F455315

General Info

Members Datasets Scaffolds Average Seq Length
499 270 998 156

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100101265|Ga0070689_1001012652
Length 183
Sequence LTDRTHSSTPELVRRIFVENLIHLPNDTDFMREALRLARKAFEHEEVPVGAVVVREGKIIGRAFNQVEVLKDATAHAEMLAITQAEAAVGDWRLNECDLFVTKEPCVMCAGALVNVRMRRVVFGCADERSGGAGGQVNLLQMPALNHQCIIASGVLAEECAELLQSFFRVKRGSRALEEGQKG

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
270 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.8
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 7.62
Rhizosphere 88.98
Stem 0
Stem Tuber 0
Unclassified 11.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100101265 3300005340 Bacteria 2280
2 JGI24749J21850_1009071 3300002076 Bacteria 1390
3 JGI24034J26672_10044245 3300002239 Bacteria 753
4 Ga0065704_10127230 3300005289 Bacteria 1678
5 Ga0065715_10007815 3300005293 Bacteria 3129
6 Ga0070658_10157978 3300005327 Bacteria 1901
7 Ga0070676_10038178 3300005328 Bacteria 2773
8 Ga0070676_10347056 3300005328 Bacteria 1019
9 Ga0070683_100263236 3300005329 Bacteria 1640
10 Ga0070690_100000119 3300005330 Bacteria 40780
11 Ga0070690_100031469 3300005330 Bacteria 3306
12 Ga0068869_100137937 3300005334 Bacteria 1881
13 Ga0070666_10001332 3300005335 Bacteria 14974
14 Ga0070666_10373609 3300005335 Bacteria 1023
15 Ga0070682_100672369 3300005337 Bacteria 827
16 Ga0068868_100720097 3300005338 Unclassified 894
17 Ga0070660_100113861 3300005339 Bacteria 2154
18 Ga0070689_100001660 3300005340 Bacteria 14214
19 Ga0070689_101324647 3300005340 Unclassified 649
20 Ga0070691_10016662 3300005341 Bacteria 3377
21 Ga0070691_10160630 3300005341 Bacteria 1158
22 Ga0070691_10477682 3300005341 Bacteria 716
23 Ga0070691_10646780 3300005341 Bacteria 629
24 Ga0070687_100257826 3300005343 Bacteria 1087
25 Ga0070687_100702700 3300005343 Bacteria 706
26 Ga0070687_100746622 3300005343 Unclassified 688
27 Ga0070661_100158591 3300005344 Bacteria 1713
28 Ga0070668_100040538 3300005347 Bacteria 3563
29 Ga0070668_100192543 3300005347 Unclassified 1671
30 Ga0070669_100032052 3300005353 Bacteria 3796
31 Ga0070675_100017644 3300005354 Bacteria 5676
32 Ga0070675_100026644 3300005354 Bacteria 4640
33 Ga0070675_100246907 3300005354 Bacteria 1561
34 Ga0070671_100023353 3300005355 Bacteria 5061
35 Ga0070674_100026600 3300005356 Bacteria 3782
36 Ga0070674_100051435 3300005356 Bacteria 2839
37 Ga0070673_100006245 3300005364 Bacteria 7726
38 Ga0070673_100014615 3300005364 Bacteria 5477
39 Ga0070673_100220628 3300005364 Bacteria 1641
40 Ga0070667_100000490 3300005367 Bacteria 40202
41 Ga0070667_100198020 3300005367 Bacteria 1782
42 Ga0070667_100488642 3300005367 Bacteria 1128
43 Ga0070709_10057909 3300005434 Bacteria 2456
44 Ga0070714_100001318 3300005435 Bacteria 17935
45 Ga0070714_100007276 3300005435 Bacteria 8603
46 Ga0070714_100051102 3300005435 Bacteria 3523
47 Ga0070714_100114801 3300005435 Bacteria 2389
48 Ga0070714_100373010 3300005435 Bacteria 1344
49 Ga0070710_10079052 3300005437 Unclassified 1915
50 Ga0070711_100033336 3300005439 Unclassified 3429
51 Ga0070705_100008332 3300005440 Bacteria 5133
52 Ga0070705_100043152 3300005440 Bacteria 2583
53 Ga0070705_100139074 3300005440 Bacteria 1596
54 Ga0070700_100123887 3300005441 Bacteria 1735
55 Ga0070700_100829901 3300005441 Bacteria 747
56 Ga0070694_100431367 3300005444 Bacteria 1037
57 Ga0070694_100467108 3300005444 Bacteria 999
58 Ga0070708_100091334 3300005445 Bacteria 2773
59 Ga0070708_100099081 3300005445 Bacteria 2666
60 Ga0070708_100251382 3300005445 Bacteria 1661
61 Ga0070663_100172117 3300005455 Bacteria 1674
62 Ga0070663_100431478 3300005455 Bacteria 1083
63 Ga0070663_101149020 3300005455 Bacteria 680
64 Ga0070678_100112464 3300005456 Bacteria 2132
65 Ga0070678_100205435 3300005456 Bacteria 1628
66 Ga0070662_100140920 3300005457 Bacteria 1868
67 Ga0070662_101697505 3300005457 Bacteria 545
68 Ga0070681_10966415 3300005458 Bacteria 771
69 Ga0068867_100058643 3300005459 Bacteria 2853
70 Ga0070685_10882147 3300005466 Bacteria 665
71 Ga0070706_100036253 3300005467 Bacteria 4555
72 Ga0070706_100038997 3300005467 Bacteria 4385
73 Ga0070706_101413712 3300005467 Unclassified 637
74 Ga0070706_101551550 3300005467 Bacteria 605
75 Ga0070707_100047420 3300005468 Bacteria 4114
76 Ga0070707_100361274 3300005468 Unclassified 1410
77 Ga0070707_100490778 3300005468 Bacteria 1190
78 Ga0070707_101122913 3300005468 Bacteria 752
79 Ga0070698_100335973 3300005471 Bacteria 1442
80 Ga0070699_100141799 3300005518 Bacteria 2123
81 Ga0070699_100812049 3300005518 Unclassified 856
82 Ga0070699_101696241 3300005518 Unclassified 579
83 Ga0070684_100045525 3300005535 Bacteria 3799
84 Ga0070697_100003252 3300005536 Bacteria 12476
