F455496

General Info

Members Datasets Scaffolds Average Seq Length
500 313 1000 140

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100263941|Ga0068853_1002639412
Length 170
Sequence MVESAPQLTASESSILSSSNLPPIHSEFTMNDRNLLRGLFLLAISLAFGLTSLRYPIGQFSRAGPGLFPLMVSCLLLLIAVITILRSRFVEHLPLGFNIKNISIILASLCGFALISEFVNMIAGIVFMVFCASFAGTASYSVVRNLKIAAGLVAVALAFQKLLGFNLPLY

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
285 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
286 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
292 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
295 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
296 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
297 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
298 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
299 2643221609 Acidovorax sp. Root217 Isolate Unclassified
300 2643221611 Acidovorax sp. Root219 Isolate Unclassified
301 2818991446 Variovorax sp. 1180 Isolate Unclassified
302 2842677519 Variovorax sp. R-72495 Isolate Unclassified
303 2842733646 Variovorax sp. R-72446 Isolate Unclassified
304 2842747753 Variovorax sp. R-72060 Isolate Unclassified
305 2899924645 Variovorax sp. 369 Isolate Unclassified
306 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
307 2904456579 Variovorax sp. 2002 Isolate Unclassified
308 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
309 2928051484 Variovorax sp. 1133 Isolate Unclassified
310 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
311 2928070936 Variovorax gossypii 1167 Isolate Unclassified
312 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
313 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0.4
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 0
Rhizoplane 9
Rhizosphere 70.6
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100263941 3300005539 Bacteria 1584
2 SwRhRL2b_contig_1133905 2162886007 Bacteria 1705
3 SwRhRL2b_contig_805671 2162886007 Bacteria 1200
4 JGI25152J39213_1003768 3300002773 Bacteria 5047
5 JGI25151J46595_10024381 3300003187 Bacteria 2475
6 rootH1_10009465 3300003316 Bacteria 1518
7 rootH1_10042863 3300003323 Bacteria 1528
8 Ga0006562J51391_1151502 3300003578 Bacteria 2510
9 Ga0055525_1000021 3300003759 Bacteria 370802
10 Ga0055535_1000075 3300003761 Bacteria 111667
11 Ga0055542_1000059 3300003762 Bacteria 162670
12 Ga0055530_10000110 3300003791 Bacteria 71015
13 Ga0055540_1001401 3300003792 Bacteria 14381
14 Ga0055540_1002424 3300003792 Bacteria 9858
15 Ga0055531_10001413 3300003794 Bacteria 17732
16 Ga0055543_1000644 3300004625 Bacteria 18672
17 Ga0058862_11893894 3300004803 Bacteria 629
18 Ga0065714_10003364 3300005288 Bacteria 12768
19 Ga0065704_10008021 3300005289 Bacteria 2814
20 Ga0070658_10018794 3300005327 Bacteria 5536
21 Ga0070676_10547651 3300005328 Bacteria 828
22 Ga0070683_100037905 3300005329 Bacteria 4415
23 Ga0070683_100197063 3300005329 Bacteria 1913
24 Ga0070680_100050642 3300005336 Bacteria 3388
25 Ga0068868_100980961 3300005338 Bacteria 772
26 Ga0068868_101055707 3300005338 Bacteria 746
27 Ga0070660_100011925 3300005339 Bacteria 6200
28 Ga0070660_100239910 3300005339 Bacteria 1476
29 Ga0070661_100026217 3300005344 Bacteria 4190
30 Ga0070669_100043497 3300005353 Bacteria 3271
31 Ga0070675_101848967 3300005354 Bacteria 557
32 Ga0070671_100006289 3300005355 Bacteria 9466
33 Ga0070659_100012771 3300005366 Bacteria 6236
34 Ga0070667_100850646 3300005367 Bacteria 848
35 Ga0070714_100281266 3300005435 Bacteria 1546
36 Ga0070713_100002534 3300005436 Bacteria 11950
37 Ga0070694_100779511 3300005444 Unclassified 783
38 Ga0070708_100189520 3300005445 Bacteria 1923
39 Ga0070678_100648075 3300005456 Bacteria 947
40 Ga0070678_101539945 3300005456 Bacteria 623
41 Ga0070662_100095764 3300005457 Bacteria 2238
42 Ga0070681_10210008 3300005458 Bacteria 1863
43 Ga0070681_10269862 3300005458 Bacteria 1613
44 Ga0068867_100169390 3300005459 Bacteria 1729
45 Ga0070706_100002053 3300005467 Bacteria 20636
46 Ga0070706_100106729 3300005467 Bacteria 2605
47 Ga0070706_100167442 3300005467 Bacteria 2052
48 Ga0070707_100073705 3300005468 Bacteria 3292
49 Ga0070707_100086667 3300005468 Bacteria 3028
50 Ga0070707_100209098 3300005468 Bacteria 1902
51 Ga0070698_100144502 3300005471 Bacteria 2329
52 Ga0070698_100568509 3300005471 Bacteria 1073
53 Ga0070699_100070610 3300005518 Bacteria 3036
54 Ga0070699_100346288 3300005518 Bacteria 1338
55 Ga0070679_100154427 3300005530 Bacteria 2271
56 Ga0070684_100040104 3300005535 Bacteria 4030
57 Ga0070697_100038643 3300005536 Bacteria 3857
58 Ga0070697_100183223 3300005536 Bacteria 1775
59 Ga0070697_100879216 3300005536 Bacteria 794
60 Ga0068853_100731835 3300005539 Bacteria 945
61 Ga0070672_100405838 3300005543 Bacteria 1168
62 Ga0070695_100209656 3300005545 Bacteria 1398
63 Ga0070693_100058782 3300005547 Bacteria 2227
