F455270

General Info

Members Datasets Scaffolds Average Seq Length
498 321 451 320

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0001967|Ga0496123_0001967_23085_24038
Length 307
Sequence MRVLLTGSSGWLGRFLAPRLRAAGHTVIGLDVAPGADTDIVGSVADRATVDRAFARGVDAVIHAGALHKPDIARYPAQAFVDVNVTGTLNLLEAAAAARHDRFVFTSTTSLMISEAIRSEAGSQAIWLDETSGPLLPRNIYGVTKLAAEGLCRIHAQQHGLNCVVLRTGRFFPEEDDTHRTPSGENLKANELLSRRLTVEDAADAHVVALDRAPAIGFGIYILAAPTPFARDDVAALKRDAASVLYARRGWTLPASIGRVYDATLAERELGFRCATGFADVLAALRAGRDPPVAHDPSYVPPKEQRR

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
9 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
10 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
11 2643221556 Massilia sp. Root1485 Isolate Unclassified
12 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
16 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
17 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
18 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
19 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
20 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
21 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
24 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
25 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
29 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
30 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
31 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
32 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
33 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
34 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
35 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
36 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
37 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
38 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
43 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
243 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
308 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
309 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
310 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
311 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
312 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
313 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
317 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
318 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
319 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
320 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
321 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.11
Metatranscriptomes 0
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.07
Nodule 4.82
Rhizoplane 2.61
Rhizosphere 60.84
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002303 3300001915 Bacteria 5020
2 JGI24740J21852_10003974 3300001979 Bacteria 6419
3 JGI24737J22298_10016381 3300001990 Bacteria 2393
4 JGI24749J21850_1001461 3300002076 Bacteria 3336
5 JGI24751J29686_10000357 3300002459 Bacteria 15936
6 JGI25153J46596_10013111 3300003215 Bacteria 3524
7 rootH1_10130120 3300003316 Bacteria 2794
8 rootH2_10014115 3300003320 Bacteria 2993
9 rootH1_10283578 3300003323 Bacteria 2608
10 Ga0055525_1000186 3300003759 Bacteria 75686
11 Ga0055526_1033145 3300003771 Bacteria 1440
12 Ga0055537_1001019 3300003773 Bacteria 12668
13 Ga0055537_1006876 3300003773 Bacteria 2820
14 Ga0055524_1000539 3300003775 Bacteria 28724
15 Ga0055536_1009630 3300003781 Bacteria 3959
16 Ga0055530_10003402 3300003791 Bacteria 9077
17 Ga0055530_10007609 3300003791 Bacteria 4526
18 Ga0055540_1006750 3300003792 Bacteria 4488
19 Ga0055531_10003730 3300003794 Bacteria 9574
20 Ga0055531_10004059 3300003794 Bacteria 9077
21 Ga0055543_1011995 3300004625 Bacteria 1755
22 Ga0065165_1003679 3300005262 Bacteria 10426
23 Ga0065165_1005379 3300005262 Bacteria 7235
24 Ga0065165_1037227 3300005262 Bacteria 1476
25 Ga0065707_10093872 3300005295 Bacteria 3569
26 Ga0070670_100000178 3300005331 Bacteria 57676
27 Ga0070660_100102256 3300005339 Bacteria 2271
28 Ga0070661_100143793 3300005344 Bacteria 1799
29 Ga0070669_100000119 3300005353 Bacteria 73001
30 Ga0070675_100242562 3300005354 Bacteria 1575
31 Ga0070674_100024610 3300005356 Bacteria 3910
32 Ga0070674_100106425 3300005356 Bacteria 2052
33 Ga0070673_100184294 3300005364 Bacteria 1789
34 Ga0070667_100000088 3300005367 Bacteria 113956
35 Ga0070667_100000407 3300005367 Bacteria 46001
36 Ga0070667_100202315 3300005367 Bacteria 1762
37 Ga0070678_100017439 3300005456 Bacteria 4624
38 Ga0070662_100185244 3300005457 Bacteria 1643
39 Ga0068853_100023854 3300005539 Bacteria 5126
40 Ga0070665_100000323 3300005548 Bacteria 73605
41 Ga0070664_100028482 3300005564 Bacteria 4647
42 Ga0068857_100347931 3300005577 Bacteria 1372
43 Ga0068859_100008045 3300005617 Bacteria 10690
44 Ga0068864_100000183 3300005618 Bacteria 57684
45 Ga0068861_100000001 3300005719 Bacteria 116118
46 Ga0068861_100001052 3300005719 Bacteria 16975
47 Ga0068851_10053336 3300005834 Bacteria 2058
48 Ga0068858_100000327 3300005842 Bacteria 50180
49 Ga0068860_100000055 3300005843 Bacteria 203538
50 Ga0068860_100000220 3300005843 Bacteria 89460
51 Ga0068862_100000011 3300005844 Bacteria 270105
52 Ga0068862_100010652 3300005844 Bacteria 7596
53 Ga0081540_1066166 3300005983 Bacteria 1695
54 Ga0081539_10011418 3300005985 Bacteria 7021
55 Ga0075368_10000016 3300006042 Bacteria 42234
56 Ga0075364_10000807 3300006051 Bacteria 16518
57 Ga0070712_100145779 3300006175 Bacteria 1812
58 Ga0075367_10000154 3300006178 Bacteria 21481
59 Ga0075369_10003090 3300006186 Bacteria 6029
60 Ga0075366_10023439 3300006195 Bacteria 3595
61 Ga0075370_10011024 3300006353 Bacteria 4740
62 Ga0097620_100008045 3300006931 Bacteria 10690
63 Ga0099822_1020871 3300006943 Bacteria 6426
64 Ga0105240_10617028 3300009093 Unclassified 1192
