453683_0000310 Ga0453683_0000310_60372_60965 194
373 3300044673 Ga0453683_0004273 Ga0453683_0004273_1820_2413 194
374 3300044673 Ga0453683_0179298 Ga0453683_0179298_70_663 194
375 3300044673 Ga0453683_0462149 Ga0453683_0462149_213_806 194
376 3300044673 Ga0453683_0547773 Ga0453683_0547773_98_691 194
377 3300044673 Ga0453683_0557764 Ga0453683_0557764_64_657 194
378 3300044684 Ga0466966_0024494 Ga0466966_0024494_2035_2619 194
379 3300044693 Ga0466961_0016933 Ga0466961_0016933_3432_4016 194
380 3300044712 Ga0453684_0000506 Ga0453684_0000506_98713_99306 194
381 3300044712 Ga0453684_0000628 Ga0453684_0000628_23793_24386 194
382 3300044712 Ga0453684_0001093 Ga0453684_0001093_23068_23661 194
383 3300044712 Ga0453684_0001226 Ga0453684_0001226_69276_69869 194
384 3300044712 Ga0453684_0004535 Ga0453684_0004535_19042_19629 194
385 3300044712 Ga0453684_0011107 Ga0453684_0011107_4622_5209 194
386 3300044712 Ga0453684_0019447 Ga0453684_0019447_1554_2147 194
387 3300044712 Ga0453684_0020001 Ga0453684_0020001_364_963 194
388 3300044712 Ga0453684_0033679 Ga0453684_0033679_3427_4014 194
389 3300044712 Ga0453684_0075361 Ga0453684_0075361_2688_3281 194
390 3300044712 Ga0453684_0087321 Ga0453684_0087321_1266_1856 194
391 3300044712 Ga0453684_0092525 Ga0453684_0092525_1310_1903 194
392 3300044712 Ga0453684_0149583 Ga0453684_0149583_1189_1776 194
393 3300044712 Ga0453684_0160316 Ga0453684_0160316_48_641 194
394 3300044712 Ga0453684_0377590 Ga0453684_0377590_685_1278 194
395 3300044712 Ga0453684_0506198 Ga0453684_0506198_663_1256 194
396 3300044712 Ga0453684_0520074 Ga0453684_0520074_494_1087 194
397 3300044712 Ga0453684_0594726 Ga0453684_0594726_46_633 194
398 3300044735 Ga0466968_0162798 Ga0466968_0162798_229_813 194
399 3300045049 Ga0466959_0109148 Ga0466959_0109148_1123_1707 194
400 3300045051 Ga0451576_0000022 Ga0451576_0000022_136914_137498 194
401 3300045051 Ga0451576_0000204 Ga0451576_0000204_52838_53431 194
402 3300045051 Ga0451576_0000339 Ga0451576_0000339_14964_15557 194
403 3300045051 Ga0451576_0001565 Ga0451576_0001565_27898_28491 194
404 3300045051 Ga0451576_0004822 Ga0451576_0004822_2890_3483 194
405 3300045051 Ga0451576_0010058 Ga0451576_0010058_8306_8896 194
406 3300045051 Ga0451576_0054235 Ga0451576_0054235_3441_4034 194
407 3300045051 Ga0451576_0145641 Ga0451576_0145641_310_930 194
408 3300045051 Ga0451576_0153039 Ga0451576_0153039_1121_1714 194
409 3300045051 Ga0451576_0178444 Ga0451576_0178444_408_1001 194
410 3300045051 Ga0451576_0262855 Ga0451576_0262855_1166_1765 194
411 3300045051 Ga0451576_0853297 Ga0451576_0853297_60_647 194
412 3300045051 Ga0451576_1385915 Ga0451576_1385915_89_682 194
413 3300045836 Ga0466958_0152249 Ga0466958_0152249_540_1124 194
414 3300046462 Ga0495651_0207294 Ga0495651_0207294_341_925 194
415 3300046463 Ga0495653_0559744 Ga0495653_0559744_88_672 194
416 3300046471 Ga0495650_0000144 Ga0495650_0000144_33166_33750 194
417 3300046471 Ga0495650_0023355 Ga0495650_0023355_770_1354 194
418 3300046471 Ga0495650_0192828 Ga0495650_0192828_75_659 194
419 3300046492 Ga0495585_0000312 Ga0495585_0000312_8309_8893 194
420 3300046492 Ga0495585_0000348 Ga0495585_0000348_12482_13066 194
421 3300046492 Ga0495585_0133678 Ga0495585_0133678_73_657 194
422 3300046500 Ga0495596_0012521 Ga0495596_0012521_2227_2811 194
423 3300046506 Ga0495583_0013618 Ga0495583_0013618_228_812 194
424 3300046506 Ga0495583_0191480 Ga0495583_0191480_207_791 194
425 3300046507 Ga0495606_0000926 Ga0495606_0000926_6658_7242 194
