F455726

General Info

Members Datasets Scaffolds Average Seq Length
501 286 1002 320

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0036393|Ga0453684_0036393_2220_3359
Length 379
Sequence MVMEVGMECGAKIYVAGHQGLVGSAIVRQLTSQGYANIVTRTVAELDLRRQEPVEAFFAKEQPEYVFLAAARVGGILANNTYKADFIYDNLMIATNVIHASYRYGVKKLINLGSSCIYPKNASQPLKEEYLLSGPLEATNEPYAIAKIAAIKLCRYYNEQYGTNFISVMPTNLYGPGDNFNLETAHVLPALMRKFHLAKLCAAGDWDSVYADLKNFPVGYGLGAALVNHDQKQLQEILALRGVTATDVRVWGSGKPLREFLYVDDLARALLFLMNYQQRTAIGECINIGVGQDLSIQDLAAMIKQAVRFDGEIIFDPTKPDGTVQKLLDVTRINTLGWQASVPLPRGVEYLYQWYLHARCDTPMPTVKKGMREGSSRSV

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
187 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
245 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
251 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
263 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
264 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
265 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
266 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
267 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
268 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
269 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
270 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
271 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
272 2773857925 Microvirga vignae BR3299 Isolate Unclassified
273 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
274 2818991459 Paenibacillus sp. 597 Isolate Unclassified
275 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
276 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
277 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
278 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
279 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
280 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
281 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
282 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
283 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
284 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
285 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
286 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.01
Metatranscriptomes 1.4
Isolates 4.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 3.39
Nodule 0.4
Rhizoplane 2.79
Rhizosphere 83.63
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0036393 3300044712 Bacteria 6785
2 JGI24744J21845_10001516 3300002077 Bacteria 4620
3 Ga0055539_1000590 3300003752 Bacteria 10125
4 Ga0055533_1000293 3300003756 Bacteria 25431
5 Ga0055531_10000193 3300003794 Bacteria 67836
6 Ga0070658_10047940 3300005327 Bacteria 3458
7 Ga0070676_10000024 3300005328 Bacteria 46771
8 Ga0070683_100009195 3300005329 Bacteria 8438
9 Ga0070683_100017759 3300005329 Bacteria 6286
10 Ga0070683_100101520 3300005329 Bacteria 2709
11 Ga0070683_100202260 3300005329 Bacteria 1886
12 Ga0070670_100200551 3300005331 Bacteria 1734
13 Ga0070677_10116103 3300005333 Bacteria 1202
14 Ga0068869_100017134 3300005334 Bacteria 4904
15 Ga0070666_10046765 3300005335 Bacteria 2904
16 Ga0070682_100005387 3300005337 Bacteria 7122
17 Ga0070682_100366126 3300005337 Bacteria 1079
18 Ga0068868_100018195 3300005338 Bacteria 5249
19 Ga0068868_100020594 3300005338 Bacteria 4959
20 Ga0068868_100021174 3300005338 Bacteria 4896
21 Ga0068868_100034783 3300005338 Bacteria 3891
22 Ga0068868_100038432 3300005338 Bacteria 3715
23 Ga0070660_100060685 3300005339 Bacteria 2935
24 Ga0070660_100369396 3300005339 Bacteria 1183
25 Ga0070661_100039164 3300005344 Bacteria 3453
26 Ga0070675_100264277 3300005354 Bacteria 1509
27 Ga0070671_100000102 3300005355 Bacteria 54494
28 Ga0070671_100095868 3300005355 Bacteria 2487
29 Ga0070671_100109922 3300005355 Bacteria 2315
30 Ga0070673_100287769 3300005364 Bacteria 1443
31 Ga0070688_100019111 3300005365 Bacteria 3967
32 Ga0070667_100000545 3300005367 Bacteria 37543
33 Ga0070709_10094425 3300005434 Bacteria 1979
34 Ga0070709_10212306 3300005434 Bacteria 1376
35 Ga0070714_100000832 3300005435 Bacteria 21845
36 Ga0070713_100000255 3300005436 Bacteria 35004
37 Ga0070700_100247484 3300005441 Bacteria 1277
38 Ga0070678_100003306 3300005456 Bacteria 8965
39 Ga0070678_100433573 3300005456 Bacteria 1148
40 Ga0070681_10020602 3300005458 Bacteria 6608
41 Ga0070681_10062363 3300005458 Bacteria 3701
42 Ga0070681_10095094 3300005458 Bacteria 2928
43 Ga0070681_10102270 3300005458 Bacteria 2811
44 Ga0068867_100000162 3300005459 Bacteria 43536
45 Ga0068867_100019996 3300005459 Bacteria 4771
46 Ga0070698_100147087 3300005471 Bacteria 2305
47 Ga0070699_100000020 3300005518 Bacteria 182025
48 Ga0070679_100011593 3300005530 Bacteria 8400
49 Ga0070679_100036838 3300005530 Bacteria 4855
50 Ga0070684_100068908 3300005535 Bacteria 3110
51 Ga0070684_100086187 3300005535 Bacteria 2787
52 Ga0068853_100001778 3300005539 Bacteria 15842