85 Ga0070697_100042800 3300005536 Bacteria 3665
86 Ga0070697_100291133 3300005536 Unclassified 1402
87 Ga0070697_100492241 3300005536 Bacteria 1071
88 Ga0070697_100868941 3300005536 Bacteria 799
89 Ga0070697_101360496 3300005536 Bacteria 634
90 Ga0070697_101651113 3300005536 Bacteria 573
91 Ga0070672_100003702 3300005543 Bacteria 9945
92 Ga0070672_100010428 3300005543 Bacteria 6448
93 Ga0070672_100288181 3300005543 Bacteria 1390
94 Ga0070686_100057368 3300005544 Bacteria 2501
95 Ga0070695_100032893 3300005545 Bacteria 3243
96 Ga0070695_100039672 3300005545 Bacteria 2978
97 Ga0070695_100598116 3300005545 Bacteria 865
98 Ga0070696_100083864 3300005546 Bacteria 2261
99 Ga0070696_100224542 3300005546 Bacteria 1410
100 Ga0070696_100234134 3300005546 Unclassified 1383
101 Ga0070696_100539496 3300005546 Bacteria 933
102 Ga0070696_101386870 3300005546 Bacteria 599
103 Ga0070696_101590748 3300005546 Bacteria 561
104 Ga0070693_100457922 3300005547 Bacteria 897
105 Ga0070693_100735409 3300005547 Bacteria 726
106 Ga0070665_100002600 3300005548 Bacteria 19714
107 Ga0070665_100008718 3300005548 Bacteria 10262
108 Ga0070665_100208341 3300005548 Unclassified 1956
109 Ga0070704_100345760 3300005549 Bacteria 1254
110 Ga0070704_101043866 3300005549 Unclassified 741
111 Ga0068855_100063264 3300005563 Bacteria 4318
112 Ga0068855_100166780 3300005563 Unclassified 2496
113 Ga0068855_101544911 3300005563 Bacteria 680
114 Ga0070664_100009395 3300005564 Bacteria 7929
115 Ga0068854_100000023 3300005578 Bacteria 127086
116 Ga0068854_100597526 3300005578 Unclassified 942
117 Ga0068856_100007091 3300005614 Bacteria 10946
118 Ga0068856_100039419 3300005614 Bacteria 4638
119 Ga0068856_100070800 3300005614 Bacteria 3451
120 Ga0068856_100263830 3300005614 Unclassified 1738
121 Ga0068856_100572894 3300005614 Bacteria 1150
122 Ga0070702_100054602 3300005615 Bacteria 2300
123 Ga0070702_100428396 3300005615 Bacteria 954
124 Ga0068852_100026900 3300005616 Bacteria 4682
125 Ga0068859_100000964 3300005617 Bacteria 29430
126 Ga0068859_100681900 3300005617 Bacteria 1119
127 Ga0068864_100176179 3300005618 Bacteria 1953
128 Ga0068864_101103712 3300005618 Bacteria 790
129 Ga0068866_10042871 3300005718 Bacteria 2255
130 Ga0068861_100150174 3300005719 Unclassified 1911
131 Ga0068863_100007465 3300005841 Bacteria 10703
132 Ga0068863_100019526 3300005841 Bacteria 6483
133 Ga0068863_100356389 3300005841 Bacteria 1425
134 Ga0068858_100000488 3300005842 Bacteria 41391
135 Ga0068858_101641942 3300005842 Unclassified 634
136 Ga0068860_100000940 3300005843 Bacteria 32286
137 Ga0068862_100383816 3300005844 Bacteria 1311
138 Ga0081455_10000382 3300005937 Bacteria 58627
139 Ga0081455_10011529 3300005937 Bacteria 8873
140 Ga0081455_10248663 3300005937 Bacteria 1302
141 Ga0081539_10021324 3300005985 Bacteria 4335
142 Ga0070717_10099943 3300006028 Bacteria 2462
143 Ga0070717_10612590 3300006028 Bacteria 988
144 Ga0070717_10622177 3300006028 Bacteria 980
145 Ga0070717_10830553 3300006028 Bacteria 841
146 Ga0070715_10023416 3300006163 Unclassified 2419
147 Ga0070716_100016000 3300006173 Bacteria 3866
148 Ga0070716_100300353 3300006173 Bacteria 1116
149 Ga0070716_100872077 3300006173 Unclassified 702
150 Ga0070712_100056882 3300006175 Bacteria 2745
151 Ga0097621_100082553 3300006237 Bacteria 2676
152 Ga0068871_100144619 3300006358 Bacteria 2023
153 Ga0068871_100515234 3300006358 Bacteria 1079
154 Ga0068871_100856142 3300006358 Bacteria 841
155 Ga0075428_100092271 3300006844 Bacteria 3302
156 Ga0075434_100104380 3300006871 Bacteria 2844
157 Ga0075434_100442126 3300006871 Bacteria 1322
158 Ga0075434_100557053 3300006871 Unclassified 1166
159 Ga0068865_101336745 3300006881 Bacteria 638
160 Ga0075436_100071939 3300006914 Bacteria 2392
161 Ga0075436_100292216 3300006914 Bacteria 1167
162 Ga0075436_100582336 3300006914 Bacteria 823
163 Ga0097620_100000964 3300006931 Bacteria 29430
164 Ga0097620_100681838 3300006931 Bacteria 1119
165 Ga0075435_100025862 3300007076 Bacteria 4574
166 Ga0075435_100610001 3300007076 Bacteria 947
167 Ga0099795_10037157 3300007788 Bacteria 1712
168 Ga0099795_10291164 3300007788 Unclassified 715
169 Ga0111539_10091752 3300009094 Bacteria 3569
170 Ga0105247_10014071 3300009101 Bacteria 4799
171 Ga0105247_10101051 3300009101 Unclassified 1843
172 Ga0105247_10778791 3300009101 Bacteria 728
173 Ga0114129_10021480 3300009147 Bacteria 9162
174 Ga0114129_10031106 3300009147 Bacteria 7549
175 Ga0105243_10796363 3300009148 Bacteria 931
176 Ga0105241_10010036 3300009174 Bacteria 6954
177 Ga0105241_11162692 3300009174 Bacteria 729
178 Ga0105248_10002523 3300009177 Bacteria 20372
179 Ga0105248_12510033 3300009177 Bacteria 587
180 Ga0105237_11683585 3300009545 Unclassified 641
