F455882

General Info

Members Datasets Scaffolds Average Seq Length
502 308 1004 201

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_19879|Ga0400485_19879_68_775
Length 235
Sequence MRRRFCGQVMQKNLPVGGFDCRYKIQVLNCLAQLGSSVMSADGVDLKKRRTLIAATSVVGAVGTAFVAYPFLAAWAPSEKAKAAGAPVEADISKLEPGQMVRVEWRGQPVWIVRRTKQNLADLSALNDRLLDPNSELPQQPPYCQNEHRSIKPEYLVAVGICTHLGCSPTYVPEVAPQDFDAEWKGGFFCPCHGSKFDLAGRVYSGVPAPKNLLIPKYRFMSDTLILVGDDGGAS

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
188 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
189 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
192 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
276 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
279 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
280 2643221593 Lysobacter sp. Root690 Isolate Unclassified
281 2643221638 Duganella sp. Root336D2 Isolate Unclassified
282 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
283 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
284 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
285 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
286 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
287 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
288 2919085039 Luteibacter sp. 1214 Isolate Unclassified
289 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
290 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
291 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
292 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
293 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
294 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
295 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
296 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
297 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
298 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
299 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
300 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
301 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
302 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
303 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
304 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
305 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
306 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
307 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
308 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0.6
Isolates 6.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 3.59
Rhizosphere 71.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_19879 3300038735 Bacteria 1471
2 SwRhRL2b_contig_2162414 2162886007 Bacteria 1708
3 JGI25156J39149_1001027 3300002705 Bacteria 13037
4 JGI25154J39366_1001087 3300002738 Bacteria 10661
5 JGI25157J39369_1000245 3300002741 Bacteria 41331
6 JGI25164J39214_1004143 3300002772 Bacteria 1704
7 JGI25151J46595_10000430 3300003187 Bacteria 41709
8 rootH2_10050328 3300003320 Bacteria 3940
9 rootH1_10048753 3300003323 Bacteria 2989
10 rootH1_10075507 3300003323 Bacteria 1710
11 Ga0055539_1000629 3300003752 Bacteria 9477
12 Ga0055539_1001373 3300003752 Bacteria 4626
13 Ga0055533_1000045 3300003756 Bacteria 223637
14 Ga0055525_1000681 3300003759 Bacteria 12795
15 Ga0055526_1001472 3300003771 Bacteria 16701
16 Ga0055526_1064133 3300003771 Bacteria 770
17 Ga0055537_1000713 3300003773 Bacteria 17195
18 Ga0055537_1024518 3300003773 Bacteria 846
19 Ga0055524_1008350 3300003775 Bacteria 4307
20 Ga0055524_1055870 3300003775 Bacteria 854
21 Ga0055536_1006485 3300003781 Bacteria 5447
22 Ga0055534_1000717 3300003784 Bacteria 16215
23 Ga0055528_1003920 3300003790 Bacteria 7308
24 Ga0055530_10042345 3300003791 Bacteria 1105
25 Ga0055530_10044499 3300003791 Bacteria 1064
26 Ga0055540_1023691 3300003792 Bacteria 1540
27 Ga0055531_10001707 3300003794 Bacteria 15749
28 Ga0055531_10050906 3300003794 Bacteria 1092
29 Ga0058692_1000002 3300003856 Bacteria 508401
30 Ga0065704_10009364 3300005289 Bacteria 3197
31 Ga0065704_10079974 3300005289 Bacteria 4038
32 Ga0070658_10037156 3300005327 Bacteria 3925
33 Ga0070658_10128622 3300005327 Bacteria 2109
34 Ga0070658_10133969 3300005327 Bacteria 2066
35 Ga0070658_10194055 3300005327 Bacteria 1712
36 Ga0070658_10214050 3300005327 Bacteria 1628
37 Ga0070676_10013524 3300005328 Bacteria 4472
38 Ga0070676_10065564 3300005328 Bacteria 2168
39 Ga0070690_100055904 3300005330 Bacteria 2529
40 Ga0070670_100008472 3300005331 Bacteria 8769
41 Ga0070670_100067029 3300005331 Bacteria 3080
42 Ga0070670_100123445 3300005331 Bacteria 2234
43 Ga0070670_100196674 3300005331 Bacteria 1751
44 Ga0070677_10182904 3300005333 Bacteria 999
45 Ga0068869_100500262 3300005334 Bacteria 1015
46 Ga0070680_100156174 3300005336 Bacteria 1917
47 Ga0070680_100337310 3300005336 Bacteria 1281
48 Ga0068868_100080245 3300005338 Bacteria 2614