65 Ga0105247_10012729 3300009101 Bacteria 5049
66 Ga0105243_10000033 3300009148 Bacteria 180464
67 Ga0105243_10188381 3300009148 Bacteria 1800
68 Ga0105241_10001031 3300009174 Bacteria 21221
69 Ga0105248_10000685 3300009177 Bacteria 38290
70 Ga0105248_10000998 3300009177 Bacteria 31278
71 Ga0105248_10001758 3300009177 Bacteria 24108
72 Ga0105248_10002949 3300009177 Bacteria 18868
73 Ga0105248_10311368 3300009177 Unclassified 1773
74 Ga0105237_10472577 3300009545 Unclassified 1260
75 Ga0105239_10065247 3300010375 Bacteria 3998
76 Ga0105239_10259055 3300010375 Bacteria 1954
77 Ga0157326_1002414 3300012513 Bacteria 2000
78 Ga0157371_10000059 3300013102 Bacteria 170541
79 Ga0157370_10105124 3300013104 Bacteria 2643
80 Ga0157374_10184987 3300013296 Bacteria 2037
81 Ga0157378_10045746 3300013297 Bacteria 3890
82 Ga0163162_10013938 3300013306 Bacteria 7854
83 Ga0157372_10191971 3300013307 Bacteria 2365
84 Ga0163163_10011516 3300014325 Bacteria 8031
85 Ga0157380_10000087 3300014326 Bacteria 50956
86 Ga0163161_10030181 3300017792 Bacteria 3856
87 Ga0163161_10052945 3300017792 Bacteria 2942
88 Ga0213872_10000321 3300021361 Bacteria 40934
89 Ga0213872_10002552 3300021361 Bacteria 10608
90 Ga0213872_10036518 3300021361 Bacteria 2245
91 Ga0213876_10001077 3300021384 Bacteria 17543
92 Ga0209674_108949 3300025226 Bacteria 1148
93 Ga0209563_100145 3300025230 Bacteria 75938
94 Ga0209646_1002642 3300025246 Bacteria 3848
95 Ga0209565_1000008 3300025263 Bacteria 774179
96 Ga0209565_1000134 3300025263 Bacteria 104013
97 Ga0209673_1001779 3300025273 Bacteria 17881
98 Ga0209673_1007209 3300025273 Bacteria 5180
99 Ga0209675_1005513 3300025291 Bacteria 5283
100 Ga0209676_1003684 3300025292 Bacteria 9169
101 Ga0209564_1000622 3300025295 Bacteria 53970
102 Ga0209758_1000001 3300025297 Bacteria 1981790
103 Ga0209758_1038954 3300025297 Bacteria 1815
104 Ga0209050_1000001 3300025298 Bacteria 3563507
105 Ga0209050_1000581 3300025298 Bacteria 59224
106 Ga0209050_1012997 3300025298 Bacteria 3756
107 Ga0209050_1016987 3300025298 Bacteria 2936
108 Ga0209050_1017353 3300025298 Bacteria 2877
109 Ga0209256_1000009 3300025299 Bacteria 922071
110 Ga0209256_1000010 3300025299 Bacteria 912110
111 Ga0209051_1000191 3300025303 Bacteria 108763
112 Ga0209257_1000577 3300025304 Bacteria 61710
113 Ga0209257_1000597 3300025304 Bacteria 59900
114 Ga0209257_1000876 3300025304 Bacteria 42634
115 Ga0209257_1005749 3300025304 Bacteria 8479
116 Ga0209257_1015960 3300025304 Bacteria 3074
117 Ga0209257_1019098 3300025304 Bacteria 2599
118 Ga0207656_10002881 3300025321 Bacteria 5864
119 Ga0207705_10000203 3300025909 Bacteria 60016
120 Ga0207654_10000897 3300025911 Bacteria 16495
121 Ga0207671_10058290 3300025914 Bacteria 2863
122 Ga0207693_10080522 3300025915 Bacteria 2550
123 Ga0207657_10096223 3300025919 Bacteria 2463
124 Ga0207681_10000001 3300025923 Bacteria 1105841
125 Ga0207650_10000050 3300025925 Bacteria 169589
126 Ga0207659_10031315 3300025926 Bacteria 3640
127 Ga0207706_10051503 3300025933 Bacteria 3635
128 Ga0207709_10000059 3300025935 Bacteria 211914
129 Ga0207709_10181554 3300025935 Bacteria 1486
130 Ga0207669_10000341 3300025937 Bacteria 21234
131 Ga0207669_10105521 3300025937 Bacteria 1874
132 Ga0207711_10000662 3300025941 Bacteria 34294
133 Ga0207711_10000852 3300025941 Bacteria 29486
134 Ga0207711_10004113 3300025941 Bacteria 12471
135 Ga0207711_10016633 3300025941 Bacteria 6108
136 Ga0207711_10285677 3300025941 Unclassified 1520
137 Ga0207679_10060401 3300025945 Bacteria 2816
138 Ga0207667_10000002 3300025949 Bacteria 895662
139 Ga0207668_10074535 3300025972 Bacteria 2436
140 Ga0207640_10000799 3300025981 Bacteria 17925
141 Ga0207658_10000064 3300025986 Bacteria 117779
142 Ga0207658_10001936 3300025986 Bacteria 15451
143 Ga0207703_10000244 3300026035 Bacteria 61520
144 Ga0207639_10005826 3300026041 Bacteria 8346
145 Ga0207639_10010643 3300026041 Bacteria 6369
146 Ga0207702_10003062 3300026078 Bacteria 15548
147 Ga0207641_10403089 3300026088 Bacteria 1313
148 Ga0207676_10000004 3300026095 Bacteria 725417
149 Ga0207676_10003426 3300026095 Bacteria 11218
150 Ga0207674_10475189 3300026116 Bacteria 1208
151 Ga0207675_100000159 3300026118 Bacteria 59714
152 Ga0207683_10002724 3300026121 Bacteria 15430
153 Ga0207698_10011101 3300026142 Bacteria 5824
154 Ga0209589_1000007 3300027357 Bacteria 425699
155 Ga0209489_100008 3300027361 Bacteria 425699
156 Ga0209700_100009 3300027363 Bacteria 425699
157 Ga0209813_10000014 3300027866 Bacteria 87712
158 Ga0268266_10000002 3300028379 Bacteria 3059047
159 Ga0268266_10088054 3300028379 Unclassified 2717
160 Ga0268265_10000002 3300028380 Bacteria 1035381
161 Ga0268265_10005540 3300028380 Bacteria 8618
162 Ga0268264_10000035 3300028381 Bacteria 398196
163 Ga0268264_10000112 3300028381 Bacteria 203742
164 Ga0268264_10000384 3300028381 Bacteria 63602
165 Ga0307517_10024293 3300028786 Bacteria 7480
166 Ga0307517_10024453 3300028786 Bacteria 7441
167 Ga0307509_10184800 3300031507 Bacteria 1944
168 Ga0307408_100061064 3300031548 Bacteria 2750
169 Ga0307508_10000114 3300031616 Bacteria 95098
170 Ga0307514_10153227 3300031649 Bacteria 1542
171 Ga0307516_10045233 3300031730 Bacteria 4349
172 Ga0307516_10083452 3300031730 Bacteria 3036
173 Ga0307405_10073578 3300031731 Bacteria 2207
174 Ga0307413_10044048 3300031824 Bacteria 2634
175 Ga0307413_10111086 3300031824 Bacteria 1835
176 Ga0307410_10010880 3300031852 Bacteria 5179
177 Ga0307410_10051603 3300031852 Bacteria 2773
178 Ga0307410_10162999 3300031852 Bacteria 1672
179 Ga0307407_10003482 3300031903 Bacteria 6467
180 Ga0307412_10016403 3300031911 Bacteria 4412
181 Ga0307412_10066138 3300031911 Bacteria 2449
182 Ga0307409_100035606 3300031995 Bacteria 3650
183 Ga0307409_100060415 3300031995 Bacteria 2955