181 Ga0105249_10235314 3300009553 Bacteria 1808
182 Ga0099796_10307711 3300010159 Bacteria 673
183 Ga0105246_10949876 3300011119 Bacteria 775
184 Ga0157313_1033932 3300012503 Bacteria 594
185 Ga0157373_10132781 3300013100 Bacteria 1750
186 Ga0157370_10206869 3300013104 Bacteria 1820
187 Ga0157374_10912078 3300013296 Bacteria 896
188 Ga0157374_11207753 3300013296 Bacteria 778
189 Ga0157374_11221626 3300013296 Unclassified 773
190 Ga0157378_10001366 3300013297 Bacteria 21913
191 Ga0157378_10224921 3300013297 Bacteria 1785
192 Ga0157378_10392227 3300013297 Bacteria 1366
193 Ga0157378_10541568 3300013297 Bacteria 1168
194 Ga0157378_10792408 3300013297 Bacteria 973
195 Ga0157378_11049793 3300013297 Unclassified 850
196 Ga0163162_10028159 3300013306 Bacteria 5557
197 Ga0163162_10414574 3300013306 Bacteria 1479
198 Ga0163162_11521503 3300013306 Bacteria 762
199 Ga0157372_10654104 3300013307 Bacteria 1224
200 Ga0157375_10003244 3300013308 Bacteria 14119
201 Ga0157375_10026874 3300013308 Bacteria 5372
202 Ga0157375_10027741 3300013308 Bacteria 5298
203 Ga0157375_10098756 3300013308 Bacteria 2997
204 Ga0157375_10161808 3300013308 Bacteria 2380
205 Ga0157375_10857171 3300013308 Unclassified 1055
206 Ga0163163_10032961 3300014325 Bacteria 5007
207 Ga0163163_11763920 3300014325 Bacteria 679
208 Ga0163163_12040632 3300014325 Bacteria 633
209 Ga0157380_10093141 3300014326 Bacteria 2491
210 Ga0157377_10969934 3300014745 Bacteria 641
211 Ga0157379_10001125 3300014968 Bacteria 21862
212 Ga0157376_10003367 3300014969 Bacteria 11000
213 Ga0157376_10180738 3300014969 Bacteria 1928
214 Ga0157376_10706519 3300014969 Bacteria 1014
215 Ga0157376_10960947 3300014969 Bacteria 875
216 Ga0163161_10016470 3300017792 Bacteria 5161
217 Ga0206356_10993996 3300020070 Bacteria 1504
218 Ga0213873_10001181 3300021358 Bacteria 4267
219 Ga0213873_10069510 3300021358 Bacteria 968
220 Ga0213873_10094362 3300021358 Bacteria 853
221 Ga0213872_10002647 3300021361 Bacteria 10388
222 Ga0213872_10235831 3300021361 Bacteria 775
223 Ga0213876_10146301 3300021384 Bacteria 1256
224 Ga0213875_10000001 3300021388 Bacteria 2793540
225 Ga0213875_10178041 3300021388 Bacteria 999
226 Ga0213871_10155890 3300021441 Bacteria 697
227 Ga0213871_10204563 3300021441 Unclassified 617
228 Ga0207666_1010253 3300025271 Unclassified 1280
229 Ga0207697_10002586 3300025315 Bacteria 9316
230 Ga0207642_10030200 3300025899 Bacteria 2255
231 Ga0207710_10222607 3300025900 Bacteria 937
232 Ga0207688_10019638 3300025901 Bacteria 3684
233 Ga0207680_10000596 3300025903 Bacteria 17035
234 Ga0207680_10068075 3300025903 Unclassified 2195
235 Ga0207685_10165317 3300025905 Unclassified 1014
236 Ga0207699_10071454 3300025906 Unclassified 2122
237 Ga0207645_10004654 3300025907 Bacteria 10108
238 Ga0207645_10050840 3300025907 Bacteria 2647
239 Ga0207684_10044171 3300025910 Bacteria 3778
240 Ga0207684_10956221 3300025910 Bacteria 718
241 Ga0207654_10010495 3300025911 Bacteria 4718
242 Ga0207707_10719340 3300025912 Bacteria 837
243 Ga0207693_10032949 3300025915 Bacteria 4089
244 Ga0207693_10037131 3300025915 Bacteria 3840
245 Ga0207663_10012466 3300025916 Bacteria 4598
246 Ga0207663_10622668 3300025916 Bacteria 850
247 Ga0207660_10615598 3300025917 Bacteria 885
248 Ga0207662_10323808 3300025918 Bacteria 1029
249 Ga0207657_11037249 3300025919 Bacteria 628
250 Ga0207649_10038783 3300025920 Bacteria 2886
251 Ga0207646_10152775 3300025922 Bacteria 2082
252 Ga0207646_10325621 3300025922 Bacteria 1388
253 Ga0207646_10919554 3300025922 Unclassified 775
254 Ga0207681_10007788 3300025923 Bacteria 6561
255 Ga0207681_10047966 3300025923 Unclassified 2881
256 Ga0207681_10173931 3300025923 Bacteria 1634
257 Ga0207650_10052177 3300025925 Bacteria 3029
258 Ga0207659_10017342 3300025926 Unclassified 4703
259 Ga0207659_10032244 3300025926 Bacteria 3594
260 Ga0207700_10138652 3300025928 Unclassified 1995
261 Ga0207700_10659295 3300025928 Unclassified 933
262 Ga0207664_10009802 3300025929 Bacteria 6741
263 Ga0207664_10013180 3300025929 Bacteria 5923
264 Ga0207664_10330709 3300025929 Bacteria 1346
265 Ga0207664_10509504 3300025929 Bacteria 1078
266 Ga0207644_10047511 3300025931 Bacteria 3063
267 Ga0207706_10004789 3300025933 Bacteria 12675
268 Ga0207706_10030034 3300025933 Bacteria 4851
269 Ga0207686_10028776 3300025934 Bacteria 3270
270 Ga0207709_10434755 3300025935 Bacteria 1011
271 Ga0207670_10001711 3300025936 Bacteria 11458
272 Ga0207670_10344736 3300025936 Bacteria 1178
273 Ga0207669_10009696 3300025937 Bacteria 4602
274 Ga0207669_10967326 3300025937 Bacteria 714
275 Ga0207704_10014922 3300025938 Bacteria 3942
276 Ga0207665_10012878 3300025939 Bacteria 5500
277 Ga0207665_10056651 3300025939 Unclassified 2646