49 Ga0070660_100295854 3300005339 Bacteria 1326
50 Ga0070661_100087978 3300005344 Bacteria 2298
51 Ga0070661_100147620 3300005344 Bacteria 1776
52 Ga0070668_100104736 3300005347 Bacteria 2246
53 Ga0070668_100106698 3300005347 Bacteria 2226
54 Ga0070669_100018739 3300005353 Bacteria 4947
55 Ga0070669_100447711 3300005353 Bacteria 1064
56 Ga0070675_100005641 3300005354 Bacteria 9582
57 Ga0070675_100711915 3300005354 Bacteria 915
58 Ga0070671_100002643 3300005355 Bacteria 13868
59 Ga0070671_100009715 3300005355 Bacteria 7728
60 Ga0070671_100116700 3300005355 Bacteria 2244
61 Ga0070671_100208242 3300005355 Bacteria 1658
62 Ga0070674_100004218 3300005356 Bacteria 8168
63 Ga0070674_100016880 3300005356 Bacteria 4581
64 Ga0070673_100013730 3300005364 Bacteria 5616
65 Ga0070673_100089598 3300005364 Bacteria 2511
66 Ga0070659_100130947 3300005366 Bacteria 2037
67 Ga0070659_100369398 3300005366 Bacteria 1206
68 Ga0070667_100316488 3300005367 Bacteria 1408
69 Ga0070663_100500921 3300005455 Bacteria 1008
70 Ga0070663_100505191 3300005455 Bacteria 1004
71 Ga0070678_100025611 3300005456 Bacteria 3973
72 Ga0070678_100092422 3300005456 Bacteria 2324
73 Ga0070678_100109966 3300005456 Bacteria 2154
74 Ga0070678_100118118 3300005456 Bacteria 2087
75 Ga0070678_100575218 3300005456 Bacteria 1003
76 Ga0068867_100001379 3300005459 Bacteria 16789
77 Ga0068867_100029784 3300005459 Bacteria 3934
78 Ga0068867_100130890 3300005459 Bacteria 1949
79 Ga0068867_100344061 3300005459 Bacteria 1242
80 Ga0070679_100019818 3300005530 Bacteria 6548
81 Ga0070679_100292408 3300005530 Bacteria 1580
82 Ga0070684_100096843 3300005535 Bacteria 2631
83 Ga0070672_100000327 3300005543 Bacteria 27160
84 Ga0070672_100079611 3300005543 Bacteria 2623
85 Ga0070665_100145661 3300005548 Bacteria 2372
86 Ga0070665_100310140 3300005548 Bacteria 1581
87 Ga0068855_100071883 3300005563 Bacteria 4021
88 Ga0070664_100211656 3300005564 Bacteria 1733
89 Ga0070664_100279702 3300005564 Bacteria 1505
90 Ga0070664_100508405 3300005564 Bacteria 1111
91 Ga0068854_100006652 3300005578 Bacteria 7365
92 Ga0068854_100206331 3300005578 Bacteria 1548
93 Ga0068854_100213973 3300005578 Bacteria 1522
94 Ga0068854_100581824 3300005578 Bacteria 953
95 Ga0068856_100001716 3300005614 Bacteria 22915
96 Ga0068856_100762189 3300005614 Bacteria 988
97 Ga0068852_100035604 3300005616 Bacteria 4155
98 Ga0068852_100051508 3300005616 Bacteria 3533
99 Ga0068852_101139489 3300005616 Bacteria 800
100 Ga0068864_100095314 3300005618 Bacteria 2632
101 Ga0068866_10119540 3300005718 Bacteria 1483
102 Ga0068861_100497902 3300005719 Bacteria 1101
103 Ga0068851_10074659 3300005834 Bacteria 1761
104 Ga0068870_10386194 3300005840 Bacteria 907
105 Ga0068863_100213035 3300005841 Bacteria 1860
106 Ga0075365_10298411 3300006038 Bacteria 1134
107 Ga0075364_10104998 3300006051 Bacteria 1882
108 Ga0075364_10191437 3300006051 Bacteria 1385
109 Ga0075367_10248131 3300006178 Bacteria 1116
110 Ga0075366_10027848 3300006195 Bacteria 3316
111 Ga0097621_100034290 3300006237 Bacteria 4048
112 Ga0075370_10003632 3300006353 Bacteria 7383
113 Ga0068871_100009237 3300006358 Bacteria 7131
114 Ga0068871_100488767 3300006358 Bacteria 1108
115 Ga0068871_100575057 3300006358 Bacteria 1022
116 Ga0068865_100269209 3300006881 Bacteria 1352
117 Ga0105244_10186396 3300009036 Bacteria 982
118 Ga0105240_10086298 3300009093 Bacteria 3844
119 Ga0105243_10015602 3300009148 Bacteria 5743
120 Ga0105241_10064093 3300009174 Bacteria 2837
121 Ga0105242_10014535 3300009176 Bacteria 6099
122 Ga0105242_10340584 3300009176 Bacteria 1382
123 Ga0105248_10292938 3300009177 Bacteria 1833
124 Ga0105248_10439872 3300009177 Bacteria 1469
125 Ga0105237_10061269 3300009545 Bacteria 3762
126 Ga0105237_10167569 3300009545 Bacteria 2196
127 Ga0105238_10571669 3300009551 Bacteria 1136
128 Ga0105249_10342096 3300009553 Bacteria 1513
129 Ga0105246_10130573 3300011119 Bacteria 1876
130 Ga0157371_10000429 3300013102 Bacteria 51605
131 Ga0157371_10106505 3300013102 Bacteria 1990
132 Ga0157371_10180657 3300013102 Bacteria 1509
133 Ga0157370_10157195 3300013104 Bacteria 2115
134 Ga0157369_10024224 3300013105 Bacteria 6755
135 Ga0157369_10860426 3300013105 Bacteria 930
136 Ga0157374_10134402 3300013296 Bacteria 2396
137 Ga0157374_10389282 3300013296 Bacteria 1389
138 Ga0157378_10091367 3300013297 Bacteria 2767
139 Ga0157378_10303726 3300013297 Bacteria 1545
140 Ga0163162_10137847 3300013306 Bacteria 2551
141 Ga0163162_10468498 3300013306 Bacteria 1391
142 Ga0163162_10660999 3300013306 Bacteria 1168
143 Ga0163162_10986091 3300013306 Bacteria 952
144 Ga0157372_10171484 3300013307 Bacteria 2510
145 Ga0157372_10234276 3300013307 Bacteria 2129
146 Ga0157372_10430988 3300013307 Bacteria 1537
147 Ga0157372_10486409 3300013307 Bacteria 1439
148 Ga0157375_10304369 3300013308 Bacteria 1758
149 Ga0157375_10452547 3300013308 Bacteria 1449