184 Ga0307409_100224891 3300031995 Bacteria 1697
185 Ga0307409_100270990 3300031995 Bacteria 1563
186 Ga0307416_100029785 3300032002 Bacteria 4084
187 Ga0307416_100234678 3300032002 Bacteria 1771
188 Ga0307414_10016784 3300032004 Bacteria 4463
189 Ga0307414_10244851 3300032004 Bacteria 1486
190 Ga0307411_10004666 3300032005 Bacteria 6605
191 Ga0307415_100033228 3300032126 Bacteria 3348
192 Ga0307415_100493194 3300032126 Bacteria 1069
193 Ga0307507_10020656 3300033179 Bacteria 7365
194 Ga0307510_10038576 3300033180 Bacteria 5280
195 Ga0307510_10045195 3300033180 Bacteria 4758
196 Ga0373927_0015379 3300035695 Bacteria 5057
197 Ga0373927_0043498 3300035695 Bacteria 2908
198 Ga0373947_0156097 3300035725 Bacteria 1473
199 Ga0395899_0034460 3300037312 Bacteria 3802
200 Ga0395899_0105526 3300037312 Bacteria 2029
201 Ga0395899_0157624 3300037312 Bacteria 1606
202 Ga0395899_0253187 3300037312 Bacteria 1207
203 Ga0395899_0280228 3300037312 Bacteria 1134
204 Ga0395900_0002029 3300037418 Bacteria 22751
205 Ga0395900_0201500 3300037418 Bacteria 2013
206 Ga0395900_0206130 3300037418 Bacteria 1987
207 Ga0395905_0000365 3300037471 Bacteria 64175
208 Ga0395905_0411564 3300037471 Bacteria 1247
209 Ga0395901_0000898 3300038443 Bacteria 32720
210 Ga0395901_0111905 3300038443 Bacteria 2867
211 Ga0395901_0251611 3300038443 Bacteria 1840
212 Ga0400483_105072 3300039062 Bacteria 2268
213 Ga0436365_1117045 3300039437 Bacteria 20483
214 Ga0436361_0118740 3300039447 Bacteria 13719
215 Ga0436361_0422717 3300039447 Bacteria 3366
216 Ga0436361_0567500 3300039447 Bacteria 7795
217 Ga0436361_0684862 3300039447 Bacteria 3208
218 Ga0436361_0800986 3300039447 Bacteria 3122
219 Ga0436361_0986572 3300039447 Bacteria 2169
220 Ga0436361_0991627 3300039447 Bacteria 5125
221 Ga0436361_1110176 3300039447 Bacteria 18005
222 Ga0439436_0014239 3300041404 Bacteria 2402
223 Ga0439461_0002997 3300041410 Bacteria 2749
224 Ga0439465_0008796 3300041413 Bacteria 3180
225 Ga0439431_0001353 3300041997 Bacteria 5407
226 Ga0439431_0020543 3300041997 Bacteria 1578
227 Ga0439445_0028786 3300042004 Bacteria 1433
228 Ga0439448_0046189 3300042005 Bacteria 1419
229 Ga0439432_013213 3300042006 Bacteria 2810
230 Ga0439455_0001522 3300042012 Bacteria 3908
231 Ga0439462_0016380 3300042015 Bacteria 1914
232 Ga0439446_0010759 3300042156 Bacteria 2471
233 Ga0450909_003791 3300042185 Bacteria 2146
234 Ga0439434_0001561 3300042435 Bacteria 6606
235 Ga0466969_0017985 3300044656 Bacteria 3687
236 Ga0466972_0000466 3300044658 Bacteria 20596
237 Ga0466972_0029370 3300044658 Bacteria 2707
238 Ga0466965_0012486 3300044683 Bacteria 3995
239 Ga0466965_0036275 3300044683 Bacteria 2418
240 Ga0466966_0011486 3300044684 Bacteria 5874
241 Ga0466966_0014692 3300044684 Bacteria 5181
242 Ga0466966_0045368 3300044684 Bacteria 2810
243 Ga0466961_0027986 3300044693 Bacteria 3625
244 Ga0466961_0033773 3300044693 Bacteria 3286
245 Ga0466968_0002809 3300044735 Bacteria 6432
246 Ga0466968_0034456 3300044735 Bacteria 2113
247 Ga0466970_0091423 3300044765 Bacteria 1652
248 Ga0466957_0002374 3300044842 Bacteria 10109
249 Ga0466957_0044507 3300044842 Bacteria 2690
250 Ga0466959_0003025 3300045049 Bacteria 10867
251 Ga0466959_0062594 3300045049 Bacteria 2703
252 Ga0466959_0191634 3300045049 Bacteria 1426
253 Ga0466959_0193771 3300045049 Bacteria 1417
254 Ga0466958_0046743 3300045836 Bacteria 2612
255 Ga0466967_0040917 3300045976 Bacteria 3992
256 Ga0495650_0000440 3300046471 Bacteria 66809
257 Ga0495605_0000555 3300046474 Bacteria 30522
258 Ga0495605_0018642 3300046474 Bacteria 3715
259 Ga0495664_0223013 3300046477 Bacteria 1141
260 Ga0495584_0001058 3300046491 Bacteria 17100
261 Ga0495584_0025293 3300046491 Bacteria 3010
262 Ga0495585_0079473 3300046492 Bacteria 1779
263 Ga0495594_0126095 3300046499 Bacteria 1449
264 Ga0495607_0000317 3300046501 Bacteria 50197
265 Ga0495607_0001250 3300046501 Bacteria 22779
266 Ga0495607_0113130 3300046501 Bacteria 1436
267 Ga0495583_0000212 3300046506 Bacteria 97784
268 Ga0495583_0033420 3300046506 Bacteria 2474
269 Ga0495583_0074301 3300046506 Bacteria 1488
270 Ga0495583_0083066 3300046506 Bacteria 1389
271 Ga0495606_0007068 3300046507 Bacteria 10158
272 Ga0495606_0009337 3300046507 Bacteria 8313
273 Ga0495616_0014271 3300046513 Bacteria 4454
274 Ga0495616_0014626 3300046513 Bacteria 4387
275 Ga0495631_0041989 3300046518 Bacteria 2022
276 Ga0495637_0010987 3300046520 Bacteria 4363
277 Ga0495643_0003463 3300046522 Bacteria 11527
278 Ga0495643_0018864 3300046522 Bacteria 3996
279 Ga0495643_0073096 3300046522 Bacteria 1797
280 Ga0495648_0000459 3300046524 Bacteria 44196
281 Ga0495648_0026583 3300046524 Bacteria 3893
282 Ga0495648_0043060 3300046524 Bacteria 2834
283 Ga0495648_0157980 3300046524 Bacteria 1175
284 Ga0495663_0003362 3300046525 Bacteria 4626
285 Ga0495642_0000210 3300046528 Bacteria 34170
286 Ga0495642_0009054 3300046528 Bacteria 3811
287 Ga0495654_0052374 3300046530 Bacteria 1988
288 Ga0495609_0000009 3300046538 Bacteria 354860
289 Ga0495609_0013033 3300046538 Bacteria 3934
290 Ga0495609_0097092 3300046538 Bacteria 1278
291 Ga0495622_0012589 3300046557 Bacteria 3920
292 Ga0495622_0082176 3300046557 Bacteria 1482
293 Ga0495633_0000391 3300046558 Bacteria 46143
294 Ga0495656_0009580 3300046615 Bacteria 3488
295 Ga0495656_0064526 3300046615 Bacteria 1608
296 Ga0495668_0172145 3300046616 Bacteria 1186
297 Ga0495611_0039751 3300046648 Bacteria 2095
298 Ga0495625_0000106 3300046660 Bacteria 125985
299 Ga0495625_0020905 3300046660 Bacteria 5046
300 Ga0495625_0034464 3300046660 Bacteria 3736
301 Ga0495625_0042326 3300046660 Bacteria 3311
302 Ga0495625_0202671 3300046660 Bacteria 1308
303 Ga0495661_0000113 3300046665 Bacteria 96815
304 Ga0495661_0004134 3300046665 Bacteria 10566
305 Ga0495661_0014294 3300046665 Bacteria 5320