64 Ga0070704_100042061 3300005549 Bacteria 3158
65 Ga0068855_100020731 3300005563 Bacteria 7883
66 Ga0068855_100075156 3300005563 Bacteria 3924
67 Ga0070664_100197120 3300005564 Bacteria 1795
68 Ga0070664_100306808 3300005564 Bacteria 1435
69 Ga0068857_100039274 3300005577 Bacteria 4192
70 Ga0068854_100023726 3300005578 Bacteria 4192
71 Ga0068856_100045151 3300005614 Bacteria 4337
72 Ga0068856_100146124 3300005614 Bacteria 2372
73 Ga0068856_101587004 3300005614 Bacteria 668
74 Ga0068852_100193466 3300005616 Bacteria 1921
75 Ga0068852_100869859 3300005616 Bacteria 917
76 Ga0068852_102149999 3300005616 Bacteria 580
77 Ga0068851_10021016 3300005834 Bacteria 3166
78 Ga0068851_10022285 3300005834 Bacteria 3083
79 Ga0068863_100055539 3300005841 Bacteria 3750
80 Ga0068863_100140314 3300005841 Bacteria 2309
81 Ga0068863_100731174 3300005841 Bacteria 985
82 Ga0068863_101631500 3300005841 Bacteria 654
83 Ga0068858_100185412 3300005842 Bacteria 1965
84 Ga0068858_101040500 3300005842 Bacteria 803
85 Ga0068858_101533645 3300005842 Unclassified 657
86 Ga0068860_100177803 3300005843 Bacteria 2057
87 Ga0081455_10000529 3300005937 Bacteria 49513
88 Ga0075365_10368868 3300006038 Bacteria 1012
89 Ga0075365_10955186 3300006038 Bacteria 604
90 Ga0075368_10186748 3300006042 Bacteria 875
91 Ga0075363_100288999 3300006048 Bacteria 950
92 Ga0075363_100421555 3300006048 Bacteria 786
93 Ga0075364_10054702 3300006051 Bacteria 2610
94 Ga0075362_10309204 3300006177 Bacteria 785
95 Ga0075367_10024820 3300006178 Bacteria 3382
96 Ga0075367_10686544 3300006178 Unclassified 651
97 Ga0075366_10161603 3300006195 Bacteria 1357
98 Ga0097621_101351016 3300006237 Bacteria 674
99 Ga0097621_101527055 3300006237 Bacteria 634
100 Ga0075370_10004816 3300006353 Bacteria 6609
101 Ga0075370_10048797 3300006353 Bacteria 2399
102 Ga0075370_10050853 3300006353 Bacteria 2351
103 Ga0068871_100064781 3300006358 Bacteria 2992
104 Ga0068871_100728579 3300006358 Bacteria 910
105 Ga0075434_100311127 3300006871 Bacteria 1595
106 Ga0075434_100504952 3300006871 Bacteria 1230
107 Ga0075436_100390698 3300006914 Bacteria 1007
108 Ga0075435_100242382 3300007076 Bacteria 1533
109 Ga0075435_100378493 3300007076 Bacteria 1216
110 Ga0099795_10395329 3300007788 Bacteria 627
111 Ga0099795_10409304 3300007788 Unclassified 618
112 Ga0105244_10001741 3300009036 Bacteria 17118
113 Ga0105250_10164128 3300009092 Bacteria 928
114 Ga0105240_10002500 3300009093 Bacteria 29543
115 Ga0105240_10013969 3300009093 Bacteria 10992
116 Ga0105240_10158852 3300009093 Bacteria 2687
117 Ga0105240_10163703 3300009093 Bacteria 2640
118 Ga0105240_10394371 3300009093 Bacteria 1560
119 Ga0105245_11216601 3300009098 Bacteria 801
120 Ga0114129_11415327 3300009147 Bacteria 857
121 Ga0105243_10006549 3300009148 Bacteria 8996
122 Ga0105243_10050457 3300009148 Bacteria 3287
123 Ga0105243_10320348 3300009148 Bacteria 1412
124 Ga0105241_10396362 3300009174 Bacteria 1210
125 Ga0105242_10324007 3300009176 Bacteria 1414
126 Ga0105248_10029905 3300009177 Bacteria 6078
127 Ga0105237_10015430 3300009545 Bacteria 7951
128 Ga0105237_10196836 3300009545 Bacteria 2015
129 Ga0105238_10046432 3300009551 Bacteria 4384
130 Ga0105238_10053582 3300009551 Bacteria 4053
131 Ga0105238_10059178 3300009551 Bacteria 3839
132 Ga0105238_10181069 3300009551 Bacteria 2084
133 Ga0105238_10190543 3300009551 Bacteria 2027
134 Ga0105238_11034431 3300009551 Bacteria 843
135 Ga0105238_11203509 3300009551 Bacteria 782
136 Ga0105239_10264706 3300010375 Bacteria 1933
137 Ga0105239_10484359 3300010375 Bacteria 1405
138 Ga0105246_10086083 3300011119 Bacteria 2252
139 Ga0157373_10006142 3300013100 Bacteria 8982
140 Ga0157373_10027357 3300013100 Bacteria 4114
141 Ga0157373_10035735 3300013100 Bacteria 3565
142 Ga0157371_10013731 3300013102 Bacteria 6141
143 Ga0157371_10228626 3300013102 Bacteria 1337
144 Ga0157371_10268154 3300013102 Bacteria 1232
145 Ga0157370_10219255 3300013104 Bacteria 1762
146 Ga0157370_10624902 3300013104 Bacteria 985
147 Ga0157370_10719497 3300013104 Bacteria 911
148 Ga0157369_10000843 3300013105 Bacteria 39252
149 Ga0157369_10060646 3300013105 Bacteria 4079
150 Ga0157374_10031324 3300013296 Bacteria 4833
151 Ga0157374_10240703 3300013296 Bacteria 1779
152 Ga0157378_10020288 3300013297 Bacteria 5845
153 Ga0157378_10688837 3300013297 Bacteria 1040
154 Ga0157378_11287358 3300013297 Bacteria 772
155 Ga0157372_10014374 3300013307 Bacteria 8465
156 Ga0157372_10030694 3300013307 Bacteria 5881
157 Ga0157372_10041765 3300013307 Bacteria 5070
158 Ga0157372_12643798 3300013307 Bacteria 576
159 Ga0157375_10762661 3300013308 Bacteria 1118
160 Ga0182008_10001695 3300014497 Bacteria 14479
161 Ga0182008_10018301 3300014497 Bacteria 3627
162 Ga0182008_10169992 3300014497 Bacteria 1100
163 Ga0157376_10293249 3300014969 Bacteria 1537
164 Ga0157376_10790852 3300014969 Bacteria 961