150 Ga0157375_10460331 3300013308 Bacteria 1437
151 Ga0157380_10476373 3300014326 Bacteria 1206
152 Ga0182008_10077529 3300014497 Bacteria 1635
153 Ga0157379_10234712 3300014968 Bacteria 1663
154 Ga0157379_10560425 3300014968 Bacteria 1064
155 Ga0157376_10044766 3300014969 Bacteria 3640
156 Ga0182006_1045519 3300015261 Bacteria 1707
157 Ga0182006_1104697 3300015261 Bacteria 1000
158 Ga0182007_10000127 3300015262 Bacteria 53385
159 Ga0182005_1000168 3300015265 Bacteria 45063
160 Ga0183360_10001 3300015689 Bacteria 3943671
161 Ga0163161_10025882 3300017792 Bacteria 4155
162 Ga0163161_10059409 3300017792 Bacteria 2780
163 Ga0163161_10433104 3300017792 Bacteria 1060
164 Ga0163161_10488419 3300017792 Bacteria 1001
165 Ga0209674_100073 3300025226 Bacteria 223689
166 Ga0209563_100061 3300025230 Bacteria 274295
167 Ga0207427_101392 3300025231 Bacteria 8858
168 Ga0209258_101087 3300025242 Bacteria 11629
169 Ga0207425_1007111 3300025245 Bacteria 2990
170 Ga0209646_1000076 3300025246 Bacteria 212891
171 Ga0209026_1000011 3300025250 Bacteria 507291
172 Ga0209677_100070 3300025253 Bacteria 143311
173 Ga0209677_100751 3300025253 Bacteria 16421
174 Ga0209677_102967 3300025253 Bacteria 5903
175 Ga0209759_1000034 3300025256 Bacteria 271209
176 Ga0209759_1001263 3300025256 Bacteria 15243
177 Ga0209759_1041446 3300025256 Bacteria 788
178 Ga0209565_1000014 3300025263 Bacteria 530302
179 Ga0209565_1050648 3300025263 Bacteria 746
180 Ga0209673_1000570 3300025273 Bacteria 58750
181 Ga0209675_1000021 3300025291 Bacteria 334833
182 Ga0209676_1000047 3300025292 Bacteria 408645
183 Ga0209676_1000079 3300025292 Bacteria 290447
184 Ga0209025_1000102 3300025294 Bacteria 228393
185 Ga0209564_1000263 3300025295 Bacteria 112148
186 Ga0209758_1075605 3300025297 Bacteria 1040
187 Ga0209050_1000153 3300025298 Bacteria 160851
188 Ga0209050_1013804 3300025298 Bacteria 3549
189 Ga0209256_1014020 3300025299 Bacteria 2921
190 Ga0209051_1000904 3300025303 Bacteria 29543
191 Ga0209051_1006455 3300025303 Bacteria 6603
192 Ga0209051_1013888 3300025303 Bacteria 3797
193 Ga0209051_1055050 3300025303 Bacteria 1294
194 Ga0209257_1000081 3300025304 Bacteria 306577
195 Ga0209257_1000664 3300025304 Bacteria 54069
196 Ga0209257_1002586 3300025304 Bacteria 17596
197 Ga0209257_1009765 3300025304 Bacteria 5037
198 Ga0207697_10011976 3300025315 Bacteria 3651
199 Ga0207642_10173045 3300025899 Bacteria 1170
200 Ga0207688_10149730 3300025901 Bacteria 1378
201 Ga0207688_10196858 3300025901 Bacteria 1207
202 Ga0207645_10020012 3300025907 Bacteria 4382
203 Ga0207645_10234010 3300025907 Bacteria 1213
204 Ga0207705_10059844 3300025909 Bacteria 2750
205 Ga0207705_10124287 3300025909 Bacteria 1916
206 Ga0207705_10200598 3300025909 Bacteria 1511
207 Ga0207705_10207310 3300025909 Bacteria 1486
208 Ga0207707_10364896 3300025912 Bacteria 1243
209 Ga0207695_10005493 3300025913 Bacteria 16778
210 Ga0207671_10418721 3300025914 Bacteria 1066
211 Ga0207660_10158603 3300025917 Bacteria 1744
212 Ga0207657_10394067 3300025919 Bacteria 1089
213 Ga0207649_10632391 3300025920 Bacteria 825
214 Ga0207652_10121679 3300025921 Bacteria 2322
215 Ga0207652_11120252 3300025921 Bacteria 688
216 Ga0207681_10127568 3300025923 Bacteria 1876
217 Ga0207681_10633590 3300025923 Bacteria 885
218 Ga0207694_10117168 3300025924 Bacteria 2123
219 Ga0207650_10000149 3300025925 Bacteria 83837
220 Ga0207650_10157166 3300025925 Bacteria 1799
221 Ga0207650_10473126 3300025925 Bacteria 1045
222 Ga0207659_10000394 3300025926 Bacteria 26304
223 Ga0207687_10641832 3300025927 Bacteria 898
224 Ga0207644_10000264 3300025931 Bacteria 35311
225 Ga0207644_10003679 3300025931 Bacteria 9942
226 Ga0207644_10044460 3300025931 Bacteria 3155
227 Ga0207644_10264064 3300025931 Bacteria 1377
228 Ga0207690_10578421 3300025932 Bacteria 915
229 Ga0207690_10817693 3300025932 Bacteria 770
230 Ga0207706_10585131 3300025933 Bacteria 959
231 Ga0207686_10007774 3300025934 Bacteria 5779
232 Ga0207686_10098048 3300025934 Bacteria 1951
233 Ga0207709_10000930 3300025935 Bacteria 22057
234 Ga0207670_10137645 3300025936 Bacteria 1797
235 Ga0207669_10000874 3300025937 Bacteria 12794
236 Ga0207669_10295538 3300025937 Bacteria 1228
237 Ga0207669_10805349 3300025937 Bacteria 779
238 Ga0207704_10549673 3300025938 Bacteria 938
239 Ga0207665_10135122 3300025939 Bacteria 1754
240 Ga0207691_10001736 3300025940 Bacteria 21490
241 Ga0207691_10003043 3300025940 Bacteria 16350
242 Ga0207691_10036005 3300025940 Bacteria 4588
243 Ga0207691_10149414 3300025940 Bacteria 2055
244 Ga0207711_10003550 3300025941 Bacteria 13509
245 Ga0207689_10094481 3300025942 Bacteria 2456
246 Ga0207689_10134846 3300025942 Bacteria 2033
247 Ga0207679_10265564 3300025945 Bacteria 1466
248 Ga0207679_10353048 3300025945 Bacteria 1282
249 Ga0207679_10484693 3300025945 Bacteria 1101
250 Ga0207667_10115848 3300025949 Bacteria 2762