278 Ga0207665_10097523 3300025939 Unclassified 2047
279 Ga0207665_10249104 3300025939 Unclassified 1312
280 Ga0207691_10003893 3300025940 Bacteria 14498
281 Ga0207691_10004738 3300025940 Bacteria 13154
282 Ga0207691_10291721 3300025940 Bacteria 1403
283 Ga0207711_10000467 3300025941 Bacteria 41879
284 Ga0207661_10027479 3300025944 Bacteria 4347
285 Ga0207679_10015072 3300025945 Bacteria 5097
286 Ga0207679_11344654 3300025945 Bacteria 655
287 Ga0207667_10000101 3300025949 Bacteria 137935
288 Ga0207667_10519066 3300025949 Unclassified 1207
289 Ga0207667_11239835 3300025949 Bacteria 724
290 Ga0207651_10263377 3300025960 Unclassified 1416
291 Ga0207651_10279223 3300025960 Bacteria 1379
292 Ga0207668_10237206 3300025972 Unclassified 1473
293 Ga0207640_10000459 3300025981 Bacteria 24875
294 Ga0207640_10353413 3300025981 Bacteria 1181
295 Ga0207658_10004582 3300025986 Bacteria 9595
296 Ga0207658_10174405 3300025986 Bacteria 1774
297 Ga0207658_10234587 3300025986 Bacteria 1551
298 Ga0207703_10001257 3300026035 Bacteria 23718
299 Ga0207639_10585119 3300026041 Bacteria 1028
300 Ga0207678_10006826 3300026067 Bacteria 10123
301 Ga0207678_10253048 3300026067 Bacteria 1509
302 Ga0207678_11165041 3300026067 Bacteria 682
303 Ga0207708_10272909 3300026075 Bacteria 1368
304 Ga0207702_10005609 3300026078 Bacteria 10952
305 Ga0207702_10051192 3300026078 Bacteria 3489
306 Ga0207702_10266862 3300026078 Unclassified 1613
307 Ga0207702_10434161 3300026078 Bacteria 1272
308 Ga0207702_10456924 3300026078 Bacteria 1240
309 Ga0207702_10668504 3300026078 Bacteria 1022
310 Ga0207702_11675119 3300026078 Bacteria 629
311 Ga0207641_10008996 3300026088 Bacteria 8250
312 Ga0207641_10077636 3300026088 Bacteria 2874
313 Ga0207641_11056646 3300026088 Unclassified 810
314 Ga0207648_10024515 3300026089 Bacteria 5383
315 Ga0207648_10484466 3300026089 Unclassified 1130
316 Ga0207676_10172049 3300026095 Bacteria 1888
317 Ga0207674_11373777 3300026116 Bacteria 676
318 Ga0207675_100088077 3300026118 Bacteria 2916
319 Ga0207683_10031820 3300026121 Bacteria 4580
320 Ga0207698_10054356 3300026142 Bacteria 3081
321 Ga0207428_10227081 3300027907 Bacteria 1398
322 Ga0268266_10014238 3300028379 Bacteria 6841
323 Ga0268264_10001279 3300028381 Bacteria 23844
324 Ga0265338_10501353 3300028800 Bacteria 855
325 Ga0265324_10033768 3300029957 Bacteria 1784
326 Ga0265770_1064263 3300030878 Bacteria 688
327 Ga0265765_1002523 3300030879 Bacteria 1779
328 Ga0265330_10172505 3300031235 Bacteria 917
329 Ga0265329_10059298 3300031242 Bacteria 1212
330 Ga0265339_10133123 3300031249 Bacteria 1270
331 Ga0265316_10254263 3300031344 Bacteria 1289
332 Ga0307513_10007605 3300031456 Bacteria 14006
333 Ga0316575_10014156 3300031665 Bacteria 2991
334 Ga0307411_10394936 3300032005 Bacteria 1142
335 Ga0316583_10289397 3300032133 Bacteria 567
336 Ga0316593_10233078 3300032168 Bacteria 686
337 Ga0373956_0013138 3300035119 Bacteria 3443
338 Ga0373957_0151198 3300035120 Bacteria 953
339 Ga0373943_0510678 3300035170 Bacteria 703
340 Ga0373943_0647144 3300035170 Bacteria 624
341 Ga0373955_0062812 3300035172 Bacteria 2055
342 Ga0316574_0118021 3300035398 Bacteria 1702
343 Ga0373931_0066055 3300035691 Bacteria 1962
344 Ga0373931_0176409 3300035691 Bacteria 1263
345 Ga0373927_0653924 3300035695 Bacteria 695
346 Ga0373933_0729376 3300035724 Bacteria 652
347 Ga0373947_0167204 3300035725 Bacteria 1425
348 Ga0373937_0004938 3300036401 Bacteria 11337
349 Ga0316582_0385600 3300036647 Bacteria 965
350 Ga0316584_0238385 3300036712 Bacteria 1332
351 Ga0373925_0287233 3300037068 Bacteria 1326
352 Ga0373925_1247235 3300037068 Bacteria 610
353 Ga0395898_0024990 3300037466 Bacteria 6022
354 Ga0436364_0035043 3300037853 Bacteria 1119
355 Ga0436364_0273345 3300037853 Bacteria 2794207
356 Ga0436364_0286381 3300037853 Bacteria 1103
357 Ga0436364_1311791 3300037853 Bacteria 2614
358 Ga0436364_1377689 3300037853 Bacteria 1097
359 Ga0395901_0038542 3300038443 Bacteria 4944
360 Ga0436365_1923237 3300039437 Bacteria 2139
361 Ga0436360_0106868 3300039438 Bacteria 756
362 Ga0436360_0277498 3300039438 Bacteria 1459
363 Ga0436360_0413812 3300039438 Bacteria 789
364 Ga0436360_0773208 3300039438 Bacteria 1728
365 Ga0436360_0988460 3300039438 Bacteria 692
366 Ga0436360_1001226 3300039438 Bacteria 998
367 Ga0436360_1179091 3300039438 Bacteria 1085
368 Ga0436360_1189221 3300039438 Bacteria 855
369 Ga0436360_1220737 3300039438 Bacteria 505
370 Ga0436361_0092742 3300039447 Bacteria 1172
371 Ga0436361_0281189 3300039447 Bacteria 888
372 Ga0436361_0548111 3300039447 Bacteria 49647
373 Ga0436361_0686581 3300039447 Bacteria 65096
374 Ga0436361_0835610 3300039447 Bacteria 1397
375 Ga0436361_0993464 3300039447 Bacteria 1734
376 Ga0436363_0655149 3300039450 Bacteria 1138