165 Ga0182006_1001421 3300015261 Bacteria 14485
166 Ga0182006_1054110 3300015261 Bacteria 1537
167 Ga0182007_10000269 3300015262 Bacteria 34602
168 Ga0182007_10060516 3300015262 Bacteria 1241
169 Ga0182005_1055896 3300015265 Bacteria 1076
170 Ga0163161_10079679 3300017792 Bacteria 2409
171 Ga0163161_10338879 3300017792 Bacteria 1192
172 Ga0163161_10986849 3300017792 Bacteria 718
173 Ga0209563_100005 3300025230 Bacteria 1774893
174 Ga0209051_1000979 3300025303 Bacteria 27790
175 Ga0207656_10022314 3300025321 Bacteria 2538
176 Ga0207656_10023216 3300025321 Bacteria 2495
177 Ga0207656_10035942 3300025321 Bacteria 2077
178 Ga0207653_10205235 3300025885 Bacteria 744
179 Ga0207680_11004681 3300025903 Bacteria 597
180 Ga0207645_10208452 3300025907 Bacteria 1287
181 Ga0207643_10335998 3300025908 Bacteria 946
182 Ga0207705_10082515 3300025909 Bacteria 2344
183 Ga0207684_10054550 3300025910 Bacteria 3391
184 Ga0207684_10576008 3300025910 Bacteria 962
185 Ga0207684_10883649 3300025910 Bacteria 752
186 Ga0207654_10223827 3300025911 Bacteria 1249
187 Ga0207707_10122830 3300025912 Bacteria 2271
188 Ga0207695_10040490 3300025913 Bacteria 4994
189 Ga0207695_10062860 3300025913 Bacteria 3830
190 Ga0207695_10171178 3300025913 Bacteria 2097
191 Ga0207695_10304354 3300025913 Bacteria 1485
192 Ga0207671_10008619 3300025914 Bacteria 8617
193 Ga0207671_10039086 3300025914 Bacteria 3515
194 Ga0207671_10039920 3300025914 Bacteria 3475
195 Ga0207660_10148383 3300025917 Bacteria 1800
196 Ga0207657_10016574 3300025919 Bacteria 7099
197 Ga0207657_10093005 3300025919 Bacteria 2512
198 Ga0207657_10353789 3300025919 Bacteria 1158
199 Ga0207657_10455933 3300025919 Bacteria 1003
200 Ga0207649_10043086 3300025920 Bacteria 2757
201 Ga0207652_10128265 3300025921 Bacteria 2261
202 Ga0207652_10447531 3300025921 Bacteria 1164
203 Ga0207646_10001985 3300025922 Bacteria 24574
204 Ga0207646_10640695 3300025922 Bacteria 952
205 Ga0207646_10648246 3300025922 Bacteria 946
206 Ga0207681_11168299 3300025923 Bacteria 646
207 Ga0207694_10011581 3300025924 Bacteria 6654
208 Ga0207694_10031848 3300025924 Bacteria 4031
209 Ga0207694_10106212 3300025924 Bacteria 2230
210 Ga0207694_10243677 3300025924 Bacteria 1469
211 Ga0207694_10507830 3300025924 Bacteria 1010
212 Ga0207694_10828918 3300025924 Bacteria 782
213 Ga0207650_10354946 3300025925 Bacteria 1207
214 Ga0207659_10570225 3300025926 Bacteria 963
215 Ga0207687_10009492 3300025927 Bacteria 6363
216 Ga0207687_10586269 3300025927 Bacteria 938
217 Ga0207700_10000023 3300025928 Bacteria 152285
218 Ga0207664_10252464 3300025929 Bacteria 1540
219 Ga0207644_10005689 3300025931 Bacteria 8115
220 Ga0207690_10041570 3300025932 Bacteria 3013
221 Ga0207690_10209176 3300025932 Bacteria 1486
222 Ga0207706_10038066 3300025933 Bacteria 4267
223 Ga0207706_10130152 3300025933 Bacteria 2213
224 Ga0207686_10345486 3300025934 Bacteria 1119
225 Ga0207709_10858962 3300025935 Bacteria 735
226 Ga0207709_11245038 3300025935 Bacteria 614
227 Ga0207670_10446444 3300025936 Unclassified 1042
228 Ga0207704_10312584 3300025938 Bacteria 1209
229 Ga0207665_10027809 3300025939 Bacteria 3736
230 Ga0207665_10877827 3300025939 Bacteria 711
231 Ga0207691_10222421 3300025940 Bacteria 1637
232 Ga0207711_10013786 3300025941 Bacteria 6711
233 Ga0207689_10000485 3300025942 Bacteria 37567
234 Ga0207689_10497350 3300025942 Bacteria 1021
235 Ga0207661_10152085 3300025944 Bacteria 2001
236 Ga0207679_10399865 3300025945 Bacteria 1208
237 Ga0207667_10070033 3300025949 Bacteria 3651
238 Ga0207640_10404827 3300025981 Bacteria 1112
239 Ga0207640_10579721 3300025981 Bacteria 947
240 Ga0207658_10406238 3300025986 Bacteria 1198
241 Ga0207658_10628519 3300025986 Bacteria 966
242 Ga0207677_10385619 3300026023 Bacteria 1184
243 Ga0207677_10397262 3300026023 Bacteria 1168
244 Ga0207677_10942626 3300026023 Unclassified 780
245 Ga0207703_10063010 3300026035 Bacteria 3038
246 Ga0207703_10122628 3300026035 Bacteria 2233
247 Ga0207639_10005201 3300026041 Bacteria 8778
248 Ga0207639_10056507 3300026041 Bacteria 3008
249 Ga0207639_10555439 3300026041 Bacteria 1054
250 Ga0207639_10674729 3300026041 Bacteria 957
251 Ga0207678_10019010 3300026067 Bacteria 6036
252 Ga0207678_10336875 3300026067 Bacteria 1299
253 Ga0207702_10078095 3300026078 Bacteria 2865
254 Ga0207702_11003410 3300026078 Archaea 828
255 Ga0207702_11918650 3300026078 Bacteria 583
256 Ga0207641_10019011 3300026088 Bacteria 5636
257 Ga0207641_10121814 3300026088 Bacteria 2329
258 Ga0207641_10176970 3300026088 Bacteria 1951
259 Ga0207641_12055682 3300026088 Bacteria 572
260 Ga0207648_10049361 3300026089 Bacteria 3682
261 Ga0207676_10197367 3300026095 Bacteria 1775
262 Ga0207674_10053011 3300026116 Bacteria 4135
263 Ga0207674_10314725 3300026116 Bacteria 1514
264 Ga0207675_100000216 3300026118 Bacteria 54012