251 Ga0207667_10268630 3300025949 Bacteria 1744
252 Ga0207667_10657257 3300025949 Bacteria 1053
253 Ga0207651_10001608 3300025960 Bacteria 10344
254 Ga0207651_10003954 3300025960 Bacteria 7360
255 Ga0207651_10052834 3300025960 Bacteria 2773
256 Ga0207668_10093881 3300025972 Bacteria 2211
257 Ga0207640_10036768 3300025981 Bacteria 3077
258 Ga0207640_10081574 3300025981 Bacteria 2212
259 Ga0207640_10170811 3300025981 Bacteria 1620
260 Ga0207640_10322806 3300025981 Bacteria 1230
261 Ga0207658_10188205 3300025986 Bacteria 1714
262 Ga0207658_10357939 3300025986 Bacteria 1272
263 Ga0207677_10056587 3300026023 Bacteria 2688
264 Ga0207678_10007141 3300026067 Bacteria 9911
265 Ga0207678_10271552 3300026067 Bacteria 1454
266 Ga0207702_10001565 3300026078 Bacteria 22647
267 Ga0207641_10031836 3300026088 Bacteria 4376
268 Ga0207648_10055368 3300026089 Bacteria 3462
269 Ga0207648_10163179 3300026089 Bacteria 1968
270 Ga0207676_10203374 3300026095 Bacteria 1751
271 Ga0207676_10664799 3300026095 Bacteria 1006
272 Ga0207676_11140447 3300026095 Bacteria 771
273 Ga0207674_10005653 3300026116 Bacteria 14825
274 Ga0207675_100017046 3300026118 Bacteria 6788
275 Ga0207683_10008540 3300026121 Bacteria 8765
276 Ga0207683_10148137 3300026121 Bacteria 2118
277 Ga0207683_10148712 3300026121 Bacteria 2113
278 Ga0207683_10351859 3300026121 Bacteria 1352
279 Ga0207683_10730044 3300026121 Bacteria 919
280 Ga0207698_10009501 3300026142 Bacteria 6204
281 Ga0207698_10139071 3300026142 Bacteria 2089
282 Ga0207698_10223658 3300026142 Bacteria 1703
283 Ga0207698_10489973 3300026142 Bacteria 1194
284 Ga0209371_1000004 3300027312 Bacteria 1098197
285 Ga0209967_1005782 3300027364 Bacteria 1669
286 Ga0268266_10053077 3300028379 Bacteria 3482
287 Ga0268266_10245124 3300028379 Bacteria 1655
288 Ga0265336_10000036 3300028666 Bacteria 154609
289 Ga0307515_10284701 3300028794 Bacteria 1356
290 Ga0265324_10000136 3300029957 Bacteria 57490
291 Ga0268256_1000005 3300030500 Bacteria 1082342
292 Ga0316178_1026255 3300030735 Bacteria 955
293 Ga0307513_10004594 3300031456 Bacteria 18392
294 Ga0307509_10269348 3300031507 Bacteria 1472
295 Ga0307408_100000285 3300031548 Bacteria 50296
296 Ga0307408_100161518 3300031548 Bacteria 1780
297 Ga0307516_10004973 3300031730 Bacteria 16142
298 Ga0307516_10098842 3300031730 Bacteria 2736
299 Ga0307516_10245800 3300031730 Bacteria 1486
300 Ga0307405_10006874 3300031731 Bacteria 5641
301 Ga0307405_10582323 3300031731 Bacteria 910
302 Ga0307413_10024068 3300031824 Bacteria 3312
303 Ga0307413_10303594 3300031824 Bacteria 1212
304 Ga0307413_10601742 3300031824 Bacteria 900
305 Ga0307410_10008211 3300031852 Bacteria 5777
306 Ga0307410_10084632 3300031852 Bacteria 2236
307 Ga0307410_10981729 3300031852 Bacteria 727
308 Ga0307406_10010424 3300031901 Bacteria 5240
309 Ga0307406_10178436 3300031901 Bacteria 1544
310 Ga0307406_10296338 3300031901 Bacteria 1240
311 Ga0307407_10014479 3300031903 Bacteria 3865
312 Ga0307412_10015454 3300031911 Bacteria 4528
313 Ga0307409_100389882 3300031995 Bacteria 1327
314 Ga0307416_101544504 3300032002 Bacteria 769
315 Ga0307414_10025210 3300032004 Bacteria 3805
316 Ga0307414_10028093 3300032004 Bacteria 3644
317 Ga0307414_10180054 3300032004 Bacteria 1699
318 Ga0307414_10251311 3300032004 Bacteria 1470
319 Ga0307414_10319760 3300032004 Bacteria 1320
320 Ga0307414_10471618 3300032004 Bacteria 1105
321 Ga0307411_10072174 3300032005 Bacteria 2343
322 Ga0307411_10166611 3300032005 Bacteria 1657
323 Ga0307411_10312369 3300032005 Bacteria 1265
324 Ga0307411_10836375 3300032005 Bacteria 813
325 Ga0395899_0029496 3300037312 Bacteria 4126
326 Ga0395899_0044080 3300037312 Bacteria 3324
327 Ga0395899_0080757 3300037312 Bacteria 2366
328 Ga0395899_0391759 3300037312 Bacteria 921
329 Ga0395900_0000514 3300037418 Bacteria 54749
330 Ga0395900_0009652 3300037418 Bacteria 9898
331 Ga0395900_0031777 3300037418 Bacteria 5426
332 Ga0395900_0253697 3300037418 Bacteria 1759
333 Ga0395900_1022949 3300037418 Bacteria 745
334 Ga0395898_0003251 3300037466 Bacteria 18262
335 Ga0395898_0037937 3300037466 Bacteria 4777
336 Ga0395898_0044157 3300037466 Bacteria 4390
337 Ga0395898_0089583 3300037466 Bacteria 2960
338 Ga0395898_0109177 3300037466 Bacteria 2653
339 Ga0395898_0266648 3300037466 Bacteria 1633
340 Ga0395898_0763933 3300037466 Bacteria 907
341 Ga0395905_0003749 3300037471 Bacteria 16101
342 Ga0395905_0011773 3300037471 Bacteria 8444
343 Ga0395905_0027570 3300037471 Bacteria 5356
344 Ga0395905_0089996 3300037471 Bacteria 2877
345 Ga0395905_0251417 3300037471 Bacteria 1651
346 Ga0395905_0304238 3300037471 Bacteria 1482
347 Ga0395905_0427598 3300037471 Bacteria 1221
348 Ga0395901_0003179 3300038443 Bacteria 16526
349 Ga0395901_0027639 3300038443 Bacteria 5830
350 Ga0395901_0092749 3300038443 Bacteria 3161
351 Ga0395901_0235087 3300038443 Bacteria 1912