53 Ga0068853_100037125 3300005539 Bacteria 4144
54 Ga0070686_100166340 3300005544 Bacteria 1556
55 Ga0070686_100331117 3300005544 Bacteria 1138
56 Ga0070665_100038251 3300005548 Bacteria 4823
57 Ga0070665_100039132 3300005548 Bacteria 4769
58 Ga0068855_100032051 3300005563 Bacteria 6275
59 Ga0068855_100037986 3300005563 Bacteria 5724
60 Ga0068855_100085924 3300005563 Bacteria 3639
61 Ga0068855_100272823 3300005563 Bacteria 1880
62 Ga0070664_100250781 3300005564 Bacteria 1591
63 Ga0068857_100000894 3300005577 Bacteria 22550
64 Ga0068857_100014877 3300005577 Bacteria 6785
65 Ga0068857_100016041 3300005577 Bacteria 6563
66 Ga0068857_100042433 3300005577 Bacteria 4036
67 Ga0068856_100009762 3300005614 Bacteria 9327
68 Ga0068856_100106255 3300005614 Bacteria 2801
69 Ga0068856_100160135 3300005614 Bacteria 2261
70 Ga0068856_100272329 3300005614 Bacteria 1709
71 Ga0068852_100000340 3300005616 Bacteria 31671
72 Ga0068852_100185040 3300005616 Bacteria 1961
73 Ga0068852_100310906 3300005616 Bacteria 1528
74 Ga0068859_100003030 3300005617 Bacteria 17032
75 Ga0068859_100007889 3300005617 Bacteria 10800
76 Ga0068864_100076024 3300005618 Bacteria 2933
77 Ga0068864_100108055 3300005618 Bacteria 2475
78 Ga0068864_100265992 3300005618 Bacteria 1596
79 Ga0068866_10094377 3300005718 Bacteria 1637
80 Ga0068861_100026883 3300005719 Bacteria 4187
81 Ga0068863_100001313 3300005841 Bacteria 24793
82 Ga0068863_100084141 3300005841 Bacteria 3015
83 Ga0068863_100281849 3300005841 Bacteria 1610
84 Ga0068858_100000601 3300005842 Bacteria 37610
85 Ga0068858_100001102 3300005842 Bacteria 27941
86 Ga0068858_100003823 3300005842 Bacteria 14888
87 Ga0068858_100078718 3300005842 Bacteria 3063
88 Ga0068858_100182812 3300005842 Bacteria 1980
89 Ga0068860_100001877 3300005843 Bacteria 22327
90 Ga0068860_100003861 3300005843 Bacteria 15397
91 Ga0068860_100004970 3300005843 Bacteria 13551
92 Ga0068860_100024890 3300005843 Bacteria 5779
93 Ga0081455_10000020 3300005937 Bacteria 172997
94 Ga0081539_10017941 3300005985 Bacteria 4938
95 Ga0070717_10073482 3300006028 Bacteria 2858
96 Ga0070716_100154373 3300006173 Bacteria 1480
97 Ga0070716_100281244 3300006173 Bacteria 1148
98 Ga0075366_10084058 3300006195 Bacteria 1903
99 Ga0097621_100000057 3300006237 Bacteria 58430
100 Ga0097621_100007122 3300006237 Bacteria 7973
101 Ga0097621_100008329 3300006237 Bacteria 7462
102 Ga0097621_100037115 3300006237 Bacteria 3901
103 Ga0097621_100038448 3300006237 Bacteria 3840
104 Ga0068871_100000094 3300006358 Bacteria 52461
105 Ga0068871_100021961 3300006358 Bacteria 4915
106 Ga0068871_100023917 3300006358 Bacteria 4733
107 Ga0068871_100168932 3300006358 Bacteria 1874
108 Ga0075428_100142092 3300006844 Bacteria 2610
109 Ga0075430_100236975 3300006846 Bacteria 1512
110 Ga0075433_10144057 3300006852 Bacteria 2118
111 Ga0068865_100000849 3300006881 Bacteria 17300
112 Ga0097620_100003030 3300006931 Bacteria 17032
113 Ga0097620_100007890 3300006931 Bacteria 10800
114 Ga0079104_1000031 3300006946 Bacteria 204963
115 Ga0105250_10035113 3300009092 Bacteria 2011
116 Ga0105240_10004522 3300009093 Bacteria 21131
117 Ga0105240_10065839 3300009093 Bacteria 4497
118 Ga0105240_10104295 3300009093 Bacteria 3443
119 Ga0105240_10195919 3300009093 Bacteria 2372
120 Ga0111539_10083841 3300009094 Bacteria 3748
121 Ga0111539_10119236 3300009094 Unclassified 3092
122 Ga0111539_10401436 3300009094 Bacteria 1596
123 Ga0105245_10093946 3300009098 Bacteria 2764
124 Ga0105247_10000126 3300009101 Bacteria 74123
125 Ga0105247_10002078 3300009101 Bacteria 13856
126 Ga0105247_10119326 3300009101 Bacteria 1707
127 Ga0105243_10149056 3300009148 Bacteria 2005
128 Ga0105241_10021011 3300009174 Bacteria 4826
129 Ga0105242_10004035 3300009176 Bacteria 11411
130 Ga0105242_10009627 3300009176 Bacteria 7406
131 Ga0105242_10050082 3300009176 Bacteria 3400
132 Ga0105242_10088551 3300009176 Bacteria 2601
133 Ga0105248_10007293 3300009177 Bacteria 12131
134 Ga0105248_10040446 3300009177 Bacteria 5226
135 Ga0105248_10133445 3300009177 Bacteria 2801
136 Ga0105248_10221938 3300009177 Bacteria 2128
137 Ga0105237_10001650 3300009545 Bacteria 28964
138 Ga0105237_10009954 3300009545 Bacteria 10143
139 Ga0105237_10038725 3300009545 Bacteria 4814
140 Ga0105237_10062422 3300009545 Bacteria 3725
141 Ga0105237_10159573 3300009545 Bacteria 2253
142 Ga0105238_10010280 3300009551 Bacteria 9386
143 Ga0105238_10012386 3300009551 Bacteria 8600
144 Ga0105238_10015562 3300009551 Bacteria 7702
145 Ga0105238_10054681 3300009551 Bacteria 4008
146 Ga0105238_10499066 3300009551 Bacteria 1217
147 Ga0105239_10002824 3300010375 Bacteria 21720
148 Ga0105239_10201856 3300010375 Bacteria 2228
149 Ga0105239_10454496 3300010375 Bacteria 1453
150 Ga0105239_10858242 3300010375 Bacteria 1041
151 Ga0105246_10146554 3300011119 Unclassified 1782
152 Ga0105246_10173737 3300011119 Bacteria 1652
153 Ga0105246_10246382 3300011119 Bacteria 1416