306 Ga0495661_0033369 3300046665 Bacteria 3247
307 Ga0495661_0082032 3300046665 Bacteria 1857
308 Ga0495661_0137855 3300046665 Bacteria 1330
309 Ga0495588_0000118 3300046674 Bacteria 134942
310 Ga0495669_0000148 3300046684 Bacteria 44972
311 Ga0495670_0000002 3300046691 Bacteria 601814
312 Ga0495649_0072392 3300046694 Bacteria 1847
313 Ga0495649_0084774 3300046694 Bacteria 1691
314 Ga0495589_0000037 3300046794 Bacteria 150603
315 Ga0495589_0028378 3300046794 Bacteria 2824
316 Ga0495600_0028612 3300046809 Bacteria 3605
317 Ga0495660_0000050 3300046810 Bacteria 140329
318 Ga0495660_0039347 3300046810 Bacteria 2626
319 Ga0495672_0152649 3300047320 Bacteria 1196
320 Ga0495683_0006914 3300047323 Bacteria 6164
321 Ga0495687_000068 3300047443 Bacteria 161081
322 Ga0495687_000097 3300047443 Bacteria 132755
323 Ga0495687_000168 3300047443 Bacteria 97267
324 Ga0495687_000563 3300047443 Bacteria 43682
325 Ga0495687_000654 3300047443 Bacteria 39715
326 Ga0495687_010878 3300047443 Bacteria 4943
327 Ga0495677_0000011 3300047445 Bacteria 149837
328 Ga0495677_0000251 3300047445 Bacteria 23487
329 Ga0495677_0002971 3300047445 Bacteria 6596
330 Ga0495677_0020710 3300047445 Bacteria 2383
331 Ga0495673_0025860 3300047469 Bacteria 2814
332 Ga0495686_0000619 3300047472 Bacteria 49008
333 Ga0495686_0016175 3300047472 Bacteria 5067
334 Ga0495686_0086220 3300047472 Bacteria 1911
335 Ga0495626_0000081 3300048091 Bacteria 128894
336 Ga0495626_0000772 3300048091 Bacteria 29300
337 Ga0495626_0086632 3300048091 Bacteria 1383
338 Ga0496102_0002779 3300048905 Bacteria 14916
339 Ga0496102_0089177 3300048905 Bacteria 2853
340 Ga0496103_0001865 3300048906 Bacteria 13700
341 Ga0496106_0011029 3300048909 Bacteria 6680
342 Ga0496106_0034658 3300048909 Bacteria 3771
343 Ga0496109_0112418 3300048912 Bacteria 2533
344 Ga0496110_0026296 3300048913 Bacteria 4978
345 Ga0496111_0116116 3300048914 Bacteria 1974
346 Ga0496111_0263170 3300048914 Bacteria 1280
347 Ga0496115_0000269 3300048918 Bacteria 45856
348 Ga0496115_0001129 3300048918 Bacteria 19266
349 Ga0496116_0033048 3300048919 Bacteria 3677
350 Ga0496117_0000887 3300048920 Bacteria 46091
351 Ga0496117_0013570 3300048920 Bacteria 7098
352 Ga0496118_0005843 3300048921 Bacteria 13797
353 Ga0496118_0009618 3300048921 Bacteria 9730
354 Ga0496118_0029534 3300048921 Bacteria 4595
355 Ga0496118_0241159 3300048921 Bacteria 1035
356 Ga0496119_0019694 3300048922 Bacteria 4954
357 Ga0496120_0026787 3300048923 Bacteria 3555
358 Ga0496121_0000009 3300048924 Bacteria 836971
359 Ga0496121_0004850 3300048924 Bacteria 17692
360 Ga0496121_0040867 3300048924 Bacteria 4062
361 Ga0496121_0354025 3300048924 Bacteria 977
362 Ga0496122_0002487 3300048925 Bacteria 26053
363 Ga0496122_0047324 3300048925 Bacteria 3321
364 Ga0496122_0073375 3300048925 Bacteria 2426
365 Ga0496123_0001567 3300048926 Bacteria 31277
366 Ga0496123_0001967 3300048926 Bacteria 26671
367 Ga0496123_0058045 3300048926 Bacteria 2514
368 Ga0496123_0182997 3300048926 Bacteria 1092
369 Ga0496124_0000874 3300048927 Bacteria 49185
370 Ga0496124_0000960 3300048927 Bacteria 45969
371 Ga0496124_0005202 3300048927 Bacteria 14776
372 Ga0496124_0006631 3300048927 Bacteria 12562
373 Ga0496124_0012507 3300048927 Bacteria 8370
374 Ga0496124_0045594 3300048927 Bacteria 3758
375 Ga0496124_0196942 3300048927 Bacteria 1536
376 Ga0496125_0000956 3300048928 Bacteria 45452
377 Ga0496125_0109050 3300048928 Bacteria 2011
378 Ga0496125_0168675 3300048928 Bacteria 1475
379 Ga0496126_0000321 3300048929 Bacteria 102445
380 Ga0496126_0124692 3300048929 Bacteria 2230
381 Ga0495682_0025992 3300049460 Bacteria 2177
382 Ga0501032_0000174 3300049569 Bacteria 52564
383 Ga0501032_0205700 3300049569 Bacteria 1284
384 Ga0501033_0012210 3300049570 Bacteria 6556
385 Ga0501034_0001672 3300049571 Bacteria 28588
386 Ga0501034_0023822 3300049571 Bacteria 6234
387 Ga0501036_0010134 3300049572 Bacteria 7767
388 Ga0501036_0154588 3300049572 Bacteria 1935
389 Ga0501037_0171244 3300049573 Bacteria 1543
390 Ga0501038_0000906 3300049574 Bacteria 26241
391 Ga0501039_0019301 3300049575 Bacteria 5227
392 Ga0501043_0030136 3300049579 Bacteria 4262
393 Ga0501046_0002375 3300049580 Bacteria 17702
394 Ga0501046_0069743 3300049580 Bacteria 2734
395 Ga0501047_0001336 3300049581 Bacteria 24199
396 Ga0501047_0193738 3300049581 Bacteria 1895
397 Ga0501048_0309996 3300049582 Bacteria 1123
398 Ga0501067_0090640 3300049583 Bacteria 1697
399 Ga0501068_0012788 3300049584 Bacteria 4765
400 Ga0501069_0136628 3300049585 Bacteria 1405
401 Ga0501072_0302978 3300049588 Bacteria 1270
402 Ga0501073_0043700 3300049589 Bacteria 3159
403 Ga0501080_0002399 3300049742 Bacteria 16356
404 Ga0501241_013729 3300049758 Bacteria 1471
405 Ga0501044_0042146 3300049823 Bacteria 4750
406 Ga0501044_0193935 3300049823 Bacteria 1992
407 nmdc:mga0k408_61488_c1 3300050493 Bacteria 2183
408 nmdc:mga0k408_98499_c1 3300050493 Bacteria 1723
409 nmdc:mga06z11_47_c1 3300050494 Bacteria 51206
410 nmdc:mga04h51_18_c1 3300050495 Bacteria 74460
411 nmdc:mga07m45_1071_c1 3300050496 Bacteria 10955
412 Ga0500610_0000607 3300053079 Bacteria 10987
413 Ga0500635_0020061 3300053080 Bacteria 2042
414 Ga0500643_001242 3300053087 Bacteria 15099
415 Ga0500643_046710 3300053087 Bacteria 1250
416 Ga0500651_0022471 3300053093 Bacteria 3939
417 Ga0500566_0006685 3300053094 Bacteria 6826
418 Ga0500555_000216 3300053103 Bacteria 26527
419 Ga0500562_003564 3300053108 Bacteria 3903
420 Ga0500595_001506 3300053119 Bacteria 12379
421 Ga0500607_000036 3300053121 Bacteria 87178
422 Ga0500607_004589 3300053121 Bacteria 9439
423 Ga0500608_000197 3300053122 Bacteria 24165
424 Ga0500642_0004805 3300053130 Bacteria 4276
425 Ga0500655_000422 3300053133 Bacteria 8829
426 Ga0500559_0000751 3300053136 Bacteria 21285