426 3300046507 Ga0495606_0004458 Ga0495606_0004458_7516_8100 194
427 3300046507 Ga0495606_0016626 Ga0495606_0016626_1721_2305 194
428 3300046507 Ga0495606_0019604 Ga0495606_0019604_2167_2751 194
429 3300046507 Ga0495606_0129698 Ga0495606_0129698_554_1138 194
430 3300046512 Ga0495610_0001817 Ga0495610_0001817_2090_2674 194
431 3300046513 Ga0495616_0000915 Ga0495616_0000915_16715_17299 194
432 3300046513 Ga0495616_0009552 Ga0495616_0009552_1510_2094 194
433 3300046518 Ga0495631_0007237 Ga0495631_0007237_1942_2526 194
434 3300046519 Ga0495632_0059924 Ga0495632_0059924_800_1384 194
435 3300046520 Ga0495637_0153327 Ga0495637_0153327_10_594 194
436 3300046523 Ga0495644_0002551 Ga0495644_0002551_2982_3566 194
437 3300046524 Ga0495648_0006389 Ga0495648_0006389_7650_8234 194
438 3300046529 Ga0495652_0075466 Ga0495652_0075466_601_1185 194
439 3300046530 Ga0495654_0067789 Ga0495654_0067789_978_1562 194
440 3300046538 Ga0495609_0051153 Ga0495609_0051153_113_697 194
441 3300046538 Ga0495609_0084895 Ga0495609_0084895_515_1099 194
442 3300046557 Ga0495622_0125095 Ga0495622_0125095_67_651 194
443 3300046558 Ga0495633_0000006 Ga0495633_0000006_50915_51499 194
444 3300046558 Ga0495633_0001260 Ga0495633_0001260_676_1260 194
445 3300046616 Ga0495668_0000011 Ga0495668_0000011_8364_8948 194
446 3300046616 Ga0495668_0095002 Ga0495668_0095002_340_924 194
447 3300046648 Ga0495611_0036219 Ga0495611_0036219_108_692 194
448 3300046660 Ga0495625_0000059 Ga0495625_0000059_144714_145298 194
449 3300046660 Ga0495625_0000371 Ga0495625_0000371_392_976 194
450 3300046660 Ga0495625_0002039 Ga0495625_0002039_978_1562 194
451 3300046660 Ga0495625_0013917 Ga0495625_0013917_2537_3121 194
452 3300046660 Ga0495625_0083499 Ga0495625_0083499_1048_1632 194
453 3300046660 Ga0495625_0086996 Ga0495625_0086996_306_890 194
454 3300046660 Ga0495625_0106562 Ga0495625_0106562_303_887 194
455 3300046660 Ga0495625_0160849 Ga0495625_0160849_771_1355 194
456 3300046660 Ga0495625_0277941 Ga0495625_0277941_355_939 194
457 3300046665 Ga0495661_0005900 Ga0495661_0005900_2050_2634 194
458 3300046665 Ga0495661_0011405 Ga0495661_0011405_272_856 194
459 3300046665 Ga0495661_0023017 Ga0495661_0023017_2967_3551 194
460 3300046665 Ga0495661_0195110 Ga0495661_0195110_163_747 194
461 3300046692 Ga0495671_0129110 Ga0495671_0129110_417_1001 194
462 3300046694 Ga0495649_0000031 Ga0495649_0000031_115939_116523 194
463 3300046694 Ga0495649_0159314 Ga0495649_0159314_381_965 194
464 3300046810 Ga0495660_0021597 Ga0495660_0021597_2867_3451 194
465 3300046810 Ga0495660_0096196 Ga0495660_0096196_908_1492 194
466 3300047323 Ga0495683_0141850 Ga0495683_0141850_508_1092 194
467 3300047443 Ga0495687_000601 Ga0495687_000601_13585_14169 194
468 3300047443 Ga0495687_000783 Ga0495687_000783_9994_10578 194
469 3300047446 Ga0495679_054800 Ga0495679_054800_235_819 194
470 3300047469 Ga0495673_0033046 Ga0495673_0033046_1480_2064 194
471 3300047472 Ga0495686_0001365 Ga0495686_0001365_16305_16889 194
472 3300047472 Ga0495686_0016930 Ga0495686_0016930_248_832 194
473 3300047472 Ga0495686_0160705 Ga0495686_0160705_296_880 194
474 3300047472 Ga0495686_0347225 Ga0495686_0347225_21_605 194
475 3300048089 Ga0495614_0008920 Ga0495614_0008920_1581_2165 194
476 3300048918 Ga0496115_0046402 Ga0496115_0046402_1752_2339 194
477 3300049459 Ga0495678_011997 Ga0495678_011997_1085_1669 194
478 3300049568 Ga0501031_0001144 Ga0501031_0001144_6599_7186 194
479 3300049569 Ga0501032_0001137 Ga0501032_0001137_4140_4727 194