265 Ga0207683_10777511 3300026121 Unclassified 888
266 Ga0207698_10100776 3300026142 Bacteria 2393
267 Ga0207698_10576920 3300026142 Bacteria 1106
268 Ga0207698_10982606 3300026142 Bacteria 854
269 Ga0209813_10188488 3300027866 Bacteria 758
270 Ga0268264_10120988 3300028381 Bacteria 2307
271 Ga0268264_11190180 3300028381 Bacteria 771
272 Ga0307517_10226113 3300028786 Unclassified 1130
273 Ga0307515_10000588 3300028794 Bacteria 85228
274 Ga0307515_10350882 3300028794 Bacteria 1122
275 Ga0316183_1205824 3300030742 Bacteria 1798
276 Ga0316181_1077792 3300030744 Bacteria 786
277 Ga0316181_1222123 3300030744 Bacteria 2027
278 Ga0316182_1158317 3300030745 Bacteria 3990
279 Ga0265330_10063991 3300031235 Bacteria 1598
280 Ga0265332_10000401 3300031238 Bacteria 31298
281 Ga0265331_10000262 3300031250 Bacteria 60603
282 Ga0265327_10009701 3300031251 Bacteria 6900
283 Ga0307513_10228514 3300031456 Bacteria 1675
284 Ga0307513_10271620 3300031456 Bacteria 1478
285 Ga0307509_10401709 3300031507 Bacteria 1077
286 Ga0307408_100166395 3300031548 Bacteria 1756
287 Ga0307508_10000030 3300031616 Bacteria 165616
288 Ga0307514_10002589 3300031649 Bacteria 18532
289 Ga0307514_10022816 3300031649 Bacteria 5083
290 Ga0265314_10063499 3300031711 Bacteria 2505
291 Ga0265342_10034460 3300031712 Bacteria 3106
292 Ga0265342_10143406 3300031712 Bacteria 1331
293 Ga0307516_10002018 3300031730 Bacteria 27692
294 Ga0307516_10074468 3300031730 Bacteria 3251
295 Ga0307405_10073519 3300031731 Bacteria 2207
296 Ga0307406_10585168 3300031901 Bacteria 918
297 Ga0307412_10139289 3300031911 Bacteria 1774
298 Ga0307412_10179871 3300031911 Bacteria 1589
299 Ga0307412_10268140 3300031911 Bacteria 1335
300 Ga0307414_11304740 3300032004 Bacteria 673
301 Ga0307507_10155844 3300033179 Bacteria 1702
302 Ga0373950_0074729 3300034818 Bacteria 699
303 Ga0373958_0043707 3300034819 Bacteria 925
304 Ga0373928_0014799 3300035084 Bacteria 1582
305 Ga0373932_0137755 3300035112 Bacteria 828
306 Ga0373943_0305856 3300035170 Unclassified 904
307 Ga0373943_0945225 3300035170 Bacteria 516
308 Ga0373935_0257976 3300035692 Bacteria 1222
309 Ga0373927_0765745 3300035695 Bacteria 638
310 Ga0373947_0574243 3300035725 Bacteria 768
311 Ga0373947_0669185 3300035725 Bacteria 708
312 Ga0373937_0738037 3300036401 Bacteria 932
313 Ga0373925_0633744 3300037068 Bacteria 881
314 Ga0395899_0008027 3300037312 Bacteria 8127
315 Ga0395900_0112102 3300037418 Bacteria 2801
316 Ga0395900_0122997 3300037418 Bacteria 2661
317 Ga0395900_0163570 3300037418 Bacteria 2269
318 Ga0395898_0023928 3300037466 Bacteria 6164
319 Ga0395898_0064104 3300037466 Bacteria 3565
320 Ga0395898_1144034 3300037466 Bacteria 711
321 Ga0395905_0129996 3300037471 Bacteria 2368
322 Ga0395905_0712504 3300037471 Bacteria 906
323 Ga0395905_0750804 3300037471 Bacteria 878
324 Ga0395901_0293102 3300038443 Bacteria 1688
325 Ga0436365_0120135 3300039437 Bacteria 692
326 Ga0436361_0091030 3300039447 Bacteria 2094
327 Ga0451787_732463 3300041441 Bacteria 934
328 Ga0451789_0208144 3300041443 Bacteria 1487
329 Ga0451797_1207466 3300041453 Bacteria 1033
330 Ga0451800_1261555 3300041459 Bacteria 1038
331 Ga0451802_1175484 3300041460 Bacteria 958
332 Ga0451807_0433055 3300041486 Bacteria 527
333 Ga0451807_1653191 3300041486 Bacteria 948
334 Ga0451833_0702241 3300041491 Bacteria 1080
335 Ga0451835_0121393 3300041492 Bacteria 976
336 Ga0451839_1208443 3300041496 Bacteria 914
337 Ga0451841_0118537 3300041498 Bacteria 577
338 Ga0451845_0541005 3300041501 Bacteria 1955
339 Ga0451851_1291770 3300041507 Bacteria 777
340 Ga0451843_0852173 3300041509 Bacteria 2370
341 Ga0451855_2054749 3300041511 Bacteria 748
342 Ga0451853_3754481 3300041512 Bacteria 1256
343 Ga0439449_0037794 3300042007 Bacteria 1796
344 Ga0439455_0011263 3300042012 Bacteria 1983
345 Ga0439434_0320390 3300042435 Bacteria 538
346 Ga0439464_0090092 3300042439 Bacteria 924
347 Ga0451577_0240257 3300042876 Bacteria 1639
348 Ga0451577_0263266 3300042876 Bacteria 1561
349 Ga0451577_1692403 3300042876 Bacteria 557
350 Ga0466969_0194863 3300044656 Bacteria 925
351 Ga0466969_0336965 3300044656 Bacteria 683
352 Ga0453683_0021324 3300044673 Bacteria 4137
353 Ga0453683_0260770 3300044673 Bacteria 1106
354 Ga0466965_0135852 3300044683 Bacteria 1277
355 Ga0466961_0189447 3300044693 Bacteria 1275
356 Ga0453684_0465695 3300044712 Bacteria 1404
357 Ga0466971_0094165 3300044719 Bacteria 1373
358 Ga0466970_0367875 3300044765 Bacteria 817
359 Ga0466957_0264821 3300044842 Bacteria 1146
360 Ga0466960_0021035 3300044901 Bacteria 2899
361 Ga0466960_0159829 3300044901 Bacteria 1209
362 Ga0466959_0466161 3300045049 Bacteria 856
363 Ga0451576_0215421 3300045051 Bacteria 2005
364 Ga0451576_0647610 3300045051 Bacteria 1110
365 Ga0466967_0892961 3300045976 Bacteria 884
366 Ga0495592_0000328 3300046454 Bacteria 39423
367 Ga0495580_0024117 3300046472 Bacteria 4459