154 Ga0157373_10000161 3300013100 Bacteria 54194
155 Ga0157371_10128320 3300013102 Bacteria 1804
156 Ga0157371_10150995 3300013102 Bacteria 1657
157 Ga0157370_10225535 3300013104 Bacteria 1735
158 Ga0157369_10014438 3300013105 Bacteria 8917
159 Ga0157369_10247388 3300013105 Bacteria 1862
160 Ga0157374_10006005 3300013296 Bacteria 10278
161 Ga0157374_10010479 3300013296 Bacteria 7973
162 Ga0157374_10038851 3300013296 Bacteria 4377
163 Ga0157374_10056590 3300013296 Bacteria 3662
164 Ga0157374_10064873 3300013296 Bacteria 3428
165 Ga0157374_10268345 3300013296 Bacteria 1682
166 Ga0157374_10653196 3300013296 Bacteria 1064
167 Ga0157378_10008635 3300013297 Bacteria 8866
168 Ga0157378_10021778 3300013297 Bacteria 5636
169 Ga0157378_10023941 3300013297 Bacteria 5370
170 Ga0157378_10046428 3300013297 Bacteria 3861
171 Ga0157378_10080150 3300013297 Bacteria 2949
172 Ga0163162_10053670 3300013306 Unclassified 4052
173 Ga0163162_10088681 3300013306 Bacteria 3173
174 Ga0163162_10089997 3300013306 Bacteria 3150
175 Ga0163162_10142039 3300013306 Bacteria 2515
176 Ga0163162_10143601 3300013306 Bacteria 2501
177 Ga0163162_10812134 3300013306 Bacteria 1052
178 Ga0157372_10005914 3300013307 Bacteria 13028
179 Ga0157372_10024900 3300013307 Bacteria 6504
180 Ga0157372_10069459 3300013307 Bacteria 3962
181 Ga0157372_10112690 3300013307 Bacteria 3117
182 Ga0157372_10221744 3300013307 Bacteria 2192
183 Ga0157372_10283183 3300013307 Bacteria 1927
184 Ga0157375_10304506 3300013308 Bacteria 1757
185 Ga0157375_10366144 3300013308 Bacteria 1608
186 Ga0163163_10001074 3300014325 Bacteria 23194
187 Ga0163163_10011324 3300014325 Bacteria 8085
188 Ga0163163_10079537 3300014325 Bacteria 3276
189 Ga0157380_10104756 3300014326 Bacteria 2363
190 Ga0182008_10005609 3300014497 Bacteria 7116
191 Ga0157379_10000997 3300014968 Bacteria 22973
192 Ga0157376_10009971 3300014969 Bacteria 6932
193 Ga0157376_10017914 3300014969 Bacteria 5415
194 Ga0157376_10051705 3300014969 Bacteria 3413
195 Ga0157376_10117100 3300014969 Bacteria 2355
196 Ga0157376_10261810 3300014969 Bacteria 1621
197 Ga0157376_10281027 3300014969 Bacteria 1568
198 Ga0182007_10002337 3300015262 Bacteria 9494
199 Ga0206356_11147555 3300020070 Bacteria 1161
200 Ga0213872_10001114 3300021361 Bacteria 18378
201 Ga0213872_10015271 3300021361 Bacteria 3574
202 Ga0213872_10019321 3300021361 Bacteria 3139
203 Ga0209674_100354 3300025226 Bacteria 26166
204 Ga0209677_100379 3300025253 Bacteria 27214
205 Ga0209455_1000095 3300025272 Bacteria 217487
206 Ga0209256_1001226 3300025299 Bacteria 28557
207 Ga0209257_1000233 3300025304 Bacteria 129948
208 Ga0207710_10000357 3300025900 Bacteria 32396
209 Ga0207710_10001422 3300025900 Bacteria 11969
210 Ga0207680_10027153 3300025903 Bacteria 3183
211 Ga0207647_10011657 3300025904 Bacteria 6155
212 Ga0207647_10044413 3300025904 Bacteria 2777
213 Ga0207699_10039584 3300025906 Bacteria 2710
214 Ga0207645_10000226 3300025907 Bacteria 46795
215 Ga0207705_10011828 3300025909 Bacteria 6305
216 Ga0207707_10102963 3300025912 Bacteria 2496
217 Ga0207695_10048333 3300025913 Bacteria 4494
218 Ga0207695_10206160 3300025913 Bacteria 1879
219 Ga0207671_10006362 3300025914 Bacteria 10531
220 Ga0207671_10095449 3300025914 Bacteria 2245
221 Ga0207671_10263436 3300025914 Bacteria 1357
222 Ga0207660_10376630 3300025917 Bacteria 1140
223 Ga0207657_10002531 3300025919 Bacteria 19778
224 Ga0207657_10130320 3300025919 Bacteria 2061
225 Ga0207649_10049901 3300025920 Bacteria 2587
226 Ga0207694_10009014 3300025924 Bacteria 7534
227 Ga0207694_10062263 3300025924 Bacteria 2905
228 Ga0207700_10008851 3300025928 Bacteria 6258
229 Ga0207664_10257111 3300025929 Bacteria 1526
230 Ga0207644_10079907 3300025931 Bacteria 2414
231 Ga0207644_10145766 3300025931 Bacteria 1828
232 Ga0207686_10011494 3300025934 Bacteria 4850
233 Ga0207686_10014314 3300025934 Bacteria 4412
234 Ga0207686_10025735 3300025934 Bacteria 3427
235 Ga0207709_10121424 3300025935 Bacteria 1764
236 Ga0207704_10000052 3300025938 Bacteria 80866
237 Ga0207704_10082629 3300025938 Bacteria 2082
238 Ga0207711_10010945 3300025941 Bacteria 7539
239 Ga0207711_10198444 3300025941 Bacteria 1830
240 Ga0207689_10002938 3300025942 Bacteria 15742
241 Ga0207661_10017757 3300025944 Bacteria 5272
242 Ga0207661_10021050 3300025944 Bacteria 4884
243 Ga0207661_10145808 3300025944 Bacteria 2042
244 Ga0207667_10009604 3300025949 Bacteria 11382
245 Ga0207667_10066300 3300025949 Bacteria 3764
246 Ga0207667_10215444 3300025949 Bacteria 1968
247 Ga0207651_10036989 3300025960 Bacteria 3193
248 Ga0207640_10140186 3300025981 Bacteria 1761
249 Ga0207658_10010009 3300025986 Bacteria 6442
250 Ga0207658_10021437 3300025986 Bacteria 4486
251 Ga0207677_10014413 3300026023 Bacteria 4616
252 Ga0207677_10145308 3300026023 Bacteria 1822
253 Ga0207703_10000299 3300026035 Bacteria 54610
254 Ga0207703_10003957 3300026035 Bacteria 12279