377 Ga0436363_0723866 3300039450 Bacteria 42191
378 Ga0436363_1696426 3300039450 Bacteria 898
379 Ga0436362_0225652 3300039453 Bacteria 12297
380 Ga0436362_0428450 3300039453 Bacteria 7245
381 Ga0436362_0578453 3300039453 Bacteria 782
382 Ga0436362_0751165 3300039453 Bacteria 744
383 Ga0436362_0951292 3300039453 Bacteria 719
384 Ga0436362_1004198 3300039453 Bacteria 2721
385 Ga0436362_1043395 3300039453 Bacteria 2314
386 Ga0439448_0078385 3300042005 Bacteria 1107
387 Ga0451577_0004543 3300042876 Bacteria 14601
388 Ga0451577_0344112 3300042876 Bacteria 1353
389 Ga0466969_0299581 3300044656 Bacteria 728
390 Ga0453683_0410619 3300044673 Unclassified 873
391 Ga0466965_0057269 3300044683 Bacteria 1942
392 Ga0466966_0065971 3300044684 Bacteria 2275
393 Ga0466966_0234331 3300044684 Bacteria 1107
394 Ga0466961_0767631 3300044693 Bacteria 576
395 Ga0466963_0007159 3300044694 Bacteria 6649
396 Ga0466963_0214770 3300044694 Bacteria 1346
397 Ga0453684_0248878 3300044712 Bacteria 2042
398 Ga0466968_0005297 3300044735 Bacteria 4830
399 Ga0466968_0063841 3300044735 Bacteria 1592
400 Ga0466968_0378549 3300044735 Bacteria 691
401 Ga0466957_0027880 3300044842 Bacteria 3358
402 Ga0466957_0034068 3300044842 Bacteria 3055
403 Ga0466959_0049207 3300045049 Bacteria 3096
404 Ga0466959_0806746 3300045049 Unclassified 627
405 Ga0466959_0840548 3300045049 Bacteria 613
406 Ga0451576_0058775 3300045051 Bacteria 4016
407 Ga0466958_0014783 3300045836 Bacteria 4460
408 Ga0466958_0026959 3300045836 Bacteria 3397
409 Ga0466958_0486800 3300045836 Bacteria 800
410 Ga0466967_0020538 3300045976 Bacteria 5343
411 Ga0466967_0044140 3300045976 Bacteria 3864
412 Ga0466967_0225154 3300045976 Bacteria 1784
413 Ga0466967_1015417 3300045976 Bacteria 826
414 Ga0495651_0545584 3300046462 Bacteria 737
415 Ga0495580_0116780 3300046472 Bacteria 1853
416 Ga0495580_0195546 3300046472 Bacteria 1394
417 Ga0495582_0169292 3300046473 Bacteria 1243
418 Ga0495662_0147022 3300046476 Bacteria 1161
419 Ga0495594_0277595 3300046499 Bacteria 955
420 Ga0495608_0204768 3300046511 Bacteria 1242
421 Ga0495640_0027623 3300046533 Bacteria 4091
422 Ga0495587_0500222 3300046536 Bacteria 672
423 Ga0495598_0052398 3300046537 Bacteria 1233
424 Ga0495645_0000225 3300046543 Bacteria 40682
425 Ga0495622_0110115 3300046557 Bacteria 1261
426 Ga0495667_0825268 3300046559 Bacteria 571
427 Ga0495657_0540857 3300046675 Bacteria 677
428 Ga0495647_0054617 3300046681 Bacteria 1561
429 Ga0495658_0224295 3300046683 Bacteria 1177
430 Ga0495658_0502728 3300046683 Bacteria 775
431 Ga0495600_0020271 3300046809 Bacteria 4253
432 Ga0495581_0050305 3300047315 Bacteria 2407
433 Ga0495675_0042105 3300047444 Bacteria 2909
434 Ga0495684_0044390 3300047471 Bacteria 3403
435 Ga0496100_0007712 3300048903 Bacteria 5958
436 Ga0496100_0008584 3300048903 Bacteria 5703
437 Ga0496100_0193480 3300048903 Bacteria 1478
438 Ga0496101_0004740 3300048904 Bacteria 8621
439 Ga0496101_0007624 3300048904 Bacteria 7027
440 Ga0496101_0707411 3300048904 Bacteria 795
441 Ga0496102_0004233 3300048905 Bacteria 12132
442 Ga0496102_0015196 3300048905 Bacteria 6701
443 Ga0496102_0026273 3300048905 Bacteria 5191
444 Ga0496102_0110392 3300048905 Bacteria 2563
445 Ga0496102_0504017 3300048905 Bacteria 1133
446 Ga0496103_0063381 3300048906 Bacteria 2302
447 Ga0496103_0080435 3300048906 Bacteria 2049
448 Ga0496103_0540297 3300048906 Unclassified 744
449 Ga0496104_0032108 3300048907 Bacteria 4887
450 Ga0496104_0036550 3300048907 Bacteria 4592
451 Ga0496104_0142319 3300048907 Bacteria 2304
452 Ga0496105_0384641 3300048908 Unclassified 1116
453 Ga0496105_0412515 3300048908 Bacteria 1070
454 Ga0496106_0005019 3300048909 Bacteria 9791
455 Ga0496106_0005439 3300048909 Bacteria 9424
456 Ga0496107_0001356 3300048910 Bacteria 15061
457 Ga0496107_0007955 3300048910 Bacteria 7316
458 Ga0496108_0005929 3300048911 Bacteria 9901
459 Ga0496108_0226797 3300048911 Unclassified 1624
460 Ga0496108_0393003 3300048911 Bacteria 1211
461 Ga0496109_0019044 3300048912 Bacteria 6046
462 Ga0496110_0023460 3300048913 Bacteria 5248
463 Ga0496110_0184302 3300048913 Bacteria 1895
464 Ga0496110_0480782 3300048913 Unclassified 1131
465 Ga0496111_0011636 3300048914 Bacteria 5936
466 Ga0496111_0257243 3300048914 Bacteria 1295
467 Ga0496112_0705559 3300048915 Bacteria 937
468 Ga0496113_0034463 3300048916 Bacteria 3694
469 Ga0496113_0245327 3300048916 Bacteria 1429
470 Ga0496113_0964349 3300048916 Bacteria 673
471 Ga0496114_0051220 3300048917 Bacteria 3437
472 Ga0496115_0034234 3300048918 Bacteria 4014
473 Ga0496125_0335516 3300048928 Unclassified 910
474 Ga0501067_0063868 3300049583 Bacteria 2039
475 Ga0501069_0135868 3300049585 Bacteria 1409
476 Ga0501076_1732285 3300049592 Bacteria 512