368 Ga0495580_0064769 3300046472 Bacteria 2561
369 Ga0495582_0147315 3300046473 Bacteria 1336
370 Ga0495639_0002544 3300046475 Bacteria 7956
371 Ga0495639_0323352 3300046475 Bacteria 772
372 Ga0495664_0508658 3300046477 Bacteria 719
373 Ga0495610_0016380 3300046512 Bacteria 4269
374 Ga0495632_0179430 3300046519 Bacteria 970
375 Ga0495632_0198534 3300046519 Bacteria 914
376 Ga0495643_0085589 3300046522 Bacteria 1634
377 Ga0495643_0156440 3300046522 Bacteria 1125
378 Ga0495643_0187262 3300046522 Bacteria 1001
379 Ga0495586_0068923 3300046535 Bacteria 1930
380 Ga0495586_0125125 3300046535 Bacteria 1438
381 Ga0495645_0006456 3300046543 Bacteria 8136
382 Ga0495625_0003304 3300046660 Bacteria 16271
383 Ga0495588_0077058 3300046674 Bacteria 1738
384 Ga0495658_0023210 3300046683 Bacteria 3291
385 Ga0495671_0580736 3300046692 Bacteria 533
386 Ga0495604_0254759 3300047317 Bacteria 1195
387 Ga0495676_0153249 3300047321 Bacteria 1638
388 Ga0495676_0336519 3300047321 Bacteria 1011
389 Ga0495687_216436 3300047443 Bacteria 596
390 Ga0495686_0144795 3300047472 Bacteria 1400
391 Ga0495593_0210271 3300047673 Bacteria 977
392 Ga0495593_0481720 3300047673 Bacteria 622
393 Ga0496100_0109914 3300048903 Bacteria 1913
394 Ga0496100_0114481 3300048903 Bacteria 1879
395 Ga0496100_0368195 3300048903 Bacteria 1089
396 Ga0496101_0005715 3300048904 Bacteria 7942
397 Ga0496101_0053030 3300048904 Bacteria 2925
398 Ga0496102_0005508 3300048905 Bacteria 10749
399 Ga0496102_0035422 3300048905 Bacteria 4493
400 Ga0496102_0243665 3300048905 Bacteria 1695
401 Ga0496102_0639269 3300048905 Bacteria 987
402 Ga0496103_0265559 3300048906 Bacteria 1104
403 Ga0496103_0600020 3300048906 Bacteria 701
404 Ga0496104_0332872 3300048907 Bacteria 1431
405 Ga0496104_0396805 3300048907 Bacteria 1292
406 Ga0496104_0498979 3300048907 Bacteria 1128
407 Ga0496104_0559621 3300048907 Bacteria 1054
408 Ga0496105_0005462 3300048908 Bacteria 9647
409 Ga0496105_0220561 3300048908 Bacteria 1544
410 Ga0496106_0053197 3300048909 Bacteria 3057
411 Ga0496107_0038399 3300048910 Bacteria 3435
412 Ga0496108_0068417 3300048911 Bacteria 2996
413 Ga0496108_0267992 3300048911 Bacteria 1486
414 Ga0496108_0331442 3300048911 Bacteria 1327
415 Ga0496109_0446621 3300048912 Bacteria 1221
416 Ga0496110_0026020 3300048913 Bacteria 5003
417 Ga0496110_0044555 3300048913 Bacteria 3874
418 Ga0496111_0114695 3300048914 Bacteria 1986
419 Ga0496111_0131026 3300048914 Bacteria 1855
420 Ga0496111_0200368 3300048914 Bacteria 1484
421 Ga0496111_0705975 3300048914 Bacteria 733
422 Ga0496112_0043599 3300048915 Bacteria 4392
423 Ga0496112_0904911 3300048915 Bacteria 804
424 Ga0496113_0099411 3300048916 Bacteria 2253
425 Ga0496113_0132626 3300048916 Bacteria 1956
426 Ga0496114_0123916 3300048917 Bacteria 2225
427 Ga0496115_0114743 3300048918 Bacteria 2214
428 Ga0496117_0090613 3300048920 Bacteria 1969
429 Ga0496118_0019314 3300048921 Bacteria 6095
430 Ga0496122_0000688 3300048925 Bacteria 67392
431 Ga0496122_0064646 3300048925 Bacteria 2660
432 Ga0496122_0173095 3300048925 Bacteria 1298
433 Ga0496123_0000314 3300048926 Bacteria 92927
434 Ga0496123_0077880 3300048926 Bacteria 2034
435 Ga0496123_0214684 3300048926 Bacteria 975
436 Ga0496124_0039875 3300048927 Bacteria 4066
437 Ga0496124_0119653 3300048927 Bacteria 2106
438 Ga0496125_0081972 3300048928 Bacteria 2461
439 Ga0496125_0206662 3300048928 Bacteria 1280
440 Ga0496125_0750761 3300048928 Bacteria 511
441 Ga0501206_016097 3300049653 Bacteria 1039
442 Ga0501225_0010347 3300049705 Bacteria 2642
443 nmdc:mga03683_1992_c1 3300050489 Bacteria 1612
444 nmdc:mga03n38_204035_c1 3300050490 Bacteria 1024
445 nmdc:mga03n38_439699_c1 3300050490 Unclassified 724
446 nmdc:mga00v17_1014678_c1 3300050491 Bacteria 522
447 nmdc:mga00v17_363630_c1 3300050491 Bacteria 941
448 nmdc:mga0yw44_375176_c1 3300050492 Bacteria 960
449 nmdc:mga0k408_101826_c1 3300050493 Bacteria 1694
450 nmdc:mga0k408_333326_c1 3300050493 Bacteria 905
451 nmdc:mga0k408_377245_c1 3300050493 Bacteria 845
452 nmdc:mga0k408_940415_c1 3300050493 Bacteria 501
453 nmdc:mga06z11_114389_c1 3300050494 Bacteria 1498
454 nmdc:mga06z11_557972_c1 3300050494 Bacteria 696
455 nmdc:mga04h51_150219_c1 3300050495 Bacteria 890
456 nmdc:mga07m45_110796_c1 3300050496 Bacteria 1581
457 nmdc:mga07m45_135754_c1 3300050496 Bacteria 1424
458 nmdc:mga07m45_45882_c1 3300050496 Bacteria 2454
459 nmdc:mga05p37_2127583_c1 3300050507 Bacteria 524
460 nmdc:mga0n895_1532692_c1 3300050512 Unclassified 632
461 nmdc:mga0n895_214406_c1 3300050512 Bacteria 1955
462 nmdc:mga0n895_470091_c1 3300050512 Bacteria 1268
463 nmdc:mga0rr50_337035_c1 3300050513 Bacteria 1267
464 nmdc:mga0rr50_595903_c1 3300050513 Bacteria 942
465 nmdc:mga0rr50_601009_c1 3300050513 Bacteria 938
466 nmdc:mga08x19_350734_c1 3300050514 Bacteria 1030
467 nmdc:mga0a205_675157_c1 3300050515 Bacteria 884