255 Ga0207703_10004527 3300026035 Bacteria 11402
256 Ga0207703_10013696 3300026035 Bacteria 6320
257 Ga0207703_10157736 3300026035 Bacteria 1985
258 Ga0207639_10003102 3300026041 Bacteria 11170
259 Ga0207639_10109648 3300026041 Bacteria 2246
260 Ga0207678_10004796 3300026067 Bacteria 12142
261 Ga0207708_10164555 3300026075 Bacteria 1753
262 Ga0207702_10067246 3300026078 Bacteria 3075
263 Ga0207702_10238087 3300026078 Bacteria 1704
264 Ga0207641_10004591 3300026088 Bacteria 11929
265 Ga0207641_10165907 3300026088 Bacteria 2011
266 Ga0207641_10369319 3300026088 Bacteria 1372
267 Ga0207648_10001156 3300026089 Bacteria 29559
268 Ga0207648_10030342 3300026089 Bacteria 4789
269 Ga0207676_10059412 3300026095 Bacteria 3019
270 Ga0207674_10001333 3300026116 Bacteria 32023
271 Ga0207674_10008701 3300026116 Bacteria 11684
272 Ga0207674_10052890 3300026116 Bacteria 4140
273 Ga0207674_10081561 3300026116 Bacteria 3236
274 Ga0207675_100042142 3300026118 Bacteria 4261
275 Ga0207698_10001154 3300026142 Bacteria 15390
276 Ga0209281_1000062 3300027111 Bacteria 289797
277 Ga0268266_10038431 3300028379 Bacteria 4075
278 Ga0268266_10054246 3300028379 Bacteria 3444
279 Ga0268266_10191591 3300028379 Bacteria 1867
280 Ga0268264_10002701 3300028381 Bacteria 15478
281 Ga0268264_10004835 3300028381 Bacteria 11415
282 Ga0268264_10006054 3300028381 Bacteria 10217
283 Ga0268264_10009883 3300028381 Bacteria 7898
284 Ga0268264_10050805 3300028381 Bacteria 3453
285 Ga0265337_1000904 3300028556 Bacteria 15610
286 Ga0265337_1040204 3300028556 Bacteria 1349
287 Ga0265319_1001832 3300028563 Bacteria 12116
288 Ga0265318_10000524 3300028577 Bacteria 27594
289 Ga0265318_10000724 3300028577 Bacteria 22147
290 Ga0265318_10018381 3300028577 Bacteria 2853
291 Ga0265322_10000083 3300028654 Bacteria 44679
292 Ga0265336_10024576 3300028666 Bacteria 1902
293 Ga0307515_10010334 3300028794 Eukaryota 17894
294 Ga0265338_10000339 3300028800 Bacteria 85119
295 Ga0265338_10015135 3300028800 Bacteria 8508
296 Ga0265338_10233033 3300028800 Bacteria 1368
297 Ga0265324_10002597 3300029957 Bacteria 9074
298 Ga0307511_10086179 3300030521 Eukaryota 2165
299 Ga0307512_10045922 3300030522 Eukaryota 3568
300 Ga0265332_10031642 3300031238 Bacteria 2307
301 Ga0265328_10010302 3300031239 Bacteria 3767
302 Ga0265320_10000278 3300031240 Bacteria 41319
303 Ga0265320_10001566 3300031240 Bacteria 16451
304 Ga0265320_10016398 3300031240 Bacteria 4153
305 Ga0265320_10041268 3300031240 Bacteria 2295
306 Ga0265325_10002576 3300031241 Bacteria 12164
307 Ga0265325_10021360 3300031241 Bacteria 3557
308 Ga0265340_10008014 3300031247 Bacteria 5724
309 Ga0265339_10085295 3300031249 Bacteria 1663
310 Ga0265331_10079183 3300031250 Bacteria 1529
311 Ga0265331_10091143 3300031250 Bacteria 1409
312 Ga0265327_10001772 3300031251 Bacteria 25464
313 Ga0265327_10002174 3300031251 Bacteria 21563
314 Ga0265316_10033900 3300031344 Bacteria 4153
315 Ga0265316_10040063 3300031344 Bacteria 3758
316 Ga0307513_10423565 3300031456 Eukaryota 1060
317 Ga0307408_100044754 3300031548 Bacteria 3156
318 Ga0265313_10003814 3300031595 Bacteria 11912
319 Ga0307508_10022930 3300031616 Eukaryota 5673
320 Ga0307514_10121503 3300031649 Eukaryota 1820
321 Ga0265314_10014742 3300031711 Bacteria 6235
322 Ga0265314_10079661 3300031711 Bacteria 2165
323 Ga0265342_10008168 3300031712 Bacteria 7548
324 Ga0307405_10015533 3300031731 Bacteria 4128
325 Ga0307413_10006363 3300031824 Bacteria 5382
326 Ga0307410_10015775 3300031852 Bacteria 4489
327 Ga0307407_10005822 3300031903 Bacteria 5398
328 Ga0307412_10060446 3300031911 Bacteria 2543
329 Ga0307412_10078173 3300031911 Bacteria 2278
330 Ga0307409_100006104 3300031995 Bacteria 7042
331 Ga0307416_100040716 3300032002 Bacteria 3612
332 Ga0307414_10031041 3300032004 Bacteria 3499
333 Ga0307411_10056545 3300032005 Bacteria 2586
334 Ga0307415_100262366 3300032126 Bacteria 1410
335 Ga0316593_10019903 3300032168 Bacteria 2079
336 Ga0307507_10141938 3300033179 Eukaryota 1838
337 Ga0307510_10020981 3300033180 Eukaryota 7621
338 Ga0307510_10146278 3300033180 Bacteria 1994
339 Ga0373928_0000397 3300035084 Bacteria 8677
340 Ga0373935_0029039 3300035692 Bacteria 3421
341 Ga0373947_0090225 3300035725 Bacteria 1910
342 Ga0373947_0270939 3300035725 Bacteria 1127
343 Ga0373937_0009594 3300036401 Bacteria 8427
344 Ga0395899_0000025 3300037312 Bacteria 350927
345 Ga0395900_0048894 3300037418 Bacteria 4356
346 Ga0395900_0057620 3300037418 Bacteria 4000
347 Ga0395900_0115531 3300037418 Bacteria 2754
348 Ga0395905_0000994 3300037471 Bacteria 36295
349 Ga0436364_0228312 3300037853 Bacteria 4904
350 Ga0436364_0889772 3300037853 Bacteria 1241
351 Ga0436364_1316340 3300037853 Bacteria 2756
352 Ga0400484_03169 3300038725 Bacteria 18939
353 Ga0400490_05124 3300038726 Bacteria 27034
354 Ga0400491_05118 3300038727 Unclassified 4683
355 Ga0400483_071122 3300039062 Bacteria 3202
356 Ga0400483_154000 3300039062 Bacteria 1129