352 Ga0395901_0332386 3300038443 Bacteria 1571
353 Ga0395901_0829596 3300038443 Bacteria 911
354 Ga0237819_00925 3300038705 Bacteria 9056
355 Ga0237819_02667 3300038705 Bacteria 3481
356 Ga0237819_09016 3300038705 Bacteria 1357
357 Ga0400490_47037 3300038726 Bacteria 11438
358 Ga0400490_50483 3300038726 Bacteria 25263
359 Ga0400490_57681 3300038726 Bacteria 1479
360 Ga0400485_15170 3300038735 Bacteria 2493
361 Ga0400486_10179 3300038742 Bacteria 7565
362 Ga0400483_071977 3300039062 Bacteria 8745
363 Ga0400483_115881 3300039062 Bacteria 1526
364 Ga0400483_162261 3300039062 Bacteria 1831
365 Ga0400489_82739 3300039093 Bacteria 12458
366 Ga0400487_12706 3300039110 Bacteria 3586
367 Ga0436361_0535775 3300039447 Bacteria 4122
368 Ga0436361_0711422 3300039447 Bacteria 4175
369 Ga0439436_0008829 3300041404 Bacteria 3095
370 Ga0451791_1149829 3300041451 Bacteria 691
371 Ga0451800_0331456 3300041459 Bacteria 677
372 Ga0451804_0568692 3300041463 Bacteria 1074
373 Ga0451804_1103520 3300041463 Bacteria 772
374 Ga0451807_1453451 3300041486 Bacteria 1188
375 Ga0439431_0084113 3300041997 Bacteria 861
376 Ga0439445_0082974 3300042004 Bacteria 897
377 Ga0439448_0091019 3300042005 Bacteria 1031
378 Ga0439432_019793 3300042006 Bacteria 2240
379 Ga0439449_0029459 3300042007 Bacteria 2046
380 Ga0439455_0224406 3300042012 Bacteria 547
381 Ga0439457_085945 3300042014 Bacteria 725
382 Ga0439464_0083430 3300042439 Bacteria 957
383 Ga0466965_0025409 3300044683 Bacteria 2866
384 Ga0466966_0007854 3300044684 Bacteria 7059
385 Ga0466961_0027475 3300044693 Bacteria 3659
386 Ga0466964_0001613 3300044706 Bacteria 7783
387 Ga0466971_0013051 3300044719 Bacteria 3644
388 Ga0466970_0066207 3300044765 Bacteria 1939
389 Ga0466957_0038830 3300044842 Bacteria 2870
390 Ga0466959_0082526 3300045049 Bacteria 2315
391 Ga0466958_0009465 3300045836 Bacteria 5430
392 Ga0466967_0530738 3300045976 Bacteria 1157
393 Ga0466967_1434905 3300045976 Bacteria 687
394 Ga0495627_012048 3300046453 Bacteria 3079
395 Ga0495638_0041441 3300046460 Bacteria 2913
396 Ga0495650_0079565 3300046471 Bacteria 1267
397 Ga0495583_0000129 3300046506 Bacteria 126766
398 Ga0495606_0006415 3300046507 Bacteria 10855
399 Ga0495631_0243945 3300046518 Bacteria 766
400 Ga0495648_0326766 3300046524 Bacteria 709
401 Ga0495663_0000203 3300046525 Bacteria 23635
402 Ga0495663_0055232 3300046525 Bacteria 1238
403 Ga0495598_0018402 3300046537 Bacteria 1816
404 Ga0495656_0154615 3300046615 Bacteria 1110
405 Ga0495668_0104153 3300046616 Bacteria 1552
406 Ga0495625_0141994 3300046660 Bacteria 1619
407 Ga0495658_0398965 3300046683 Bacteria 877
408 Ga0495669_0072416 3300046684 Bacteria 1572
409 Ga0495671_0041080 3300046692 Bacteria 2330
410 Ga0495649_0062115 3300046694 Bacteria 2008
411 Ga0495589_0054971 3300046794 Bacteria 1962
412 Ga0495660_0071012 3300046810 Bacteria 1847
413 Ga0495686_0010557 3300047472 Bacteria 6561
414 Ga0496100_0745507 3300048903 Bacteria 766
415 Ga0496101_0116958 3300048904 Bacteria 2012
416 Ga0496104_0058299 3300048907 Bacteria 3655
417 Ga0496104_0582161 3300048907 Bacteria 1030
418 Ga0496105_0016600 3300048908 Bacteria 5879
419 Ga0496108_0220908 3300048911 Bacteria 1646
420 Ga0496108_0465830 3300048911 Bacteria 1104
421 Ga0496109_0129592 3300048912 Bacteria 2354
422 Ga0496109_0192189 3300048912 Bacteria 1918
423 Ga0496109_0444797 3300048912 Bacteria 1224
424 Ga0496110_0411391 3300048913 Bacteria 1233
425 Ga0496112_0307470 3300048915 Bacteria 1530
426 Ga0496113_0524733 3300048916 Bacteria 950
427 Ga0496116_0054246 3300048919 Bacteria 2642
428 Ga0496117_0002078 3300048920 Bacteria 26449
429 Ga0496117_0044096 3300048920 Bacteria 3233
430 Ga0496117_0192398 3300048920 Bacteria 1160
431 Ga0496118_0000573 3300048921 Bacteria 60932
432 Ga0496118_0004832 3300048921 Bacteria 15713
433 Ga0496119_0000211 3300048922 Bacteria 83064
434 Ga0496120_0000525 3300048923 Bacteria 59273
435 Ga0496121_0061039 3300048924 Bacteria 3096
436 Ga0496123_0090758 3300048926 Bacteria 1815
437 Ga0496123_0141228 3300048926 Bacteria 1316
438 Ga0496124_0013804 3300048927 Bacteria 7857
439 Ga0496124_0015296 3300048927 Bacteria 7363
440 Ga0496124_0067474 3300048927 Bacteria 2976
441 Ga0496125_0019580 3300048928 Bacteria 6377
442 Ga0496126_0000806 3300048929 Bacteria 56104
443 Ga0496126_0284813 3300048929 Bacteria 1368
444 Ga0501308_024695 3300049128 Bacteria 775
445 Ga0501317_021928 3300049533 Bacteria 871
446 Ga0501031_0235215 3300049568 Bacteria 1191
447 Ga0501033_0056953 3300049570 Bacteria 2888
448 Ga0501034_0000571 3300049571 Bacteria 58421
449 Ga0501034_0002251 3300049571 Bacteria 23717
450 Ga0501034_0019916 3300049571 Bacteria 6852
451 Ga0501036_0177777 3300049572 Bacteria 1792
452 Ga0501036_0584053 3300049572 Bacteria 927
453 Ga0501038_0154319 3300049574 Bacteria 1870
454 Ga0501043_0059593 3300049579 Bacteria 2996
455 Ga0501070_0274589 3300049586 Bacteria 1376