468 Ga0495601_0099995 3300053077 Bacteria 1872
469 Ga0500646_0029362 3300053090 Bacteria 1505
470 Ga0500608_054840 3300053122 Bacteria 1912
471 Ga0500618_043307 3300053125 Bacteria 1029
472 Ga0500658_0044912 3300053134 Bacteria 1784
473 Ga0500559_0013547 3300053136 Bacteria 3451
474 Ga0500564_035821 3300053138 Bacteria 2291
475 Ga0500622_0271440 3300053156 Bacteria 735
476 Ga0500567_081028 3300053723 Bacteria 1401
477 Ga0500587_007339 3300053739 Bacteria 1437
478 Ga0466962_0335901 3300061719 Bacteria 751
479 2587754982 2585428062 Bacteria 6842168
480 2599622999 2599185214 Bacteria 8209958
481 2599674646 2599185226 Bacteria 8233575
482 2599680603 2599185227 Bacteria 8246414
483 2599692618 2599185229 Bacteria 8216126
484 2644058529 2643221609 Bacteria 6756331
485 2644070658 2643221611 Bacteria 6820941
486 2819601752 2818991446 Bacteria 7757362
487 2842680378 2842677519 Bacteria 5615038
488 2842736823 2842733646 Bacteria 5716726
489 2842747893 2842747753 Bacteria 5578255
490 2899928694 2899924645 Bacteria 7487985
491 2899930819 2899924645 Bacteria 7487985
492 2904455281 2904449895 Bacteria 6927402
493 2904461314 2904456579 Bacteria 6819253
494 2919467414 2919462493 Bacteria 5817112
495 2928055592 2928051484 Bacteria 7773759
496 2928056297 2928051484 Bacteria 7773759
497 2928069689 2928064002 Bacteria 7419480
498 2928075825 2928070936 Bacteria 8062541
499 2945972417 2945972063 Bacteria 6086495
500 2954768160 2954767861 Bacteria 5535784
501 Ga0068853_100263941
502 SwRhRL2b_contig_1133905
503 SwRhRL2b_contig_805671
504 JGI25152J39213_1003768
505 JGI25151J46595_10024381
506 rootH1_10009465
507 rootH1_10042863
508 Ga0006562J51391_1151502
509 Ga0055525_1000021
510 Ga0055535_1000075
511 Ga0055542_1000059
512 Ga0055530_10000110
513 Ga0055540_1001401
514 Ga0055540_1002424
515 Ga0055531_10001413
516 Ga0055543_1000644
517 Ga0058862_11893894
518 Ga0065714_10003364
519 Ga0065704_10008021
520 Ga0070658_10018794
521 Ga0070676_10547651
522 Ga0070683_100037905
523 Ga0070683_100197063
524 Ga0070680_100050642
525 Ga0068868_100980961
526 Ga0068868_101055707
527 Ga0070660_100011925
528 Ga0070660_100239910
529 Ga0070661_100026217
530 Ga0070669_100043497
531 Ga0070675_101848967
532 Ga0070671_100006289
533 Ga0070659_100012771
534 Ga0070667_100850646
535 Ga0070714_100281266
536 Ga0070713_100002534
537 Ga0070694_100779511
538 Ga0070708_100189520
539 Ga0070678_100648075
540 Ga0070678_101539945
541 Ga0070662_100095764
542 Ga0070681_10210008
543 Ga0070681_10269862
544 Ga0068867_100169390
545 Ga0070706_100002053
546 Ga0070706_100106729
547 Ga0070706_100167442
548 Ga0070707_100073705
549 Ga0070707_100086667
550 Ga0070707_100209098
551 Ga0070698_100144502
552 Ga0070698_100568509
553 Ga0070699_100070610
554 Ga0070699_100346288
555 Ga0070679_100154427
556 Ga0070684_100040104
557 Ga0070697_100038643
558 Ga0070697_100183223
559 Ga0070697_100879216
560 Ga0068853_100731835
561 Ga0070672_100405838
562 Ga0070695_100209656
563 Ga0070693_100058782
564 Ga0070704_100042061
565 Ga0068855_100020731
566 Ga0068855_100075156
567 Ga0070664_100197120
568 Ga0070664_100306808
569 Ga0068857_100039274
570 Ga0068854_100023726
571 Ga0068856_100045151
572 Ga0068856_100146124
573 Ga0068856_101587004
574 Ga0068852_100193466
575 Ga0068852_100869859
576 Ga0068852_102149999
577 Ga0068851_10021016
578 Ga0068851_10022285
579 Ga0068863_100055539
580 Ga0068863_100140314
581 Ga0068863_100731174
582 Ga0068863_101631500
583 Ga0068858_100185412
584 Ga0068858_101040500
585 Ga0068858_101533645
586 Ga0068860_100177803
587 Ga0081455_10000529
588 Ga0075365_10368868
589 Ga0075365_10955186
590 Ga0075368_10186748
591 Ga0075363_100288999
592 Ga0075363_100421555
593 Ga0075364_10054702
594 Ga0075362_10309204
595 Ga0075367_10024820
596 Ga0075367_10686544
597 Ga0075366_10161603
598 Ga0097621_101351016
599 Ga0097621_101527055
600 Ga0075370_10004816
601 Ga0075370_10048797
602 Ga0075370_10050853
603 Ga0068871_100064781
604 Ga0068871_100728579
605 Ga0075434_100311127
606 Ga0075434_100504952
607 Ga0075436_100390698
608 Ga0075435_100242382
609 Ga0075435_100378493
610 Ga0099795_10395329
611 Ga0099795_10409304
612 Ga0105244_10001741
613 Ga0105250_10164128
614 Ga0105240_10002500
615 Ga0105240_10013969
616 Ga0105240_10158852
617 Ga0105240_10163703
618 Ga0105240_10394371
619 Ga0105245_11216601
620 Ga0114129_11415327
621 Ga0105243_10006549
622 Ga0105243_10050457
623 Ga0105243_10320348
624 Ga0105241_10396362
625 Ga0105242_10324007
626 Ga0105248_10029905
627 Ga0105237_10015430
628 Ga0105237_10196836
629 Ga0105238_10046432
630 Ga0105238_10053582
631 Ga0105238_10059178
632 Ga0105238_10181069
633 Ga0105238_10190543
634 Ga0105238_11034431
635 Ga0105238_11203509
636 Ga0105239_10264706
637 Ga0105239_10484359
638 Ga0105246_10086083
639 Ga0157373_10006142
640 Ga0157373_10027357
641 Ga0157373_10035735
642 Ga0157371_10013731