357 Ga0436365_1125905 3300039437 Bacteria 2504
358 Ga0436360_0960022 3300039438 Bacteria 3621
359 Ga0436361_0314526 3300039447 Bacteria 29245
360 Ga0436361_0420617 3300039447 Bacteria 5398
361 Ga0436361_0561836 3300039447 Bacteria 2608
362 Ga0436363_1575714 3300039450 Bacteria 1981
363 Ga0436362_0261628 3300039453 Bacteria 2030
364 Ga0451795_1246844 3300041456 Bacteria 2033
365 Ga0451795_1276180 3300041456 Bacteria 2313
366 Ga0451855_0122681 3300041511 Bacteria 2150
367 Ga0451855_1894416 3300041511 Bacteria 6304
368 Ga0451577_0000164 3300042876 Bacteria 145507
369 Ga0451577_0001096 3300042876 Bacteria 38706
370 Ga0451577_0035194 3300042876 Bacteria 4512
371 Ga0451577_0133165 3300042876 Bacteria 2231
372 Ga0451577_0332051 3300042876 Bacteria 1379
373 Ga0451577_0446689 3300042876 Bacteria 1174
374 Ga0466969_0120084 3300044656 Bacteria 1224
375 Ga0453683_0000302 3300044673 Bacteria 62266
376 Ga0453683_0000676 3300044673 Bacteria 36239
377 Ga0453683_0006620 3300044673 Bacteria 7937
378 Ga0466966_0000369 3300044684 Bacteria 29348
379 Ga0466961_0127164 3300044693 Unclassified 1598
380 Ga0453684_0000236 3300044712 Bacteria 238892
381 Ga0453684_0000710 3300044712 Bacteria 117944
382 Ga0453684_0000978 3300044712 Bacteria 93610
383 Ga0453684_0001504 3300044712 Bacteria 65595
384 Ga0453684_0001541 3300044712 Bacteria 64371
385 Ga0453684_0002231 3300044712 Bacteria 48048
386 Ga0453684_0003799 3300044712 Bacteria 33319
387 Ga0453684_0008995 3300044712 Bacteria 17643
388 Ga0453684_0136075 3300044712 Bacteria 2942
389 Ga0453684_0386653 3300044712 Bacteria 1570
390 Ga0466957_0054066 3300044842 Bacteria 2450
391 Ga0466959_0011038 3300045049 Bacteria 6484
392 Ga0451576_0000064 3300045051 Bacteria 277677
393 Ga0451576_0000491 3300045051 Bacteria 87622
394 Ga0451576_0242042 3300045051 Bacteria 1885
395 Ga0451576_0413622 3300045051 Bacteria 1415
396 Ga0451576_0551910 3300045051 Bacteria 1210
397 Ga0495603_0089095 3300046455 Bacteria 1805
398 Ga0495590_0083168 3300046457 Unclassified 1128
399 Ga0495629_0003975 3300046459 Bacteria 11111
400 Ga0495650_0000009 3300046471 Bacteria 653845
401 Ga0495580_0292311 3300046472 Bacteria 1111
402 Ga0495582_0015200 3300046473 Bacteria 4233
403 Ga0495594_0002341 3300046499 Bacteria 9859
404 Ga0495594_0021011 3300046499 Bacteria 3482
405 Ga0495644_0000078 3300046523 Bacteria 48386
406 Ga0495642_0025638 3300046528 Bacteria 2338
407 Ga0495665_0022787 3300046531 Bacteria 3364
408 Ga0495665_0065514 3300046531 Bacteria 1918
409 Ga0495622_0132568 3300046557 Bacteria 1134
410 Ga0495633_0000021 3300046558 Bacteria 227171
411 Ga0495633_0029257 3300046558 Bacteria 2680
412 Ga0495634_0010207 3300046642 Bacteria 6887
413 Ga0495625_0081253 3300046660 Bacteria 2256
414 Ga0495659_0008137 3300046664 Bacteria 3334
415 Ga0495669_0001907 3300046684 Bacteria 8553
416 Ga0495613_0011892 3300046689 Bacteria 6468
417 Ga0495624_0167649 3300046690 Bacteria 1340
418 Ga0495581_0153502 3300047315 Bacteria 1345
419 Ga0495604_0231750 3300047317 Bacteria 1266
420 Ga0495674_0030290 3300047319 Bacteria 4921
421 Ga0495676_0001102 3300047321 Bacteria 22909
422 Ga0495680_0006151 3300047322 Bacteria 11197
423 Ga0495686_0005874 3300047472 Bacteria 9568
424 Ga0495614_0054113 3300048089 Bacteria 1721
425 Ga0496100_0161286 3300048903 Bacteria 1608
426 Ga0496100_0225193 3300048903 Bacteria 1378
427 Ga0496102_0009318 3300048905 Bacteria 8431
428 Ga0496102_0120483 3300048905 Bacteria 2450
429 Ga0496102_0327052 3300048905 Bacteria 1444
430 Ga0496104_0023567 3300048907 Bacteria 5660
431 Ga0496108_0215389 3300048911 Bacteria 1668
432 Ga0496110_0004410 3300048913 Bacteria 10900
433 Ga0496112_0011672 3300048915 Bacteria 8037
434 Ga0496112_0533357 3300048915 Bacteria 1108
435 Ga0496113_0004902 3300048916 Bacteria 8288
436 Ga0496115_0233422 3300048918 Bacteria 1516
437 Ga0496119_0006609 3300048922 Bacteria 10679
438 Ga0496119_0134751 3300048922 Bacteria 1341
439 Ga0496120_0025497 3300048923 Bacteria 3668
440 Ga0496120_0189775 3300048923 Bacteria 1003
441 Ga0496121_0001023 3300048924 Bacteria 49854
442 Ga0496121_0002657 3300048924 Bacteria 26807
443 Ga0496121_0034717 3300048924 Bacteria 4535
444 Ga0496121_0077826 3300048924 Bacteria 2639
445 Ga0496123_0022221 3300048926 Bacteria 4897
446 Ga0496125_0001270 3300048928 Bacteria 37575
447 Ga0496125_0003836 3300048928 Bacteria 17841
448 Ga0496125_0008794 3300048928 Bacteria 10500
449 Ga0496125_0011053 3300048928 Bacteria 9060
450 Ga0496125_0046709 3300048928 Bacteria 3629
451 Ga0496126_0000101 3300048929 Bacteria 201606
452 Ga0496126_0025078 3300048929 Bacteria 5746
453 Ga0496126_0285619 3300048929 Bacteria 1366
454 Ga0501306_000276 3300049127 Bacteria 3635
455 Ga0501305_000644 3300049161 Bacteria 2981
456 Ga0501291_014983 3300049514 Bacteria 1167
457 Ga0501312_000328 3300049528 Bacteria 3599
458 Ga0501312_008527 3300049528 Bacteria 1333
459 Ga0501316_000636 3300049532 Bacteria 2565