456 Ga0501072_0037721 3300049588 Bacteria 3790
457 Ga0501074_0160895 3300049590 Bacteria 1604
458 Ga0501234_077806 3300049707 Bacteria 581
459 Ga0501035_0027305 3300049822 Bacteria 5217
460 Ga0501044_0003946 3300049823 Bacteria 16620
461 Ga0501044_0607071 3300049823 Bacteria 987
462 nmdc:mga0k408_46389_c1 3300050493 Bacteria 2509
463 nmdc:mga0k408_501186_c1 3300050493 Bacteria 719
464 nmdc:mga07m45_522_c1 3300050496 Bacteria 13513
465 Ga0500635_0146038 3300053080 Bacteria 900
466 Ga0500641_0003573 3300053096 Bacteria 5484
467 Ga0500608_142448 3300053122 Bacteria 1061
468 Ga0500658_0124536 3300053134 Bacteria 1145
469 Ga0500634_0000070 3300053161 Bacteria 40723
470 Ga0587083_0006361 3300059505 Bacteria 1757
471 Ga0466962_0039339 3300061719 Bacteria 2264
472 2547500886 2547132130 Bacteria 4660562
473 2578458920 2576861471 Bacteria 4648976
474 2643977744 2643221593 Bacteria 6296053
475 2644212370 2643221638 Bacteria 6579467
476 2747948746 2747842428 Bacteria 4689383
477 2765578446 2765235840 Bacteria 4663337
478 2816516463 2816332141 Bacteria 4436036
479 2852651271 2852649853 Bacteria 4036942
480 2874221069 2874220319 Bacteria 4594709
481 2881715870 2881714928 Bacteria 2469486
482 2919088763 2919085039 Bacteria 4532964
483 2919091279 2919089067 Bacteria 4560942
484 2919136381 2919134579 Bacteria 4480386
485 2919690182 2919688452 Bacteria 4595932
486 2928497911 2928496128 Bacteria 4631123
487 2931381285 2931380184 Bacteria 4455911
488 2937611891 2937610967 Bacteria 4618818
489 2939590570 2939589442 Bacteria 4214238
490 2939615262 2939611941 Bacteria 3892017
491 2939629623 2939626828 Bacteria 4695272
492 2941477784 2941475908 Bacteria 4145589
493 2961047834 2961047084 Bacteria 4594415
494 2961067173 2961064222 Bacteria 4749990
495 2974309383 2974307012 Bacteria 4172388
496 2977250103 2977247770 Bacteria 4160543
497 2984515407 2984514374 Bacteria 4172479
498 2995950569 2995948881 Bacteria 6358104
499 8021624312 8021622325 Bacteria 4844743
500 8021628217 8021626552 Bacteria 4665214
501 8021651474 8021648035 Bacteria 4772378
502 8054358700 8054357960 Bacteria 2867777
503 Ga0400485_19879
504 SwRhRL2b_contig_2162414
505 JGI25156J39149_1001027
506 JGI25154J39366_1001087
507 JGI25157J39369_1000245
508 JGI25164J39214_1004143
509 JGI25151J46595_10000430
510 rootH2_10050328
511 rootH1_10048753
512 rootH1_10075507
513 Ga0055539_1000629
514 Ga0055539_1001373
515 Ga0055533_1000045
516 Ga0055525_1000681
517 Ga0055526_1001472
518 Ga0055526_1064133
519 Ga0055537_1000713
520 Ga0055537_1024518
521 Ga0055524_1008350
522 Ga0055524_1055870
523 Ga0055536_1006485
524 Ga0055534_1000717
525 Ga0055528_1003920
526 Ga0055530_10042345
527 Ga0055530_10044499
528 Ga0055540_1023691
529 Ga0055531_10001707
530 Ga0055531_10050906
531 Ga0058692_1000002
532 Ga0065704_10009364
533 Ga0065704_10079974
534 Ga0070658_10037156
535 Ga0070658_10128622
536 Ga0070658_10133969
537 Ga0070658_10194055
538 Ga0070658_10214050
539 Ga0070676_10013524
540 Ga0070676_10065564
541 Ga0070690_100055904
542 Ga0070670_100008472
543 Ga0070670_100067029
544 Ga0070670_100123445
545 Ga0070670_100196674
546 Ga0070677_10182904
547 Ga0068869_100500262
548 Ga0070680_100156174
549 Ga0070680_100337310
550 Ga0068868_100080245
551 Ga0070660_100295854
552 Ga0070661_100087978
553 Ga0070661_100147620
554 Ga0070668_100104736
555 Ga0070668_100106698
556 Ga0070669_100018739
557 Ga0070669_100447711
558 Ga0070675_100005641
559 Ga0070675_100711915
560 Ga0070671_100002643
561 Ga0070671_100009715
562 Ga0070671_100116700
563 Ga0070671_100208242
564 Ga0070674_100004218
565 Ga0070674_100016880
566 Ga0070673_100013730
567 Ga0070673_100089598
568 Ga0070659_100130947
569 Ga0070659_100369398
570 Ga0070667_100316488
571 Ga0070663_100500921
572 Ga0070663_100505191
573 Ga0070678_100025611
574 Ga0070678_100092422
575 Ga0070678_100109966
576 Ga0070678_100118118
577 Ga0070678_100575218
578 Ga0068867_100001379
579 Ga0068867_100029784
580 Ga0068867_100130890
581 Ga0068867_100344061
582 Ga0070679_100019818
583 Ga0070679_100292408
584 Ga0070684_100096843
585 Ga0070672_100000327
586 Ga0070672_100079611
587 Ga0070665_100145661
588 Ga0070665_100310140
589 Ga0068855_100071883
590 Ga0070664_100211656
591 Ga0070664_100279702
592 Ga0070664_100508405
593 Ga0068854_100006652
594 Ga0068854_100206331
595 Ga0068854_100213973
596 Ga0068854_100581824
597 Ga0068856_100001716
598 Ga0068856_100762189
599 Ga0068852_100035604
600 Ga0068852_100051508
601 Ga0068852_101139489
602 Ga0068864_100095314
603 Ga0068866_10119540
604 Ga0068861_100497902
605 Ga0068851_10074659
606 Ga0068870_10386194
607 Ga0068863_100213035
608 Ga0075365_10298411
609 Ga0075364_10104998
610 Ga0075364_10191437
611 Ga0075367_10248131
612 Ga0075366_10027848
613 Ga0097621_100034290
614 Ga0075370_10003632
615 Ga0068871_100009237
616 Ga0068871_100488767
617 Ga0068871_100575057
618 Ga0068865_100269209