643 Ga0157371_10228626
644 Ga0157371_10268154
645 Ga0157370_10219255
646 Ga0157370_10624902
647 Ga0157370_10719497
648 Ga0157369_10000843
649 Ga0157369_10060646
650 Ga0157374_10031324
651 Ga0157374_10240703
652 Ga0157378_10020288
653 Ga0157378_10688837
654 Ga0157378_11287358
655 Ga0157372_10014374
656 Ga0157372_10030694
657 Ga0157372_10041765
658 Ga0157372_12643798
659 Ga0157375_10762661
660 Ga0182008_10001695
661 Ga0182008_10018301
662 Ga0182008_10169992
663 Ga0157376_10293249
664 Ga0157376_10790852
665 Ga0182006_1001421
666 Ga0182006_1054110
667 Ga0182007_10000269
668 Ga0182007_10060516
669 Ga0182005_1055896
670 Ga0163161_10079679
671 Ga0163161_10338879
672 Ga0163161_10986849
673 Ga0209563_100005
674 Ga0209051_1000979
675 Ga0207656_10022314
676 Ga0207656_10023216
677 Ga0207656_10035942
678 Ga0207653_10205235
679 Ga0207680_11004681
680 Ga0207645_10208452
681 Ga0207643_10335998
682 Ga0207705_10082515
683 Ga0207684_10054550
684 Ga0207684_10576008
685 Ga0207684_10883649
686 Ga0207654_10223827
687 Ga0207707_10122830
688 Ga0207695_10040490
689 Ga0207695_10062860
690 Ga0207695_10171178
691 Ga0207695_10304354
692 Ga0207671_10008619
693 Ga0207671_10039086
694 Ga0207671_10039920
695 Ga0207660_10148383
696 Ga0207657_10016574
697 Ga0207657_10093005
698 Ga0207657_10353789
699 Ga0207657_10455933
700 Ga0207649_10043086
701 Ga0207652_10128265
702 Ga0207652_10447531
703 Ga0207646_10001985
704 Ga0207646_10640695
705 Ga0207646_10648246
706 Ga0207681_11168299
707 Ga0207694_10011581
708 Ga0207694_10031848
709 Ga0207694_10106212
710 Ga0207694_10243677
711 Ga0207694_10507830
712 Ga0207694_10828918
713 Ga0207650_10354946
714 Ga0207659_10570225
715 Ga0207687_10009492
716 Ga0207687_10586269
717 Ga0207700_10000023
718 Ga0207664_10252464
719 Ga0207644_10005689
720 Ga0207690_10041570
721 Ga0207690_10209176
722 Ga0207706_10038066
723 Ga0207706_10130152
724 Ga0207686_10345486
725 Ga0207709_10858962
726 Ga0207709_11245038
727 Ga0207670_10446444
728 Ga0207704_10312584
729 Ga0207665_10027809
730 Ga0207665_10877827
731 Ga0207691_10222421
732 Ga0207711_10013786
733 Ga0207689_10000485
734 Ga0207689_10497350
735 Ga0207661_10152085
736 Ga0207679_10399865
737 Ga0207667_10070033
738 Ga0207640_10404827
739 Ga0207640_10579721
740 Ga0207658_10406238
741 Ga0207658_10628519
742 Ga0207677_10385619
743 Ga0207677_10397262
744 Ga0207677_10942626
745 Ga0207703_10063010
746 Ga0207703_10122628
747 Ga0207639_10005201
748 Ga0207639_10056507
749 Ga0207639_10555439
750 Ga0207639_10674729
751 Ga0207678_10019010
752 Ga0207678_10336875
753 Ga0207702_10078095
754 Ga0207702_11003410
755 Ga0207702_11918650
756 Ga0207641_10019011
757 Ga0207641_10121814
758 Ga0207641_10176970
759 Ga0207641_12055682
760 Ga0207648_10049361
761 Ga0207676_10197367
762 Ga0207674_10053011
763 Ga0207674_10314725
764 Ga0207675_100000216
765 Ga0207683_10777511
766 Ga0207698_10100776
767 Ga0207698_10576920
768 Ga0207698_10982606
769 Ga0209813_10188488
770 Ga0268264_10120988
771 Ga0268264_11190180
772 Ga0307517_10226113
773 Ga0307515_10000588
774 Ga0307515_10350882
775 Ga0316183_1205824
776 Ga0316181_1077792
777 Ga0316181_1222123
778 Ga0316182_1158317
779 Ga0265330_10063991
780 Ga0265332_10000401
781 Ga0265331_10000262
782 Ga0265327_10009701
783 Ga0307513_10228514
784 Ga0307513_10271620
785 Ga0307509_10401709
786 Ga0307408_100166395
787 Ga0307508_10000030
788 Ga0307514_10002589
789 Ga0307514_10022816
790 Ga0265314_10063499
791 Ga0265342_10034460
792 Ga0265342_10143406
793 Ga0307516_10002018
794 Ga0307516_10074468
795 Ga0307405_10073519
796 Ga0307406_10585168
797 Ga0307412_10139289
798 Ga0307412_10179871
799 Ga0307412_10268140
800 Ga0307414_11304740
801 Ga0307507_10155844
802 Ga0373950_0074729
803 Ga0373958_0043707
804 Ga0373928_0014799
805 Ga0373932_0137755
806 Ga0373943_0305856
807 Ga0373943_0945225
808 Ga0373935_0257976
809 Ga0373927_0765745
810 Ga0373947_0574243
811 Ga0373947_0669185
812 Ga0373937_0738037
813 Ga0373925_0633744
814 Ga0395899_0008027
815 Ga0395900_0112102
816 Ga0395900_0122997
817 Ga0395900_0163570
818 Ga0395898_0023928
819 Ga0395898_0064104
820 Ga0395898_1144034
821 Ga0395905_0129996
822 Ga0395905_0712504
823 Ga0395905_0750804
824 Ga0395901_0293102
825 Ga0436365_0120135
826 Ga0436361_0091030
827 Ga0451787_732463
828 Ga0451789_0208144
829 Ga0451797_1207466
830 Ga0451800_1261555
831 Ga0451802_1175484
832 Ga0451807_0433055
833 Ga0451807_1653191
834 Ga0451833_0702241
835 Ga0451835_0121393
836 Ga0451839_1208443
837 Ga0451841_0118537
838 Ga0451845_0541005
839 Ga0451851_1291770
840 Ga0451843_0852173
841 Ga0451855_2054749
842 Ga0451853_3754481
843 Ga0439449_0037794
844 Ga0439455_0011263
845 Ga0439434_0320390
846 Ga0439464_0090092
847 Ga0451577_0240257
848 Ga0451577_0263266
849 Ga0451577_1692403
850 Ga0466969_0194863
851 Ga0466969_0336965
852 Ga0453683_0021324
853 Ga0453683_0260770
854 Ga0466965_0135852