427 Ga0500559_0004177 3300053136 Bacteria 6929
428 Ga0500559_0011691 3300053136 Bacteria 3744
429 Ga0500559_0059915 3300053136 Bacteria 1695
430 Ga0500564_011201 3300053138 Bacteria 3949
431 Ga0500573_0000086 3300053140 Bacteria 42361
432 Ga0500573_0008076 3300053140 Bacteria 5785
433 Ga0500573_0078953 3300053140 Bacteria 1872
434 Ga0500590_008524 3300053148 Bacteria 5121
435 Ga0500590_082605 3300053148 Bacteria 1575
436 Ga0500616_0026669 3300053153 Bacteria 3196
437 Ga0500622_0004339 3300053156 Bacteria 8961
438 Ga0500622_0062020 3300053156 Bacteria 1905
439 Ga0500636_0072405 3300053177 Bacteria 1997
440 Ga0500637_0001378 3300053178 Bacteria 10321
441 Ga0500567_000864 3300053723 Bacteria 11500
442 Ga0500570_000114 3300053724 Bacteria 23229
443 Ga0500625_000001 3300053729 Bacteria 395993
444 Ga0500645_000002 3300053730 Bacteria 388892
445 Ga0500645_002885 3300053730 Bacteria 7355
446 Ga0500645_046518 3300053730 Bacteria 1273
447 Ga0500552_005812 3300053733 Bacteria 1359
448 Ga0500596_003355 3300053735 Bacteria 3057
449 Ga0501082_0090397 3300060353 Bacteria 2643
450 Ga0466962_0014941 3300061719 Bacteria 3742
451 Ga0466962_0055345 3300061719 Bacteria 1896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025292 Ga0209676_1003684 Ga0209676_10036846 280
2 3300025298 Ga0209050_1000001 Ga0209050_10000012054 280
3 3300025303 Ga0209051_1000191 Ga0209051_100019115 280
4 3300025304 Ga0209257_1000876 Ga0209257_10008764 280
5 3300031730 Ga0307516_10045233 Ga0307516_100452336 288
6 3300003781 Ga0055536_1009630 Ga0055536_10096303 289
7 3300031730 Ga0307516_10083452 Ga0307516_100834524 293
8 3300009101 Ga0105247_10012729 Ga0105247_100127294 294
9 3300033179 Ga0307507_10020656 Ga0307507_100206566 294
10 3300035695 Ga0373927_0015379 Ga0373927_0015379_119_1102 294
11 3300046530 Ga0495654_0052374 Ga0495654_0052374_941_1891 294
12 3300046557 Ga0495622_0082176 Ga0495622_0082176_483_1466 294
13 3300048924 Ga0496121_0040867 Ga0496121_0040867_432_1397 294
14 3300053136 Ga0500559_0059915 Ga0500559_0059915_631_1581 294
15 3300053138 Ga0500564_011201 Ga0500564_011201_2107_3057 294
16 3300053723 Ga0500567_000864 Ga0500567_000864_7367_8317 294
17 3300053729 Ga0500625_000001 Ga0500625_000001_351393_352343 294
18 3300003773 Ga0055537_1006876 Ga0055537_10068763 295
19 3300003792 Ga0055540_1006750 Ga0055540_10067504 295
20 3300025263 Ga0209565_1000134 Ga0209565_100013439 295
21 3300025273 Ga0209673_1007209 Ga0209673_10072092 295
22 3300046477 Ga0495664_0223013 Ga0495664_0223013_100_1083 295
23 3300047320 Ga0495672_0152649 Ga0495672_0152649_257_1153 295
24 3300048909 Ga0496106_0011029 Ga0496106_0011029_3167_4147 295
25 3300048921 Ga0496118_0009618 Ga0496118_0009618_3887_4867 295
26 3300048928 Ga0496125_0109050 Ga0496125_0109050_1006_1986 295
27 3300048929 Ga0496126_0124692 Ga0496126_0124692_132_1112 295
28 3300053136 Ga0500559_0011691 Ga0500559_0011691_2121_3104 295
29 3300053140 Ga0500573_0008076 Ga0500573_0008076_1815_2798 295
30 3300048924 Ga0496121_0354025 Ga0496121_0354025_23_928 296
31 3300053080 Ga0500635_0020061 Ga0500635_0020061_555_1538 296
32 3300031649 Ga0307514_10153227 Ga0307514_101532272 297
33 3300048928 Ga0496125_0168675 Ga0496125_0168675_31_933 297
34 3300039447 Ga0436361_0422717 Ga0436361_0422717_677_1636 299
35 3300025298 Ga0209050_1012997 Ga0209050_10129973 302
36 3300021361 Ga0213872_10002552 Ga0213872_100025526 304
37 3300048925 Ga0496122_0002487 Ga0496122_0002487_5251_6204 304
38 3300048926 Ga0496123_0001967 Ga0496123_0001967_23085_24038 304
39 3300025915 Ga0207693_10080522 Ga0207693_100805222 307
40 3300031852 Ga0307410_10162999 Ga0307410_101629992 307
41 3300031995 Ga0307409_100060415 Ga0307409_1000604154 307
42 iso_pu_bacteria 2513237098 2513671048 309
43 iso_pu_bacteria 2513237137 2513861538 309
44 iso_pu_bacteria 2513237145 2513919779 309
45 iso_pu_bacteria 2517572143 2517895210 309
46 iso_pu_bacteria 2524023210 2524465938 309
47 iso_pu_bacteria 2524023228 2524536337 309
48 iso_pu_bacteria 2728368998 2728752173 309
49 iso_pu_bacteria 2791355197 2793069160 309
50 iso_pu_bacteria 2837678835 2837679896 309
51 iso_pu_bacteria 2885374607 2885375645 309
52 iso_pu_bacteria 2885383462 2885392354 309
53 iso_pu_bacteria 2903748898 2903754282 309
54 iso_pu_bacteria 2903768456 2903768803 309
55 iso_pu_bacteria 2904690495 2904698272 309
56 iso_pu_bacteria 2904699407 2904699950 309
57 iso_pu_bacteria 2906610324 2906611877 309
58 iso_pu_bacteria 2906635258 2906635850 309
59 iso_pu_bacteria 2906660503 2906665441 309
60 iso_pu_bacteria 2908739725 2908740600 309
61 iso_pu_bacteria 2908756301 2908762872 309
62 iso_pu_bacteria 2922425934 2922427421 309
63 iso_pu_bacteria 2935630451 2935637170 309
64 iso_pu_bacteria 2941507105 2941513743 309
65 iso_pu_bacteria 2941515067 2941521705 309
66 iso_pu_bacteria 2941523033 2941529635 309
67 iso_pu_bacteria 3005474847 3005477133 309
68 iso_pu_bacteria 8006933436 8006938344 309
69 iso_pu_bacteria 8006973647 8006978421 309
70 iso_pu_bacteria 8019555841 8019560684 309
71 iso_pu_bacteria 8056689827 8056691524 309
72 3300006175 Ga0070712_100145779 Ga0070712_1001457791 310
73 3300037312 Ga0395899_0157624 Ga0395899_0157624_10_951 310
74 iso_pu_bacteria 2643221556 2643800819 310
75 iso_pu_bacteria 2643221684 2644471049 310
76 iso_pu_bacteria 2739367664 2739649002 310
77 iso_pu_bacteria 2739367865 2740027475 310
78 iso_pu_bacteria 2919138771 2919140089 310
79 iso_pu_bacteria 8047673197 8047677289 310
80 iso_pu_bacteria 2512564014 2512645114 311
81 iso_pu_bacteria 2582581305 2585259764 311
82 iso_pu_bacteria 2599185354 2600202834 311
83 iso_pu_bacteria 2599185359 2600225506 311
84 iso_pu_bacteria 2643221622 2644126031 311
85 iso_pu_bacteria 2818991466 2819713943 311
86 iso_pu_bacteria 2861691609 2861694122 311
87 iso_pu_bacteria 2928526807 2928528506 311