477 nmdc:mga05p37_14812_c1 3300050507 Bacteria 9362
478 nmdc:mga05p37_40321_c1 3300050507 Bacteria 5733
479 nmdc:mga06r32_486457_c1 3300050510 Bacteria 1212
480 nmdc:mga08y16_373252_c1 3300050511 Bacteria 1463
481 nmdc:mga0n895_24385_c1 3300050512 Bacteria 5701
482 nmdc:mga0n895_366483_c1 3300050512 Bacteria 1459
483 nmdc:mga0n895_83449_c1 3300050512 Bacteria 3187
484 nmdc:mga0rr50_1434036_c1 3300050513 Bacteria 584
485 nmdc:mga0rr50_9268_c1 3300050513 Bacteria 6180
486 nmdc:mga0rr50_96293_c1 3300050513 Bacteria 2315
487 nmdc:mga08x19_18355_c1 3300050514 Bacteria 4287
488 nmdc:mga08x19_63603_c1 3300050514 Bacteria 2394
489 nmdc:mga0a205_3383_c1 3300050515 Bacteria 14216
490 Ga0495601_0018467 3300053077 Bacteria 4246
491 Ga0495595_0005508 3300053084 Bacteria 5129
492 Ga0500556_0011881 3300053104 Bacteria 2589
493 Ga0500645_045064 3300053730 Bacteria 1296
494 Ga0501082_1409832 3300060353 Bacteria 608
495 Ga0466962_0145190 3300061719 Bacteria 1150
496 Ga0466962_0604220 3300061719 Unclassified 559
497 Ga0530510_0438395 3300061734 Bacteria 987
498 2919453772 2919450847 Bacteria 5631160
499 8001846722 8001845381 Bacteria 5804942
500 Ga0070689_100101265
501 JGI24749J21850_1009071
502 JGI24034J26672_10044245
503 Ga0065704_10127230
504 Ga0065715_10007815
505 Ga0070658_10157978
506 Ga0070676_10038178
507 Ga0070676_10347056
508 Ga0070683_100263236
509 Ga0070690_100000119
510 Ga0070690_100031469
511 Ga0068869_100137937
512 Ga0070666_10001332
513 Ga0070666_10373609
514 Ga0070682_100672369
515 Ga0068868_100720097
516 Ga0070660_100113861
517 Ga0070689_100001660
518 Ga0070689_101324647
519 Ga0070691_10016662
520 Ga0070691_10160630
521 Ga0070691_10477682
522 Ga0070691_10646780
523 Ga0070687_100257826
524 Ga0070687_100702700
525 Ga0070687_100746622
526 Ga0070661_100158591
527 Ga0070668_100040538
528 Ga0070668_100192543
529 Ga0070669_100032052
530 Ga0070675_100017644
531 Ga0070675_100026644
532 Ga0070675_100246907
533 Ga0070671_100023353
534 Ga0070674_100026600
535 Ga0070674_100051435
536 Ga0070673_100006245
537 Ga0070673_100014615
538 Ga0070673_100220628
539 Ga0070667_100000490
540 Ga0070667_100198020
541 Ga0070667_100488642
542 Ga0070709_10057909
543 Ga0070714_100001318
544 Ga0070714_100007276
545 Ga0070714_100051102
546 Ga0070714_100114801
547 Ga0070714_100373010
548 Ga0070710_10079052
549 Ga0070711_100033336
550 Ga0070705_100008332
551 Ga0070705_100043152
552 Ga0070705_100139074
553 Ga0070700_100123887
554 Ga0070700_100829901
555 Ga0070694_100431367
556 Ga0070694_100467108
557 Ga0070708_100091334
558 Ga0070708_100099081
559 Ga0070708_100251382
560 Ga0070663_100172117
561 Ga0070663_100431478
562 Ga0070663_101149020
563 Ga0070678_100112464
564 Ga0070678_100205435
565 Ga0070662_100140920
566 Ga0070662_101697505
567 Ga0070681_10966415
568 Ga0068867_100058643
569 Ga0070685_10882147
570 Ga0070706_100036253
571 Ga0070706_100038997
572 Ga0070706_101413712
573 Ga0070706_101551550
574 Ga0070707_100047420
575 Ga0070707_100361274
576 Ga0070707_100490778
577 Ga0070707_101122913
578 Ga0070698_100335973
579 Ga0070699_100141799
580 Ga0070699_100812049
581 Ga0070699_101696241
582 Ga0070684_100045525
583 Ga0070697_100003252
584 Ga0070697_100042800
585 Ga0070697_100291133
586 Ga0070697_100492241
587 Ga0070697_100868941
588 Ga0070697_101360496
589 Ga0070697_101651113
590 Ga0070672_100003702
591 Ga0070672_100010428
592 Ga0070672_100288181
593 Ga0070686_100057368
594 Ga0070695_100032893
595 Ga0070695_100039672
596 Ga0070695_100598116
597 Ga0070696_100083864
598 Ga0070696_100224542
599 Ga0070696_100234134
600 Ga0070696_100539496
601 Ga0070696_101386870
602 Ga0070696_101590748
603 Ga0070693_100457922
604 Ga0070693_100735409
605 Ga0070665_100002600
606 Ga0070665_100008718
607 Ga0070665_100208341
608 Ga0070704_100345760
609 Ga0070704_101043866
610 Ga0068855_100063264
611 Ga0068855_100166780
612 Ga0068855_101544911
613 Ga0070664_100009395
614 Ga0068854_100000023
615 Ga0068854_100597526
616 Ga0068856_100007091
617 Ga0068856_100039419
618 Ga0068856_100070800
619 Ga0068856_100263830
620 Ga0068856_100572894
621 Ga0070702_100054602
622 Ga0070702_100428396
623 Ga0068852_100026900
624 Ga0068859_100000964
625 Ga0068859_100681900
626 Ga0068864_100176179
627 Ga0068864_101103712
628 Ga0068866_10042871
629 Ga0068861_100150174
630 Ga0068863_100007465
631 Ga0068863_100019526
632 Ga0068863_100356389
633 Ga0068858_100000488
634 Ga0068858_101641942
635 Ga0068860_100000940
636 Ga0068862_100383816
637 Ga0081455_10000382
638 Ga0081455_10011529
639 Ga0081455_10248663
640 Ga0081539_10021324
641 Ga0070717_10099943
642 Ga0070717_10612590
643 Ga0070717_10622177
644 Ga0070717_10830553
645 Ga0070715_10023416
646 Ga0070716_100016000
647 Ga0070716_100300353
648 Ga0070716_100872077