619 Ga0105244_10186396
620 Ga0105240_10086298
621 Ga0105243_10015602
622 Ga0105241_10064093
623 Ga0105242_10014535
624 Ga0105242_10340584
625 Ga0105248_10292938
626 Ga0105248_10439872
627 Ga0105237_10061269
628 Ga0105237_10167569
629 Ga0105238_10571669
630 Ga0105249_10342096
631 Ga0105246_10130573
632 Ga0157371_10000429
633 Ga0157371_10106505
634 Ga0157371_10180657
635 Ga0157370_10157195
636 Ga0157369_10024224
637 Ga0157369_10860426
638 Ga0157374_10134402
639 Ga0157374_10389282
640 Ga0157378_10091367
641 Ga0157378_10303726
642 Ga0163162_10137847
643 Ga0163162_10468498
644 Ga0163162_10660999
645 Ga0163162_10986091
646 Ga0157372_10171484
647 Ga0157372_10234276
648 Ga0157372_10430988
649 Ga0157372_10486409
650 Ga0157375_10304369
651 Ga0157375_10452547
652 Ga0157375_10460331
653 Ga0157380_10476373
654 Ga0182008_10077529
655 Ga0157379_10234712
656 Ga0157379_10560425
657 Ga0157376_10044766
658 Ga0182006_1045519
659 Ga0182006_1104697
660 Ga0182007_10000127
661 Ga0182005_1000168
662 Ga0183360_10001
663 Ga0163161_10025882
664 Ga0163161_10059409
665 Ga0163161_10433104
666 Ga0163161_10488419
667 Ga0209674_100073
668 Ga0209563_100061
669 Ga0207427_101392
670 Ga0209258_101087
671 Ga0207425_1007111
672 Ga0209646_1000076
673 Ga0209026_1000011
674 Ga0209677_100070
675 Ga0209677_100751
676 Ga0209677_102967
677 Ga0209759_1000034
678 Ga0209759_1001263
679 Ga0209759_1041446
680 Ga0209565_1000014
681 Ga0209565_1050648
682 Ga0209673_1000570
683 Ga0209675_1000021
684 Ga0209676_1000047
685 Ga0209676_1000079
686 Ga0209025_1000102
687 Ga0209564_1000263
688 Ga0209758_1075605
689 Ga0209050_1000153
690 Ga0209050_1013804
691 Ga0209256_1014020
692 Ga0209051_1000904
693 Ga0209051_1006455
694 Ga0209051_1013888
695 Ga0209051_1055050
696 Ga0209257_1000081
697 Ga0209257_1000664
698 Ga0209257_1002586
699 Ga0209257_1009765
700 Ga0207697_10011976
701 Ga0207642_10173045
702 Ga0207688_10149730
703 Ga0207688_10196858
704 Ga0207645_10020012
705 Ga0207645_10234010
706 Ga0207705_10059844
707 Ga0207705_10124287
708 Ga0207705_10200598
709 Ga0207705_10207310
710 Ga0207707_10364896
711 Ga0207695_10005493
712 Ga0207671_10418721
713 Ga0207660_10158603
714 Ga0207657_10394067
715 Ga0207649_10632391
716 Ga0207652_10121679
717 Ga0207652_11120252
718 Ga0207681_10127568
719 Ga0207681_10633590
720 Ga0207694_10117168
721 Ga0207650_10000149
722 Ga0207650_10157166
723 Ga0207650_10473126
724 Ga0207659_10000394
725 Ga0207687_10641832
726 Ga0207644_10000264
727 Ga0207644_10003679
728 Ga0207644_10044460
729 Ga0207644_10264064
730 Ga0207690_10578421
731 Ga0207690_10817693
732 Ga0207706_10585131
733 Ga0207686_10007774
734 Ga0207686_10098048
735 Ga0207709_10000930
736 Ga0207670_10137645
737 Ga0207669_10000874
738 Ga0207669_10295538
739 Ga0207669_10805349
740 Ga0207704_10549673
741 Ga0207665_10135122
742 Ga0207691_10001736
743 Ga0207691_10003043
744 Ga0207691_10036005
745 Ga0207691_10149414
746 Ga0207711_10003550
747 Ga0207689_10094481
748 Ga0207689_10134846
749 Ga0207679_10265564
750 Ga0207679_10353048
751 Ga0207679_10484693
752 Ga0207667_10115848
753 Ga0207667_10268630
754 Ga0207667_10657257
755 Ga0207651_10001608
756 Ga0207651_10003954
757 Ga0207651_10052834
758 Ga0207668_10093881
759 Ga0207640_10036768
760 Ga0207640_10081574
761 Ga0207640_10170811
762 Ga0207640_10322806
763 Ga0207658_10188205
764 Ga0207658_10357939
765 Ga0207677_10056587
766 Ga0207678_10007141
767 Ga0207678_10271552
768 Ga0207702_10001565
769 Ga0207641_10031836
770 Ga0207648_10055368
771 Ga0207648_10163179
772 Ga0207676_10203374
773 Ga0207676_10664799
774 Ga0207676_11140447
775 Ga0207674_10005653
776 Ga0207675_100017046
777 Ga0207683_10008540
778 Ga0207683_10148137
779 Ga0207683_10148712
780 Ga0207683_10351859
781 Ga0207683_10730044
782 Ga0207698_10009501
783 Ga0207698_10139071
784 Ga0207698_10223658
785 Ga0207698_10489973
786 Ga0209371_1000004
787 Ga0209967_1005782
788 Ga0268266_10053077
789 Ga0268266_10245124
790 Ga0265336_10000036
791 Ga0307515_10284701
792 Ga0265324_10000136
793 Ga0268256_1000005
794 Ga0316178_1026255
795 Ga0307513_10004594
796 Ga0307509_10269348
797 Ga0307408_100000285
798 Ga0307408_100161518
799 Ga0307516_10004973
800 Ga0307516_10098842
801 Ga0307516_10245800
802 Ga0307405_10006874
803 Ga0307405_10582323
804 Ga0307413_10024068
805 Ga0307413_10303594
806 Ga0307413_10601742
807 Ga0307410_10008211
808 Ga0307410_10084632
809 Ga0307410_10981729
810 Ga0307406_10010424
811 Ga0307406_10178436
812 Ga0307406_10296338
813 Ga0307407_10014479
814 Ga0307412_10015454
815 Ga0307409_100389882
816 Ga0307416_101544504
817 Ga0307414_10025210
818 Ga0307414_10028093
819 Ga0307414_10180054
820 Ga0307414_10251311
821 Ga0307414_10319760
822 Ga0307414_10471618
823 Ga0307411_10072174
824 Ga0307411_10166611
825 Ga0307411_10312369
826 Ga0307411_10836375
827 Ga0395899_0029496
828 Ga0395899_0044080
829 Ga0395899_0080757
830 Ga0395899_0391759