88 iso_pu_bacteria 2928968154 2928970051 311
89 iso_pu_bacteria 2929199973 2929201879 311
90 iso_pu_bacteria 8055909800 8055910869 311
91 3300005983 Ga0081540_1066166 Ga0081540_10661662 313
92 3300006943 Ga0099822_1020871 Ga0099822_10208714 313
93 3300025298 Ga0209050_1016987 Ga0209050_10169872 313
94 3300027357 Ga0209589_1000007 Ga0209589_1000007240 313
95 3300027361 Ga0209489_100008 Ga0209489_100008240 313
96 3300027363 Ga0209700_100009 Ga0209700_100009240 313
97 3300003320 rootH2_10014115 rootH2_100141151 314
98 3300006051 Ga0075364_10000807 Ga0075364_1000080712 314
99 3300006186 Ga0075369_10003090 Ga0075369_100030906 314
100 3300006353 Ga0075370_10011024 Ga0075370_100110244 314
101 3300009177 Ga0105248_10311368 Ga0105248_103113682 314
102 3300010375 Ga0105239_10259055 Ga0105239_102590552 314
103 3300014325 Ga0163163_10011516 Ga0163163_100115161 314
104 3300025941 Ga0207711_10285677 Ga0207711_102856772 314
105 3300033180 Ga0307510_10038576 Ga0307510_100385762 314
106 3300035695 Ga0373927_0043498 Ga0373927_0043498_1441_2400 314
107 3300042005 Ga0439448_0046189 Ga0439448_0046189_146_1099 314
108 3300042012 Ga0439455_0001522 Ga0439455_0001522_2145_3107 314
109 3300044656 Ga0466969_0017985 Ga0466969_0017985_224_1177 314
110 3300044658 Ga0466972_0000466 Ga0466972_0000466_16305_17258 314
111 3300044683 Ga0466965_0012486 Ga0466965_0012486_1606_2559 314
112 3300044683 Ga0466965_0036275 Ga0466965_0036275_1198_2151 314
113 3300044684 Ga0466966_0011486 Ga0466966_0011486_292_1245 314
114 3300044684 Ga0466966_0014692 Ga0466966_0014692_4040_4999 314
115 3300044684 Ga0466966_0045368 Ga0466966_0045368_787_1806 314
116 3300044693 Ga0466961_0027986 Ga0466961_0027986_2376_3335 314
117 3300044693 Ga0466961_0033773 Ga0466961_0033773_1738_2691 314
118 3300044735 Ga0466968_0002809 Ga0466968_0002809_286_1239 314
119 3300044735 Ga0466968_0034456 Ga0466968_0034456_548_1501 314
120 3300044842 Ga0466957_0002374 Ga0466957_0002374_318_1271 314
121 3300045049 Ga0466959_0003025 Ga0466959_0003025_2693_3652 314
122 3300045049 Ga0466959_0062594 Ga0466959_0062594_60_1013 314
123 3300045049 Ga0466959_0191634 Ga0466959_0191634_205_1158 314
124 3300045049 Ga0466959_0193771 Ga0466959_0193771_208_1161 314
125 3300045836 Ga0466958_0046743 Ga0466958_0046743_230_1183 314
126 3300045976 Ga0466967_0040917 Ga0466967_0040917_2440_3456 314
127 3300046474 Ga0495605_0000555 Ga0495605_0000555_23494_24447 314
128 3300046491 Ga0495584_0001058 Ga0495584_0001058_8168_9121 314
129 3300046501 Ga0495607_0001250 Ga0495607_0001250_15953_16906 314
130 3300046506 Ga0495583_0000212 Ga0495583_0000212_58468_59424 314
131 3300046506 Ga0495583_0083066 Ga0495583_0083066_296_1252 314
132 3300046507 Ga0495606_0007068 Ga0495606_0007068_1335_2288 314
133 3300046513 Ga0495616_0014271 Ga0495616_0014271_1566_2519 314
134 3300046522 Ga0495643_0003463 Ga0495643_0003463_2155_3108 314
135 3300046522 Ga0495643_0018864 Ga0495643_0018864_85_1038 314
136 3300046524 Ga0495648_0026583 Ga0495648_0026583_776_1729 314
137 3300046528 Ga0495642_0000210 Ga0495642_0000210_13281_14234 314
138 3300046615 Ga0495656_0009580 Ga0495656_0009580_1259_2212 314
139 3300046615 Ga0495656_0064526 Ga0495656_0064526_139_1092 314
140 3300046665 Ga0495661_0004134 Ga0495661_0004134_7276_8295 314
141 3300046665 Ga0495661_0014294 Ga0495661_0014294_4252_5208 314
142 3300046665 Ga0495661_0033369 Ga0495661_0033369_592_1545 314
143 3300046665 Ga0495661_0137855 Ga0495661_0137855_73_1092 314
144 3300046674 Ga0495588_0000118 Ga0495588_0000118_110153_111106 314
145 3300046794 Ga0495589_0028378 Ga0495589_0028378_816_1769 314
146 3300046810 Ga0495660_0000050 Ga0495660_0000050_59782_60735 314
147 3300046810 Ga0495660_0039347 Ga0495660_0039347_109_1062 314
148 3300047443 Ga0495687_000097 Ga0495687_000097_62147_63100 314
149 3300047443 Ga0495687_000654 Ga0495687_000654_23737_24690 314
150 3300047443 Ga0495687_010878 Ga0495687_010878_3672_4625 314
151 3300047445 Ga0495677_0000251 Ga0495677_0000251_13092_14045 314
152 3300047445 Ga0495677_0020710 Ga0495677_0020710_108_1061 314
153 3300047469 Ga0495673_0025860 Ga0495673_0025860_858_1829 314
154 3300047472 Ga0495686_0000619 Ga0495686_0000619_31894_32850 314
155 3300047472 Ga0495686_0086220 Ga0495686_0086220_678_1634 314
156 3300048091 Ga0495626_0000081 Ga0495626_0000081_105103_106056 314
157 3300048091 Ga0495626_0086632 Ga0495626_0086632_198_1151 314
158 3300048914 Ga0496111_0116116 Ga0496111_0116116_180_1133 314
159 3300048914 Ga0496111_0263170 Ga0496111_0263170_93_1064 314
160 3300048925 Ga0496122_0073375 Ga0496122_0073375_362_1333 314
161 3300048926 Ga0496123_0001567 Ga0496123_0001567_21731_22702 314
162 3300048926 Ga0496123_0182997 Ga0496123_0182997_100_1071 314
163 3300048927 Ga0496124_0006631 Ga0496124_0006631_11591_12544 314
164 3300049460 Ga0495682_0025992 Ga0495682_0025992_1078_2034 314
165 3300049572 Ga0501036_0154588 Ga0501036_0154588_763_1716 314
166 3300050493 nmdc:mga0k408_61488_c1 nmdc:mga0k408_61488_c1_766_1716 314
167 3300050496 nmdc:mga07m45_1071_c1 nmdc:mga07m45_1071_c1_1052_2002 314
168 3300053103 Ga0500555_000216 Ga0500555_000216_14725_15681 314
169 3300053121 Ga0500607_000036 Ga0500607_000036_43533_44501 314
170 3300053121 Ga0500607_004589 Ga0500607_004589_1479_2429 314
171 3300053122 Ga0500608_000197 Ga0500608_000197_9044_9994 314
172 3300053136 Ga0500559_0000751 Ga0500559_0000751_16866_17834 314
173 3300053136 Ga0500559_0004177 Ga0500559_0004177_5465_6433 314
174 3300053140 Ga0500573_0078953 Ga0500573_0078953_211_1161 314
175 3300053148 Ga0500590_008524 Ga0500590_008524_2629_3597 314
176 3300053153 Ga0500616_0026669 Ga0500616_0026669_1841_2803 314
177 3300053156 Ga0500622_0004339 Ga0500622_0004339_5409_6359 314
178 3300053178 Ga0500637_0001378 Ga0500637_0001378_8342_9310 314
179 3300061719 Ga0466962_0014941 Ga0466962_0014941_1297_2250 314