480 3300049569 Ga0501032_0018914 Ga0501032_0018914_1452_2039 194
481 3300049570 Ga0501033_0000045 Ga0501033_0000045_81198_81785 194
482 3300049571 Ga0501034_0000682 Ga0501034_0000682_13799_14386 194
483 3300049571 Ga0501034_0489919 Ga0501034_0489919_540_1127 194
484 3300049572 Ga0501036_0078269 Ga0501036_0078269_1106_1693 194
485 3300049573 Ga0501037_0017262 Ga0501037_0017262_45_632 194
486 3300049574 Ga0501038_0006162 Ga0501038_0006162_6373_6960 194
487 3300049574 Ga0501038_0044033 Ga0501038_0044033_88_675 194
488 3300049575 Ga0501039_0001690 Ga0501039_0001690_4159_4746 194
489 3300049582 Ga0501048_0240343 Ga0501048_0240343_571_1158 194
490 3300049583 Ga0501067_0375167 Ga0501067_0375167_32_619 194
491 3300049822 Ga0501035_0056652 Ga0501035_0056652_1780_2367 194
492 3300049823 Ga0501044_0000502 Ga0501044_0000502_33853_34440 194
493 3300049824 Ga0501045_0000133 Ga0501045_0000133_762_1349 194
494 3300050493 nmdc:mga0k408_69534_c1 nmdc:mga0k408_69534_c1_77_661 194
495 3300050493 nmdc:mga0k408_7957_c1 nmdc:mga0k408_7957_c1_78_662 194
496 3300050496 nmdc:mga07m45_153735_c1 nmdc:mga07m45_153735_c1_66_650 194
497 3300050496 nmdc:mga07m45_246495_c1 nmdc:mga07m45_246495_c1_356_940 194
498 3300053080 Ga0500635_0000274 Ga0500635_0000274_12879_13463 194
499 3300053098 Ga0500650_0045775 Ga0500650_0045775_1008_1592 194
500 3300053122 Ga0500608_018660 Ga0500608_018660_777_1361 194
501 3300053123 Ga0500614_003147 Ga0500614_003147_431_1015 194
502 3300053125 Ga0500618_000018 Ga0500618_000018_52078_52662 194
503 3300053138 Ga0500564_137417 Ga0500564_137417_202_786 194
504 3300053156 Ga0500622_0011822 Ga0500622_0011822_2245_2829 194
505 3300053157 Ga0500624_013495 Ga0500624_013495_185_769 194
506 3300053161 Ga0500634_0107315 Ga0500634_0107315_208_792 194
507 3300059604 Ga0587098_025178 Ga0587098_025178_18_602 194
508 3300059640 Ga0587067_078677 Ga0587067_078677_55_639 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

134

183

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

26

96

0.93

PF08281

Sigma70_r4_2

Sigma-70, region 4

128

180

0.93

PF07638

Sigma70_ECF

ECF sigma factor

7

187

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.9982 141 179
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9693 126 181
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9685 126 181
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9642 141 179
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9581 138 185
ID Description Score Start End Superfamily
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 141 179 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 133 187 1.10.10.10
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9747 133 188 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9726 141 179 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9696 131 187 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A101HJH5-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9854 1 88 GO:0006352
GO:0016987
AF-A0A101HJH5-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9532 1 88 GO:0006352
GO:0016987
AF-A0A3C1Y7H4-F1-model_v4 RNA polymerase subunit sigma-24 0.9195 1 105 GO:0006352
GO:0016987
AF-A0A4Q3EGK4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9142 1 106 GO:0006352
GO:0016987
AF-A0A4Q3EGK4-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9057 1 106 GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
83.92 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map