460 Ga0501034_0065473 3300049571 Bacteria 3647
461 Ga0501208_015603 3300049655 Bacteria 1169
462 Ga0501217_000829 3300049661 Bacteria 5430
463 Ga0501217_003299 3300049661 Bacteria 3252
464 Ga0501223_016088 3300049663 Bacteria 1479
465 Ga0501257_040472 3300049686 Bacteria 1144
466 Ga0501221_000886 3300049704 Bacteria 4899
467 Ga0501245_000277 3300049708 Bacteria 5962
468 Ga0501079_0280034 3300049741 Bacteria 1304
469 nmdc:mga0k408_102117_c1 3300050493 Bacteria 1691
470 nmdc:mga0k408_410_c1 3300050493 Bacteria 23446
471 nmdc:mga0qj67_157522_c1 3300050509 Bacteria 1843
472 nmdc:mga08y16_540643_c1 3300050511 Unclassified 1180
473 Ga0500650_0006158 3300053098 Bacteria 4550
474 Ga0500618_000367 3300053125 Bacteria 31361
475 Ga0500590_054034 3300053148 Bacteria 2034
476 Ga0500616_0000074 3300053153 Bacteria 222910
477 Ga0500637_0017052 3300053178 Bacteria 3883
478 Ga0500661_001094 3300055283 Bacteria 5101
479 2563927985 2563366752 Bacteria 4961801
480 2566037093 2565956521 Bacteria 4468993
481 2574433202 2574179768 Bacteria 4907129
482 2587743051 2585428059 Bacteria 8696589
483 2590601472 2588254255 Bacteria 5014294
484 2595090113 2593339131 Bacteria 5116855
485 2723602726 2721755693 Bacteria 6126117
486 2730138701 2728369359 Bacteria 5621728
487 2774874723 2773857925 Bacteria 6472445
488 2802438948 2802428803 Bacteria 5806948
489 2819671314 2818991459 Bacteria 8736032
490 2857607495 2857604169 Bacteria 5111450
491 2882463092 2882456835 Bacteria 6863978
492 2889050932 2889049205 Bacteria 7524325
493 2889278684 2889276214 Bacteria 5979355
494 2904598709 2904595352 Bacteria 6124848
495 2919403890 2919399522 Bacteria 5164947
496 2936363043 2936361878 Bacteria 5632809
497 2984532487 2984527788 Bacteria 5288478
498 2984533744 2984532647 Bacteria 5288506
499 2996708304 2996706504 Bacteria 5757485
500 3006990956 3006988479 Bacteria 4767936
501 648169070 648028048 Bacteria 5394884
502 Ga0453684_0036393
503 JGI24744J21845_10001516
504 Ga0055539_1000590
505 Ga0055533_1000293
506 Ga0055531_10000193
507 Ga0070658_10047940
508 Ga0070676_10000024
509 Ga0070683_100009195
510 Ga0070683_100017759
511 Ga0070683_100101520
512 Ga0070683_100202260
513 Ga0070670_100200551
514 Ga0070677_10116103
515 Ga0068869_100017134
516 Ga0070666_10046765
517 Ga0070682_100005387
518 Ga0070682_100366126
519 Ga0068868_100018195
520 Ga0068868_100020594
521 Ga0068868_100021174
522 Ga0068868_100034783
523 Ga0068868_100038432
524 Ga0070660_100060685
525 Ga0070660_100369396
526 Ga0070661_100039164
527 Ga0070675_100264277
528 Ga0070671_100000102
529 Ga0070671_100095868
530 Ga0070671_100109922
531 Ga0070673_100287769
532 Ga0070688_100019111
533 Ga0070667_100000545
534 Ga0070709_10094425
535 Ga0070709_10212306
536 Ga0070714_100000832
537 Ga0070713_100000255
538 Ga0070700_100247484
539 Ga0070678_100003306
540 Ga0070678_100433573
541 Ga0070681_10020602
542 Ga0070681_10062363
543 Ga0070681_10095094
544 Ga0070681_10102270
545 Ga0068867_100000162
546 Ga0068867_100019996
547 Ga0070698_100147087
548 Ga0070699_100000020
549 Ga0070679_100011593
550 Ga0070679_100036838
551 Ga0070684_100068908
552 Ga0070684_100086187
553 Ga0068853_100001778
554 Ga0068853_100037125
555 Ga0070686_100166340
556 Ga0070686_100331117
557 Ga0070665_100038251
558 Ga0070665_100039132
559 Ga0068855_100032051
560 Ga0068855_100037986
561 Ga0068855_100085924
562 Ga0068855_100272823
563 Ga0070664_100250781
564 Ga0068857_100000894
565 Ga0068857_100014877
566 Ga0068857_100016041
567 Ga0068857_100042433
568 Ga0068856_100009762
569 Ga0068856_100106255
570 Ga0068856_100160135
571 Ga0068856_100272329
572 Ga0068852_100000340
573 Ga0068852_100185040
574 Ga0068852_100310906
575 Ga0068859_100003030
576 Ga0068859_100007889
577 Ga0068864_100076024
578 Ga0068864_100108055
579 Ga0068864_100265992
580 Ga0068866_10094377
581 Ga0068861_100026883
582 Ga0068863_100001313
583 Ga0068863_100084141
584 Ga0068863_100281849
585 Ga0068858_100000601
586 Ga0068858_100001102
587 Ga0068858_100003823
588 Ga0068858_100078718
589 Ga0068858_100182812
590 Ga0068860_100001877
591 Ga0068860_100003861
592 Ga0068860_100004970
593 Ga0068860_100024890
594 Ga0081455_10000020
595 Ga0081539_10017941
596 Ga0070717_10073482
597 Ga0070716_100154373
598 Ga0070716_100281244
599 Ga0075366_10084058
600 Ga0097621_100000057
601 Ga0097621_100007122
602 Ga0097621_100008329
603 Ga0097621_100037115
604 Ga0097621_100038448
605 Ga0068871_100000094
606 Ga0068871_100021961
607 Ga0068871_100023917
608 Ga0068871_100168932
609 Ga0075428_100142092
610 Ga0075430_100236975
611 Ga0075433_10144057
612 Ga0068865_100000849
613 Ga0097620_100003030
614 Ga0097620_100007890
615 Ga0079104_1000031
616 Ga0105250_10035113
617 Ga0105240_10004522
618 Ga0105240_10065839
619 Ga0105240_10104295
620 Ga0105240_10195919
621 Ga0111539_10083841
622 Ga0111539_10119236
623 Ga0111539_10401436
624 Ga0105245_10093946
625 Ga0105247_10000126
626 Ga0105247_10002078