649 Ga0070712_100056882
650 Ga0097621_100082553
651 Ga0068871_100144619
652 Ga0068871_100515234
653 Ga0068871_100856142
654 Ga0075428_100092271
655 Ga0075434_100104380
656 Ga0075434_100442126
657 Ga0075434_100557053
658 Ga0068865_101336745
659 Ga0075436_100071939
660 Ga0075436_100292216
661 Ga0075436_100582336
662 Ga0097620_100000964
663 Ga0097620_100681838
664 Ga0075435_100025862
665 Ga0075435_100610001
666 Ga0099795_10037157
667 Ga0099795_10291164
668 Ga0111539_10091752
669 Ga0105247_10014071
670 Ga0105247_10101051
671 Ga0105247_10778791
672 Ga0114129_10021480
673 Ga0114129_10031106
674 Ga0105243_10796363
675 Ga0105241_10010036
676 Ga0105241_11162692
677 Ga0105248_10002523
678 Ga0105248_12510033
679 Ga0105237_11683585
680 Ga0105249_10235314
681 Ga0099796_10307711
682 Ga0105246_10949876
683 Ga0157313_1033932
684 Ga0157373_10132781
685 Ga0157370_10206869
686 Ga0157374_10912078
687 Ga0157374_11207753
688 Ga0157374_11221626
689 Ga0157378_10001366
690 Ga0157378_10224921
691 Ga0157378_10392227
692 Ga0157378_10541568
693 Ga0157378_10792408
694 Ga0157378_11049793
695 Ga0163162_10028159
696 Ga0163162_10414574
697 Ga0163162_11521503
698 Ga0157372_10654104
699 Ga0157375_10003244
700 Ga0157375_10026874
701 Ga0157375_10027741
702 Ga0157375_10098756
703 Ga0157375_10161808
704 Ga0157375_10857171
705 Ga0163163_10032961
706 Ga0163163_11763920
707 Ga0163163_12040632
708 Ga0157380_10093141
709 Ga0157377_10969934
710 Ga0157379_10001125
711 Ga0157376_10003367
712 Ga0157376_10180738
713 Ga0157376_10706519
714 Ga0157376_10960947
715 Ga0163161_10016470
716 Ga0206356_10993996
717 Ga0213873_10001181
718 Ga0213873_10069510
719 Ga0213873_10094362
720 Ga0213872_10002647
721 Ga0213872_10235831
722 Ga0213876_10146301
723 Ga0213875_10000001
724 Ga0213875_10178041
725 Ga0213871_10155890
726 Ga0213871_10204563
727 Ga0207666_1010253
728 Ga0207697_10002586
729 Ga0207642_10030200
730 Ga0207710_10222607
731 Ga0207688_10019638
732 Ga0207680_10000596
733 Ga0207680_10068075
734 Ga0207685_10165317
735 Ga0207699_10071454
736 Ga0207645_10004654
737 Ga0207645_10050840
738 Ga0207684_10044171
739 Ga0207684_10956221
740 Ga0207654_10010495
741 Ga0207707_10719340
742 Ga0207693_10032949
743 Ga0207693_10037131
744 Ga0207663_10012466
745 Ga0207663_10622668
746 Ga0207660_10615598
747 Ga0207662_10323808
748 Ga0207657_11037249
749 Ga0207649_10038783
750 Ga0207646_10152775
751 Ga0207646_10325621
752 Ga0207646_10919554
753 Ga0207681_10007788
754 Ga0207681_10047966
755 Ga0207681_10173931
756 Ga0207650_10052177
757 Ga0207659_10017342
758 Ga0207659_10032244
759 Ga0207700_10138652
760 Ga0207700_10659295
761 Ga0207664_10009802
762 Ga0207664_10013180
763 Ga0207664_10330709
764 Ga0207664_10509504
765 Ga0207644_10047511
766 Ga0207706_10004789
767 Ga0207706_10030034
768 Ga0207686_10028776
769 Ga0207709_10434755
770 Ga0207670_10001711
771 Ga0207670_10344736
772 Ga0207669_10009696
773 Ga0207669_10967326
774 Ga0207704_10014922
775 Ga0207665_10012878
776 Ga0207665_10056651
777 Ga0207665_10097523
778 Ga0207665_10249104
779 Ga0207691_10003893
780 Ga0207691_10004738
781 Ga0207691_10291721
782 Ga0207711_10000467
783 Ga0207661_10027479
784 Ga0207679_10015072
785 Ga0207679_11344654
786 Ga0207667_10000101
787 Ga0207667_10519066
788 Ga0207667_11239835
789 Ga0207651_10263377
790 Ga0207651_10279223
791 Ga0207668_10237206
792 Ga0207640_10000459
793 Ga0207640_10353413
794 Ga0207658_10004582
795 Ga0207658_10174405
796 Ga0207658_10234587
797 Ga0207703_10001257
798 Ga0207639_10585119
799 Ga0207678_10006826
800 Ga0207678_10253048
801 Ga0207678_11165041
802 Ga0207708_10272909
803 Ga0207702_10005609
804 Ga0207702_10051192
805 Ga0207702_10266862
806 Ga0207702_10434161
807 Ga0207702_10456924
808 Ga0207702_10668504
809 Ga0207702_11675119
810 Ga0207641_10008996
811 Ga0207641_10077636
812 Ga0207641_11056646
813 Ga0207648_10024515
814 Ga0207648_10484466
815 Ga0207676_10172049
816 Ga0207674_11373777
817 Ga0207675_100088077
818 Ga0207683_10031820
819 Ga0207698_10054356
820 Ga0207428_10227081
821 Ga0268266_10014238
822 Ga0268264_10001279
823 Ga0265338_10501353
824 Ga0265324_10033768
825 Ga0265770_1064263
826 Ga0265765_1002523
827 Ga0265330_10172505
828 Ga0265329_10059298
829 Ga0265339_10133123
830 Ga0265316_10254263
831 Ga0307513_10007605
832 Ga0316575_10014156
833 Ga0307411_10394936
834 Ga0316583_10289397
835 Ga0316593_10233078
836 Ga0373956_0013138
837 Ga0373957_0151198
838 Ga0373943_0510678
839 Ga0373943_0647144
840 Ga0373955_0062812
841 Ga0316574_0118021
842 Ga0373931_0066055
843 Ga0373931_0176409
844 Ga0373927_0653924
845 Ga0373933_0729376
846 Ga0373947_0167204
847 Ga0373937_0004938
848 Ga0316582_0385600
849 Ga0316584_0238385
850 Ga0373925_0287233
851 Ga0373925_1247235
852 Ga0395898_0024990