180 3300061719 Ga0466962_0055345 Ga0466962_0055345_817_1776 314
181 3300001915 JGI24741J21665_1002303 JGI24741J21665_10023034 315
182 3300001979 JGI24740J21852_10003974 JGI24740J21852_100039742 315
183 3300001990 JGI24737J22298_10016381 JGI24737J22298_100163813 315
184 3300002076 JGI24749J21850_1001461 JGI24749J21850_10014613 315
185 3300002459 JGI24751J29686_10000357 JGI24751J29686_1000035717 315
186 3300003215 JGI25153J46596_10013111 JGI25153J46596_100131113 315
187 3300003316 rootH1_10130120 rootH1_101301203 315
188 3300003323 rootH1_10283578 rootH1_102835782 315
189 3300003759 Ga0055525_1000186 Ga0055525_100018664 315
190 3300003771 Ga0055526_1033145 Ga0055526_10331452 315
191 3300003773 Ga0055537_1001019 Ga0055537_100101911 315
192 3300003775 Ga0055524_1000539 Ga0055524_100053930 315
193 3300003791 Ga0055530_10003402 Ga0055530_100034025 315
194 3300003791 Ga0055530_10007609 Ga0055530_100076094 315
195 3300003794 Ga0055531_10003730 Ga0055531_100037304 315
196 3300003794 Ga0055531_10004059 Ga0055531_100040595 315
197 3300004625 Ga0055543_1011995 Ga0055543_10119952 315
198 3300005262 Ga0065165_1003679 Ga0065165_10036795 315
199 3300005262 Ga0065165_1005379 Ga0065165_10053793 315
200 3300005262 Ga0065165_1037227 Ga0065165_10372272 315
201 3300005295 Ga0065707_10093872 Ga0065707_100938723 315
202 3300005331 Ga0070670_100000178 Ga0070670_10000017827 315
203 3300005339 Ga0070660_100102256 Ga0070660_1001022562 315
204 3300005344 Ga0070661_100143793 Ga0070661_1001437932 315
205 3300005353 Ga0070669_100000119 Ga0070669_10000011943 315
206 3300005354 Ga0070675_100242562 Ga0070675_1002425622 315
207 3300005356 Ga0070674_100024610 Ga0070674_1000246105 315
208 3300005356 Ga0070674_100106425 Ga0070674_1001064252 315
209 3300005364 Ga0070673_100184294 Ga0070673_1001842942 315
210 3300005367 Ga0070667_100000088 Ga0070667_10000008842 315
211 3300005367 Ga0070667_100000407 Ga0070667_10000040712 315
212 3300005367 Ga0070667_100202315 Ga0070667_1002023152 315
213 3300005456 Ga0070678_100017439 Ga0070678_1000174392 315
214 3300005457 Ga0070662_100185244 Ga0070662_1001852441 315
215 3300005539 Ga0068853_100023854 Ga0068853_1000238546 315
216 3300005548 Ga0070665_100000323 Ga0070665_10000032352 315
217 3300005564 Ga0070664_100028482 Ga0070664_1000284823 315
218 3300005577 Ga0068857_100347931 Ga0068857_1003479311 315
219 3300005617 Ga0068859_100008045 Ga0068859_1000080453 315
220 3300005618 Ga0068864_100000183 Ga0068864_10000018327 315
221 3300005719 Ga0068861_100000001 Ga0068861_10000000170 315
222 3300005719 Ga0068861_100001052 Ga0068861_1000010523 315
223 3300005834 Ga0068851_10053336 Ga0068851_100533362 315
224 3300005842 Ga0068858_100000327 Ga0068858_10000032751 315
225 3300005843 Ga0068860_100000055 Ga0068860_10000005556 315
226 3300005843 Ga0068860_100000220 Ga0068860_10000022052 315
227 3300005844 Ga0068862_100000011 Ga0068862_100000011261 315
228 3300005844 Ga0068862_100010652 Ga0068862_1000106524 315
229 3300005985 Ga0081539_10011418 Ga0081539_100114183 315
230 3300006042 Ga0075368_10000016 Ga0075368_1000001611 315
231 3300006178 Ga0075367_10000154 Ga0075367_100001545 315
232 3300006195 Ga0075366_10023439 Ga0075366_100234392 315
233 3300006931 Ga0097620_100008045 Ga0097620_10000804513 315
234 3300009093 Ga0105240_10617028 Ga0105240_106170281 315
235 3300009148 Ga0105243_10000033 Ga0105243_10000033168 315
236 3300009148 Ga0105243_10188381 Ga0105243_101883812 315
237 3300009174 Ga0105241_10001031 Ga0105241_1000103115 315
238 3300009177 Ga0105248_10000685 Ga0105248_1000068524 315
239 3300009177 Ga0105248_10000998 Ga0105248_1000099819 315
240 3300009177 Ga0105248_10001758 Ga0105248_1000175823 315
241 3300009177 Ga0105248_10002949 Ga0105248_1000294923 315
242 3300009545 Ga0105237_10472577 Ga0105237_104725772 315
243 3300010375 Ga0105239_10065247 Ga0105239_100652472 315
244 3300012513 Ga0157326_1002414 Ga0157326_10024141 315
245 3300013102 Ga0157371_10000059 Ga0157371_10000059105 315
246 3300013104 Ga0157370_10105124 Ga0157370_101051242 315
247 3300013296 Ga0157374_10184987 Ga0157374_101849872 315
248 3300013297 Ga0157378_10045746 Ga0157378_100457462 315
249 3300013306 Ga0163162_10013938 Ga0163162_100139381 315
250 3300013307 Ga0157372_10191971 Ga0157372_101919712 315
251 3300014326 Ga0157380_10000087 Ga0157380_1000008719 315
252 3300017792 Ga0163161_10030181 Ga0163161_100301811 315
253 3300017792 Ga0163161_10052945 Ga0163161_100529453 315
254 3300021361 Ga0213872_10000321 Ga0213872_1000032115 315
255 3300021361 Ga0213872_10036518 Ga0213872_100365184 315
256 3300021384 Ga0213876_10001077 Ga0213876_100010778 315
257 3300025226 Ga0209674_108949 Ga0209674_1089491 315
258 3300025230 Ga0209563_100145 Ga0209563_10014522 315
259 3300025246 Ga0209646_1002642 Ga0209646_10026422 315
260 3300025263 Ga0209565_1000008 Ga0209565_1000008641 315
261 3300025273 Ga0209673_1001779 Ga0209673_100177922 315
262 3300025291 Ga0209675_1005513 Ga0209675_10055133 315
263 3300025295 Ga0209564_1000622 Ga0209564_100062254 315
264 3300025297 Ga0209758_1000001 Ga0209758_1000001727 315
265 3300025297 Ga0209758_1038954 Ga0209758_10389542 315
266 3300025298 Ga0209050_1000581 Ga0209050_100058125 315
267 3300025298 Ga0209050_1017353 Ga0209050_10173531 315
268 3300025299 Ga0209256_1000009 Ga0209256_1000009228 315
269 3300025299 Ga0209256_1000010 Ga0209256_1000010152 315
270 3300025304 Ga0209257_1000577 Ga0209257_10005775 315
271 3300025304 Ga0209257_1000597 Ga0209257_10005975 315
272 3300025304 Ga0209257_1005749 Ga0209257_100574910 315
273 3300025304 Ga0209257_1015960 Ga0209257_10159602 315
274 3300025304 Ga0209257_1019098 Ga0209257_10190982 315
275 3300025321 Ga0207656_10002881 Ga0207656_100028812 315
276 3300025909 Ga0207705_10000203 Ga0207705_1000020360 315
277 3300025911 Ga0207654_10000897 Ga0207654_1000089712 315