627 Ga0105247_10119326
628 Ga0105243_10149056
629 Ga0105241_10021011
630 Ga0105242_10004035
631 Ga0105242_10009627
632 Ga0105242_10050082
633 Ga0105242_10088551
634 Ga0105248_10007293
635 Ga0105248_10040446
636 Ga0105248_10133445
637 Ga0105248_10221938
638 Ga0105237_10001650
639 Ga0105237_10009954
640 Ga0105237_10038725
641 Ga0105237_10062422
642 Ga0105237_10159573
643 Ga0105238_10010280
644 Ga0105238_10012386
645 Ga0105238_10015562
646 Ga0105238_10054681
647 Ga0105238_10499066
648 Ga0105239_10002824
649 Ga0105239_10201856
650 Ga0105239_10454496
651 Ga0105239_10858242
652 Ga0105246_10146554
653 Ga0105246_10173737
654 Ga0105246_10246382
655 Ga0157373_10000161
656 Ga0157371_10128320
657 Ga0157371_10150995
658 Ga0157370_10225535
659 Ga0157369_10014438
660 Ga0157369_10247388
661 Ga0157374_10006005
662 Ga0157374_10010479
663 Ga0157374_10038851
664 Ga0157374_10056590
665 Ga0157374_10064873
666 Ga0157374_10268345
667 Ga0157374_10653196
668 Ga0157378_10008635
669 Ga0157378_10021778
670 Ga0157378_10023941
671 Ga0157378_10046428
672 Ga0157378_10080150
673 Ga0163162_10053670
674 Ga0163162_10088681
675 Ga0163162_10089997
676 Ga0163162_10142039
677 Ga0163162_10143601
678 Ga0163162_10812134
679 Ga0157372_10005914
680 Ga0157372_10024900
681 Ga0157372_10069459
682 Ga0157372_10112690
683 Ga0157372_10221744
684 Ga0157372_10283183
685 Ga0157375_10304506
686 Ga0157375_10366144
687 Ga0163163_10001074
688 Ga0163163_10011324
689 Ga0163163_10079537
690 Ga0157380_10104756
691 Ga0182008_10005609
692 Ga0157379_10000997
693 Ga0157376_10009971
694 Ga0157376_10017914
695 Ga0157376_10051705
696 Ga0157376_10117100
697 Ga0157376_10261810
698 Ga0157376_10281027
699 Ga0182007_10002337
700 Ga0206356_11147555
701 Ga0213872_10001114
702 Ga0213872_10015271
703 Ga0213872_10019321
704 Ga0209674_100354
705 Ga0209677_100379
706 Ga0209455_1000095
707 Ga0209256_1001226
708 Ga0209257_1000233
709 Ga0207710_10000357
710 Ga0207710_10001422
711 Ga0207680_10027153
712 Ga0207647_10011657
713 Ga0207647_10044413
714 Ga0207699_10039584
715 Ga0207645_10000226
716 Ga0207705_10011828
717 Ga0207707_10102963
718 Ga0207695_10048333
719 Ga0207695_10206160
720 Ga0207671_10006362
721 Ga0207671_10095449
722 Ga0207671_10263436
723 Ga0207660_10376630
724 Ga0207657_10002531
725 Ga0207657_10130320
726 Ga0207649_10049901
727 Ga0207694_10009014
728 Ga0207694_10062263
729 Ga0207700_10008851
730 Ga0207664_10257111
731 Ga0207644_10079907
732 Ga0207644_10145766
733 Ga0207686_10011494
734 Ga0207686_10014314
735 Ga0207686_10025735
736 Ga0207709_10121424
737 Ga0207704_10000052
738 Ga0207704_10082629
739 Ga0207711_10010945
740 Ga0207711_10198444
741 Ga0207689_10002938
742 Ga0207661_10017757
743 Ga0207661_10021050
744 Ga0207661_10145808
745 Ga0207667_10009604
746 Ga0207667_10066300
747 Ga0207667_10215444
748 Ga0207651_10036989
749 Ga0207640_10140186
750 Ga0207658_10010009
751 Ga0207658_10021437
752 Ga0207677_10014413
753 Ga0207677_10145308
754 Ga0207703_10000299
755 Ga0207703_10003957
756 Ga0207703_10004527
757 Ga0207703_10013696
758 Ga0207703_10157736
759 Ga0207639_10003102
760 Ga0207639_10109648
761 Ga0207678_10004796
762 Ga0207708_10164555
763 Ga0207702_10067246
764 Ga0207702_10238087
765 Ga0207641_10004591
766 Ga0207641_10165907
767 Ga0207641_10369319
768 Ga0207648_10001156
769 Ga0207648_10030342
770 Ga0207676_10059412
771 Ga0207674_10001333
772 Ga0207674_10008701
773 Ga0207674_10052890
774 Ga0207674_10081561
775 Ga0207675_100042142
776 Ga0207698_10001154
777 Ga0209281_1000062
778 Ga0268266_10038431
779 Ga0268266_10054246
780 Ga0268266_10191591
781 Ga0268264_10002701
782 Ga0268264_10004835
783 Ga0268264_10006054
784 Ga0268264_10009883
785 Ga0268264_10050805
786 Ga0265337_1000904
787 Ga0265337_1040204
788 Ga0265319_1001832
789 Ga0265318_10000524
790 Ga0265318_10000724
791 Ga0265318_10018381
792 Ga0265322_10000083
793 Ga0265336_10024576
794 Ga0307515_10010334
795 Ga0265338_10000339
796 Ga0265338_10015135
797 Ga0265338_10233033
798 Ga0265324_10002597
799 Ga0307511_10086179
800 Ga0307512_10045922
801 Ga0265332_10031642
802 Ga0265328_10010302
803 Ga0265320_10000278
804 Ga0265320_10001566
805 Ga0265320_10016398
806 Ga0265320_10041268
807 Ga0265325_10002576
808 Ga0265325_10021360
809 Ga0265340_10008014
810 Ga0265339_10085295
811 Ga0265331_10079183
812 Ga0265331_10091143
813 Ga0265327_10001772
814 Ga0265327_10002174
815 Ga0265316_10033900
816 Ga0265316_10040063
817 Ga0307513_10423565
818 Ga0307408_100044754
819 Ga0265313_10003814
820 Ga0307508_10022930
821 Ga0307514_10121503
822 Ga0265314_10014742
823 Ga0265314_10079661
824 Ga0265342_10008168
825 Ga0307405_10015533
826 Ga0307413_10006363
827 Ga0307410_10015775
828 Ga0307407_10005822
829 Ga0307412_10060446
830 Ga0307412_10078173
831 Ga0307409_100006104
832 Ga0307416_100040716
833 Ga0307414_10031041
834 Ga0307411_10056545
835 Ga0307415_100262366
836 Ga0316593_10019903
837 Ga0307507_10141938
838 Ga0307510_10020981
839 Ga0307510_10146278