855 Ga0466961_0189447
856 Ga0453684_0465695
857 Ga0466971_0094165
858 Ga0466970_0367875
859 Ga0466957_0264821
860 Ga0466960_0021035
861 Ga0466960_0159829
862 Ga0466959_0466161
863 Ga0451576_0215421
864 Ga0451576_0647610
865 Ga0466967_0892961
866 Ga0495592_0000328
867 Ga0495580_0024117
868 Ga0495580_0064769
869 Ga0495582_0147315
870 Ga0495639_0002544
871 Ga0495639_0323352
872 Ga0495664_0508658
873 Ga0495610_0016380
874 Ga0495632_0179430
875 Ga0495632_0198534
876 Ga0495643_0085589
877 Ga0495643_0156440
878 Ga0495643_0187262
879 Ga0495586_0068923
880 Ga0495586_0125125
881 Ga0495645_0006456
882 Ga0495625_0003304
883 Ga0495588_0077058
884 Ga0495658_0023210
885 Ga0495671_0580736
886 Ga0495604_0254759
887 Ga0495676_0153249
888 Ga0495676_0336519
889 Ga0495687_216436
890 Ga0495686_0144795
891 Ga0495593_0210271
892 Ga0495593_0481720
893 Ga0496100_0109914
894 Ga0496100_0114481
895 Ga0496100_0368195
896 Ga0496101_0005715
897 Ga0496101_0053030
898 Ga0496102_0005508
899 Ga0496102_0035422
900 Ga0496102_0243665
901 Ga0496102_0639269
902 Ga0496103_0265559
903 Ga0496103_0600020
904 Ga0496104_0332872
905 Ga0496104_0396805
906 Ga0496104_0498979
907 Ga0496104_0559621
908 Ga0496105_0005462
909 Ga0496105_0220561
910 Ga0496106_0053197
911 Ga0496107_0038399
912 Ga0496108_0068417
913 Ga0496108_0267992
914 Ga0496108_0331442
915 Ga0496109_0446621
916 Ga0496110_0026020
917 Ga0496110_0044555
918 Ga0496111_0114695
919 Ga0496111_0131026
920 Ga0496111_0200368
921 Ga0496111_0705975
922 Ga0496112_0043599
923 Ga0496112_0904911
924 Ga0496113_0099411
925 Ga0496113_0132626
926 Ga0496114_0123916
927 Ga0496115_0114743
928 Ga0496117_0090613
929 Ga0496118_0019314
930 Ga0496122_0000688
931 Ga0496122_0064646
932 Ga0496122_0173095
933 Ga0496123_0000314
934 Ga0496123_0077880
935 Ga0496123_0214684
936 Ga0496124_0039875
937 Ga0496124_0119653
938 Ga0496125_0081972
939 Ga0496125_0206662
940 Ga0496125_0750761
941 Ga0501206_016097
942 Ga0501225_0010347
943 nmdc:mga03683_1992_c1
944 nmdc:mga03n38_204035_c1
945 nmdc:mga03n38_439699_c1
946 nmdc:mga00v17_1014678_c1
947 nmdc:mga00v17_363630_c1
948 nmdc:mga0yw44_375176_c1
949 nmdc:mga0k408_101826_c1
950 nmdc:mga0k408_333326_c1
951 nmdc:mga0k408_377245_c1
952 nmdc:mga0k408_940415_c1
953 nmdc:mga06z11_114389_c1
954 nmdc:mga06z11_557972_c1
955 nmdc:mga04h51_150219_c1
956 nmdc:mga07m45_110796_c1
957 nmdc:mga07m45_135754_c1
958 nmdc:mga07m45_45882_c1
959 nmdc:mga05p37_2127583_c1
960 nmdc:mga0n895_1532692_c1
961 nmdc:mga0n895_214406_c1
962 nmdc:mga0n895_470091_c1
963 nmdc:mga0rr50_337035_c1
964 nmdc:mga0rr50_595903_c1
965 nmdc:mga0rr50_601009_c1
966 nmdc:mga08x19_350734_c1
967 nmdc:mga0a205_675157_c1
968 Ga0495601_0099995
969 Ga0500646_0029362
970 Ga0500608_054840
971 Ga0500618_043307
972 Ga0500658_0044912
973 Ga0500559_0013547
974 Ga0500564_035821
975 Ga0500622_0271440
976 Ga0500567_081028
977 Ga0500587_007339
978 Ga0466962_0335901
979 2587754982
980 2599622999
981 2599674646
982 2599680603
983 2599692618
984 2644058529
985 2644070658
986 2819601752
987 2842680378
988 2842736823
989 2842747893
990 2899928694
991 2899930819
992 2904455281
993 2904461314
994 2919467414
995 2928055592
996 2928056297
997 2928069689
998 2928075825
999 2945972417
1000 2954768160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

35

168

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g2j-assembly1.cif.gz_J mouse mitochondrial complex i in the active state 0.498 58 119
7bgn-assembly2.cif.gz_C crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.374 50 126
7nyu-assembly1.cif.gz_K respiratory complex i from escherichia coli - conformation 2 0.3661 58 117
8qhp-assembly1.cif.gz_B cysteine trna ligase homodimer 0.3637 25 124
7qj1-assembly1.cif.gz_l structure of the recombinant human gamma-tubulin ring complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) 0.3571 37 113
ID Description Score Start End Superfamily
af_Q8LPK6_255_358_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7644 65 99 1.10.10.10
af_K7LL22_254_348_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.729 57 100 1.10.10.10
af_K7TUS1_445_604_2.60.40.740 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6852 50 97 2.60.40.740
af_D4A0G9_1_71_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5287 55 114 1.25.40.10
af_Q496H8_42_120_1.10.110.10 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins 0.518 57 125 1.10.110.10
ID Description Score Start End GO Terms
AF-A0A840SKV2-F1-model_v4 DUF1468 domain-containing protein 0.9007 2 124 GO:0016020
AF-A0A433SBB6-F1-model_v4 DUF1468 domain-containing protein 0.8904 2 128 GO:0016020
AF-A0A433SBB6-F1-model_v4 DUF1468 domain-containing protein 0.8777 2 128 GO:0016020
AF-A0A4R6DZF8-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8769 2 128 GO:0016020
AF-A0A1K2HWY7-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8681 2 128 GO:0016020

Map