853 Ga0436364_0035043
854 Ga0436364_0273345
855 Ga0436364_0286381
856 Ga0436364_1311791
857 Ga0436364_1377689
858 Ga0395901_0038542
859 Ga0436365_1923237
860 Ga0436360_0106868
861 Ga0436360_0277498
862 Ga0436360_0413812
863 Ga0436360_0773208
864 Ga0436360_0988460
865 Ga0436360_1001226
866 Ga0436360_1179091
867 Ga0436360_1189221
868 Ga0436360_1220737
869 Ga0436361_0092742
870 Ga0436361_0281189
871 Ga0436361_0548111
872 Ga0436361_0686581
873 Ga0436361_0835610
874 Ga0436361_0993464
875 Ga0436363_0655149
876 Ga0436363_0723866
877 Ga0436363_1696426
878 Ga0436362_0225652
879 Ga0436362_0428450
880 Ga0436362_0578453
881 Ga0436362_0751165
882 Ga0436362_0951292
883 Ga0436362_1004198
884 Ga0436362_1043395
885 Ga0439448_0078385
886 Ga0451577_0004543
887 Ga0451577_0344112
888 Ga0466969_0299581
889 Ga0453683_0410619
890 Ga0466965_0057269
891 Ga0466966_0065971
892 Ga0466966_0234331
893 Ga0466961_0767631
894 Ga0466963_0007159
895 Ga0466963_0214770
896 Ga0453684_0248878
897 Ga0466968_0005297
898 Ga0466968_0063841
899 Ga0466968_0378549
900 Ga0466957_0027880
901 Ga0466957_0034068
902 Ga0466959_0049207
903 Ga0466959_0806746
904 Ga0466959_0840548
905 Ga0451576_0058775
906 Ga0466958_0014783
907 Ga0466958_0026959
908 Ga0466958_0486800
909 Ga0466967_0020538
910 Ga0466967_0044140
911 Ga0466967_0225154
912 Ga0466967_1015417
913 Ga0495651_0545584
914 Ga0495580_0116780
915 Ga0495580_0195546
916 Ga0495582_0169292
917 Ga0495662_0147022
918 Ga0495594_0277595
919 Ga0495608_0204768
920 Ga0495640_0027623
921 Ga0495587_0500222
922 Ga0495598_0052398
923 Ga0495645_0000225
924 Ga0495622_0110115
925 Ga0495667_0825268
926 Ga0495657_0540857
927 Ga0495647_0054617
928 Ga0495658_0224295
929 Ga0495658_0502728
930 Ga0495600_0020271
931 Ga0495581_0050305
932 Ga0495675_0042105
933 Ga0495684_0044390
934 Ga0496100_0007712
935 Ga0496100_0008584
936 Ga0496100_0193480
937 Ga0496101_0004740
938 Ga0496101_0007624
939 Ga0496101_0707411
940 Ga0496102_0004233
941 Ga0496102_0015196
942 Ga0496102_0026273
943 Ga0496102_0110392
944 Ga0496102_0504017
945 Ga0496103_0063381
946 Ga0496103_0080435
947 Ga0496103_0540297
948 Ga0496104_0032108
949 Ga0496104_0036550
950 Ga0496104_0142319
951 Ga0496105_0384641
952 Ga0496105_0412515
953 Ga0496106_0005019
954 Ga0496106_0005439
955 Ga0496107_0001356
956 Ga0496107_0007955
957 Ga0496108_0005929
958 Ga0496108_0226797
959 Ga0496108_0393003
960 Ga0496109_0019044
961 Ga0496110_0023460
962 Ga0496110_0184302
963 Ga0496110_0480782
964 Ga0496111_0011636
965 Ga0496111_0257243
966 Ga0496112_0705559
967 Ga0496113_0034463
968 Ga0496113_0245327
969 Ga0496113_0964349
970 Ga0496114_0051220
971 Ga0496115_0034234
972 Ga0496125_0335516
973 Ga0501067_0063868
974 Ga0501069_0135868
975 Ga0501076_1732285
976 nmdc:mga05p37_14812_c1
977 nmdc:mga05p37_40321_c1
978 nmdc:mga06r32_486457_c1
979 nmdc:mga08y16_373252_c1
980 nmdc:mga0n895_24385_c1
981 nmdc:mga0n895_366483_c1
982 nmdc:mga0n895_83449_c1
983 nmdc:mga0rr50_1434036_c1
984 nmdc:mga0rr50_9268_c1
985 nmdc:mga0rr50_96293_c1
986 nmdc:mga08x19_18355_c1
987 nmdc:mga08x19_63603_c1
988 nmdc:mga0a205_3383_c1
989 Ga0495601_0018467
990 Ga0495595_0005508
991 Ga0500556_0011881
992 Ga0500645_045064
993 Ga0501082_1409832
994 Ga0466962_0145190
995 Ga0466962_0604220
996 Ga0530510_0438395
997 2919453772
998 8001846722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

25

172

0.98

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

24

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9951 7 152
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9928 8 149
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.9849 3 152
6vpc-assembly1.cif.gz_E structure of the spcas9 dna adenine base editor - abe8e 0.9789 8 147
8e2p-assembly2.cif.gz_D crystal structure of tada*8.20 in a complex with ssdna 0.9721 3 149
ID Description Score Start End Superfamily
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9953 4 152 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9868 8 152 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9757 4 152 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9708 1 152 3.40.140.10
af_Q95Y87_1_153_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9679 9 106 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A6I1ZQT5-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.002 7 152 GO:0002100
GO:0008270
GO:0052717
AF-A0A382KHQ2-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 1.002 12 145 GO:0002100
GO:0008270
GO:0052717
AF-A0A7Z9N986-F1-model_v4 deleted 1.001 12 152
AF-A0A382IX97-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 1.001 12 152 GO:0002100
GO:0008270
GO:0052717
AF-A0A1H3NF70-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 1.001 12 152 GO:0002100
GO:0008270
GO:0052717

Map