840 Ga0373928_0000397
841 Ga0373935_0029039
842 Ga0373947_0090225
843 Ga0373947_0270939
844 Ga0373937_0009594
845 Ga0395899_0000025
846 Ga0395900_0048894
847 Ga0395900_0057620
848 Ga0395900_0115531
849 Ga0395905_0000994
850 Ga0436364_0228312
851 Ga0436364_0889772
852 Ga0436364_1316340
853 Ga0400484_03169
854 Ga0400490_05124
855 Ga0400491_05118
856 Ga0400483_071122
857 Ga0400483_154000
858 Ga0436365_1125905
859 Ga0436360_0960022
860 Ga0436361_0314526
861 Ga0436361_0420617
862 Ga0436361_0561836
863 Ga0436363_1575714
864 Ga0436362_0261628
865 Ga0451795_1246844
866 Ga0451795_1276180
867 Ga0451855_0122681
868 Ga0451855_1894416
869 Ga0451577_0000164
870 Ga0451577_0001096
871 Ga0451577_0035194
872 Ga0451577_0133165
873 Ga0451577_0332051
874 Ga0451577_0446689
875 Ga0466969_0120084
876 Ga0453683_0000302
877 Ga0453683_0000676
878 Ga0453683_0006620
879 Ga0466966_0000369
880 Ga0466961_0127164
881 Ga0453684_0000236
882 Ga0453684_0000710
883 Ga0453684_0000978
884 Ga0453684_0001504
885 Ga0453684_0001541
886 Ga0453684_0002231
887 Ga0453684_0003799
888 Ga0453684_0008995
889 Ga0453684_0136075
890 Ga0453684_0386653
891 Ga0466957_0054066
892 Ga0466959_0011038
893 Ga0451576_0000064
894 Ga0451576_0000491
895 Ga0451576_0242042
896 Ga0451576_0413622
897 Ga0451576_0551910
898 Ga0495603_0089095
899 Ga0495590_0083168
900 Ga0495629_0003975
901 Ga0495650_0000009
902 Ga0495580_0292311
903 Ga0495582_0015200
904 Ga0495594_0002341
905 Ga0495594_0021011
906 Ga0495644_0000078
907 Ga0495642_0025638
908 Ga0495665_0022787
909 Ga0495665_0065514
910 Ga0495622_0132568
911 Ga0495633_0000021
912 Ga0495633_0029257
913 Ga0495634_0010207
914 Ga0495625_0081253
915 Ga0495659_0008137
916 Ga0495669_0001907
917 Ga0495613_0011892
918 Ga0495624_0167649
919 Ga0495581_0153502
920 Ga0495604_0231750
921 Ga0495674_0030290
922 Ga0495676_0001102
923 Ga0495680_0006151
924 Ga0495686_0005874
925 Ga0495614_0054113
926 Ga0496100_0161286
927 Ga0496100_0225193
928 Ga0496102_0009318
929 Ga0496102_0120483
930 Ga0496102_0327052
931 Ga0496104_0023567
932 Ga0496108_0215389
933 Ga0496110_0004410
934 Ga0496112_0011672
935 Ga0496112_0533357
936 Ga0496113_0004902
937 Ga0496115_0233422
938 Ga0496119_0006609
939 Ga0496119_0134751
940 Ga0496120_0025497
941 Ga0496120_0189775
942 Ga0496121_0001023
943 Ga0496121_0002657
944 Ga0496121_0034717
945 Ga0496121_0077826
946 Ga0496123_0022221
947 Ga0496125_0001270
948 Ga0496125_0003836
949 Ga0496125_0008794
950 Ga0496125_0011053
951 Ga0496125_0046709
952 Ga0496126_0000101
953 Ga0496126_0025078
954 Ga0496126_0285619
955 Ga0501306_000276
956 Ga0501305_000644
957 Ga0501291_014983
958 Ga0501312_000328
959 Ga0501312_008527
960 Ga0501316_000636
961 Ga0501034_0065473
962 Ga0501208_015603
963 Ga0501217_000829
964 Ga0501217_003299
965 Ga0501223_016088
966 Ga0501257_040472
967 Ga0501221_000886
968 Ga0501245_000277
969 Ga0501079_0280034
970 nmdc:mga0k408_102117_c1
971 nmdc:mga0k408_410_c1
972 nmdc:mga0qj67_157522_c1
973 nmdc:mga08y16_540643_c1
974 Ga0500650_0006158
975 Ga0500618_000367
976 Ga0500590_054034
977 Ga0500616_0000074
978 Ga0500637_0017052
979 Ga0500661_001094
980 2563927985
981 2566037093
982 2574433202
983 2587743051
984 2590601472
985 2595090113
986 2723602726
987 2730138701
988 2774874723
989 2802438948
990 2819671314
991 2857607495
992 2882463092
993 2889050932
994 2889278684
995 2904598709
996 2919403890
997 2936363043
998 2984532487
999 2984533744
1000 2996708304
1001 3006990956
1002 648169070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

212

0.96

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

218

289

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

40

209

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e6u-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase 0.9702 4 308
1e7r-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e 0.9681 4 308
1bsv-assembly1.cif.gz_A gdp-fucose synthetase from escherichia coli complex with nadph 0.9665 4 310
1e7q-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a 0.9658 4 308
1bws-assembly1.cif.gz_A crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose 0.9654 4 308
ID Description Score Start End Superfamily
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 4 291 3.40.50.720
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 4 291 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9058 117 308 3.40.50.720
6aqyC02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9041 169 306 3.90.25.10
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9022 169 308 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A2A4Q680-F1-model_v4 GDP-fucose synthetase 1.001 1 139 GO:0050577
AF-A0A4Q3TSA3-F1-model_v4 deleted 1 1 161
AF-A0A2M7R8L0-F1-model_v4 GDP-fucose synthetase 1 1 156 GO:0050577
AF-A0A356R231-F1-model_v4 GDP-fucose synthetase 0.9989 1 149 GO:0050577
AF-A0A731UXI0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9983 58 156 GO:0050577

Map