831 Ga0395900_0000514
832 Ga0395900_0009652
833 Ga0395900_0031777
834 Ga0395900_0253697
835 Ga0395900_1022949
836 Ga0395898_0003251
837 Ga0395898_0037937
838 Ga0395898_0044157
839 Ga0395898_0089583
840 Ga0395898_0109177
841 Ga0395898_0266648
842 Ga0395898_0763933
843 Ga0395905_0003749
844 Ga0395905_0011773
845 Ga0395905_0027570
846 Ga0395905_0089996
847 Ga0395905_0251417
848 Ga0395905_0304238
849 Ga0395905_0427598
850 Ga0395901_0003179
851 Ga0395901_0027639
852 Ga0395901_0092749
853 Ga0395901_0235087
854 Ga0395901_0332386
855 Ga0395901_0829596
856 Ga0237819_00925
857 Ga0237819_02667
858 Ga0237819_09016
859 Ga0400490_47037
860 Ga0400490_50483
861 Ga0400490_57681
862 Ga0400485_15170
863 Ga0400486_10179
864 Ga0400483_071977
865 Ga0400483_115881
866 Ga0400483_162261
867 Ga0400489_82739
868 Ga0400487_12706
869 Ga0436361_0535775
870 Ga0436361_0711422
871 Ga0439436_0008829
872 Ga0451791_1149829
873 Ga0451800_0331456
874 Ga0451804_0568692
875 Ga0451804_1103520
876 Ga0451807_1453451
877 Ga0439431_0084113
878 Ga0439445_0082974
879 Ga0439448_0091019
880 Ga0439432_019793
881 Ga0439449_0029459
882 Ga0439455_0224406
883 Ga0439457_085945
884 Ga0439464_0083430
885 Ga0466965_0025409
886 Ga0466966_0007854
887 Ga0466961_0027475
888 Ga0466964_0001613
889 Ga0466971_0013051
890 Ga0466970_0066207
891 Ga0466957_0038830
892 Ga0466959_0082526
893 Ga0466958_0009465
894 Ga0466967_0530738
895 Ga0466967_1434905
896 Ga0495627_012048
897 Ga0495638_0041441
898 Ga0495650_0079565
899 Ga0495583_0000129
900 Ga0495606_0006415
901 Ga0495631_0243945
902 Ga0495648_0326766
903 Ga0495663_0000203
904 Ga0495663_0055232
905 Ga0495598_0018402
906 Ga0495656_0154615
907 Ga0495668_0104153
908 Ga0495625_0141994
909 Ga0495658_0398965
910 Ga0495669_0072416
911 Ga0495671_0041080
912 Ga0495649_0062115
913 Ga0495589_0054971
914 Ga0495660_0071012
915 Ga0495686_0010557
916 Ga0496100_0745507
917 Ga0496101_0116958
918 Ga0496104_0058299
919 Ga0496104_0582161
920 Ga0496105_0016600
921 Ga0496108_0220908
922 Ga0496108_0465830
923 Ga0496109_0129592
924 Ga0496109_0192189
925 Ga0496109_0444797
926 Ga0496110_0411391
927 Ga0496112_0307470
928 Ga0496113_0524733
929 Ga0496116_0054246
930 Ga0496117_0002078
931 Ga0496117_0044096
932 Ga0496117_0192398
933 Ga0496118_0000573
934 Ga0496118_0004832
935 Ga0496119_0000211
936 Ga0496120_0000525
937 Ga0496121_0061039
938 Ga0496123_0090758
939 Ga0496123_0141228
940 Ga0496124_0013804
941 Ga0496124_0015296
942 Ga0496124_0067474
943 Ga0496125_0019580
944 Ga0496126_0000806
945 Ga0496126_0284813
946 Ga0501308_024695
947 Ga0501317_021928
948 Ga0501031_0235215
949 Ga0501033_0056953
950 Ga0501034_0000571
951 Ga0501034_0002251
952 Ga0501034_0019916
953 Ga0501036_0177777
954 Ga0501036_0584053
955 Ga0501038_0154319
956 Ga0501043_0059593
957 Ga0501070_0274589
958 Ga0501072_0037721
959 Ga0501074_0160895
960 Ga0501234_077806
961 Ga0501035_0027305
962 Ga0501044_0003946
963 Ga0501044_0607071
964 nmdc:mga0k408_46389_c1
965 nmdc:mga0k408_501186_c1
966 nmdc:mga07m45_522_c1
967 Ga0500635_0146038
968 Ga0500641_0003573
969 Ga0500608_142448
970 Ga0500658_0124536
971 Ga0500634_0000070
972 Ga0587083_0006361
973 Ga0466962_0039339
974 2547500886
975 2578458920
976 2643977744
977 2644212370
978 2747948746
979 2765578446
980 2816516463
981 2852651271
982 2874221069
983 2881715870
984 2919088763
985 2919091279
986 2919136381
987 2919690182
988 2928497911
989 2931381285
990 2937611891
991 2939590570
992 2939615262
993 2939629623
994 2941477784
995 2961047834
996 2961067173
997 2974309383
998 2977250103
999 2984515407
1000 2995950569
1001 8021624312
1002 8021628217
1003 8021651474
1004 8054358700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

38

78

0.87

PF00355

Rieske

Rieske [2Fe-2S] domain

133

219

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.966 54 201
7yra-assembly1.cif.gz_B crystal structure of [2fe-2s]-ttpeta 0.9467 54 201
8smr-assembly1.cif.gz_C cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8907 34 201
2nve-assembly1.cif.gz_A soluble domain of rieske iron sulfur protein 0.8421 52 199
2nvf-assembly1.cif.gz_A soluble domain of rieske iron-sulfur protein. 0.8381 52 199
ID Description Score Start End Superfamily
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8305 50 199 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8077 48 199 2.102.10.10
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8077 49 199 2.102.10.10
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8035 50 199 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7962 48 199 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A3D2AHY0-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 0.9826 130 186 GO:0046872
GO:0051537
AF-F0C2Y6-F1-model_v4 deleted 0.9799 54 206
AF-A0A4R5JFZ0-F1-model_v4 deleted 0.9799 92 179
AF-A0A4R5JFZ0-F1-model_v4 deleted 0.9691 92 179
AF-A0A0B5K5E6-F1-model_v4 deleted 0.9654 54 205

Map