278 3300025914 Ga0207671_10058290 Ga0207671_100582902 315
279 3300025919 Ga0207657_10096223 Ga0207657_100962231 315
280 3300025923 Ga0207681_10000001 Ga0207681_10000001684 315
281 3300025925 Ga0207650_10000050 Ga0207650_1000005027 315
282 3300025926 Ga0207659_10031315 Ga0207659_100313152 315
283 3300025933 Ga0207706_10051503 Ga0207706_100515032 315
284 3300025935 Ga0207709_10000059 Ga0207709_1000005986 315
285 3300025935 Ga0207709_10181554 Ga0207709_101815542 315
286 3300025937 Ga0207669_10000341 Ga0207669_1000034111 315
287 3300025937 Ga0207669_10105521 Ga0207669_101055212 315
288 3300025941 Ga0207711_10000662 Ga0207711_1000066223 315
289 3300025941 Ga0207711_10000852 Ga0207711_1000085223 315
290 3300025941 Ga0207711_10004113 Ga0207711_100041135 315
291 3300025941 Ga0207711_10016633 Ga0207711_100166336 315
292 3300025945 Ga0207679_10060401 Ga0207679_100604011 315
293 3300025949 Ga0207667_10000002 Ga0207667_1000000255 315
294 3300025972 Ga0207668_10074535 Ga0207668_100745353 315
295 3300025981 Ga0207640_10000799 Ga0207640_1000079917 315
296 3300025986 Ga0207658_10000064 Ga0207658_1000006475 315
297 3300025986 Ga0207658_10001936 Ga0207658_1000193612 315
298 3300026035 Ga0207703_10000244 Ga0207703_1000024462 315
299 3300026041 Ga0207639_10005826 Ga0207639_100058263 315
300 3300026041 Ga0207639_10010643 Ga0207639_100106431 315
301 3300026078 Ga0207702_10003062 Ga0207702_100030629 315
302 3300026088 Ga0207641_10403089 Ga0207641_104030891 315
303 3300026095 Ga0207676_10000004 Ga0207676_10000004368 315
304 3300026095 Ga0207676_10003426 Ga0207676_100034267 315
305 3300026116 Ga0207674_10475189 Ga0207674_104751892 315
306 3300026118 Ga0207675_100000159 Ga0207675_1000001597 315
307 3300026121 Ga0207683_10002724 Ga0207683_1000272417 315
308 3300026142 Ga0207698_10011101 Ga0207698_100111012 315
309 3300027866 Ga0209813_10000014 Ga0209813_1000001460 315
310 3300028379 Ga0268266_10000002 Ga0268266_100000022970 315
311 3300028379 Ga0268266_10088054 Ga0268266_100880542 315
312 3300028380 Ga0268265_10000002 Ga0268265_10000002701 315
313 3300028380 Ga0268265_10005540 Ga0268265_100055407 315
314 3300028381 Ga0268264_10000035 Ga0268264_1000003584 315
315 3300028381 Ga0268264_10000112 Ga0268264_10000112141 315
316 3300028381 Ga0268264_10000384 Ga0268264_1000038418 315
317 3300028786 Ga0307517_10024293 Ga0307517_100242934 315
318 3300028786 Ga0307517_10024453 Ga0307517_100244537 315
319 3300031507 Ga0307509_10184800 Ga0307509_101848002 315
320 3300031548 Ga0307408_100061064 Ga0307408_1000610643 315
321 3300031616 Ga0307508_10000114 Ga0307508_100001146 315
322 3300031731 Ga0307405_10073578 Ga0307405_100735783 315
323 3300031824 Ga0307413_10044048 Ga0307413_100440484 315
324 3300031824 Ga0307413_10111086 Ga0307413_101110862 315
325 3300031852 Ga0307410_10010880 Ga0307410_100108802 315
326 3300031852 Ga0307410_10051603 Ga0307410_100516034 315
327 3300031903 Ga0307407_10003482 Ga0307407_100034824 315
328 3300031911 Ga0307412_10016403 Ga0307412_100164032 315
329 3300031911 Ga0307412_10066138 Ga0307412_100661382 315
330 3300031995 Ga0307409_100035606 Ga0307409_1000356063 315
331 3300031995 Ga0307409_100224891 Ga0307409_1002248912 315
332 3300031995 Ga0307409_100270990 Ga0307409_1002709902 315
333 3300032002 Ga0307416_100029785 Ga0307416_1000297853 315
334 3300032002 Ga0307416_100234678 Ga0307416_1002346782 315
335 3300032004 Ga0307414_10016784 Ga0307414_100167843 315
336 3300032004 Ga0307414_10244851 Ga0307414_102448512 315
337 3300032005 Ga0307411_10004666 Ga0307411_100046665 315
338 3300032126 Ga0307415_100033228 Ga0307415_1000332285 315
339 3300032126 Ga0307415_100493194 Ga0307415_1004931941 315
340 3300033180 Ga0307510_10045195 Ga0307510_100451953 315
341 3300035725 Ga0373947_0156097 Ga0373947_0156097_431_1405 315
342 3300037312 Ga0395899_0034460 Ga0395899_0034460_483_1436 315
343 3300037312 Ga0395899_0105526 Ga0395899_0105526_944_1903 315
344 3300037312 Ga0395899_0253187 Ga0395899_0253187_133_1092 315
345 3300037312 Ga0395899_0280228 Ga0395899_0280228_111_1070 315
346 3300037418 Ga0395900_0002029 Ga0395900_0002029_12157_13110 315
347 3300037418 Ga0395900_0201500 Ga0395900_0201500_837_1796 315
348 3300037418 Ga0395900_0206130 Ga0395900_0206130_1008_1967 315
349 3300037471 Ga0395905_0000365 Ga0395905_0000365_35031_35984 315
350 3300037471 Ga0395905_0411564 Ga0395905_0411564_240_1199 315
351 3300038443 Ga0395901_0000898 Ga0395901_0000898_26584_27537 315
352 3300038443 Ga0395901_0111905 Ga0395901_0111905_850_1809 315
353 3300038443 Ga0395901_0251611 Ga0395901_0251611_706_1665 315
354 3300039062 Ga0400483_105072 Ga0400483_105072_1253_2209 315
355 3300039437 Ga0436365_1117045 Ga0436365_1117045_10070_11029 315
356 3300039447 Ga0436361_0118740 Ga0436361_0118740_9223_10203 315
357 3300039447 Ga0436361_0567500 Ga0436361_0567500_6040_7002 315
358 3300039447 Ga0436361_0684862 Ga0436361_0684862_1637_2596 315
359 3300039447 Ga0436361_0800986 Ga0436361_0800986_1162_2142 315
360 3300039447 Ga0436361_0986572 Ga0436361_0986572_151_1116 315
361 3300039447 Ga0436361_0991627 Ga0436361_0991627_106_1065 315
362 3300039447 Ga0436361_1110176 Ga0436361_1110176_13306_14268 315
363 3300041404 Ga0439436_0014239 Ga0439436_0014239_1220_2182 315
364 3300041410 Ga0439461_0002997 Ga0439461_0002997_481_1500 315
365 3300041413 Ga0439465_0008796 Ga0439465_0008796_1295_2314 315
366 3300041997 Ga0439431_0001353 Ga0439431_0001353_1238_2257 315
367 3300041997 Ga0439431_0020543 Ga0439431_0020543_303_1265 315
368 3300042004 Ga0439445_0028786 Ga0439445_0028786_154_1116 315
369 3300042006 Ga0439432_013213 Ga0439432_013213_563_1582 315
370 3300042015 Ga0439462_0016380 Ga0439462_0016380_430_1449 315
371 3300042156 Ga0439446_0010759 Ga0439446_0010759_1262_2224 315
372 3300042185 Ga0450909_003791 Ga0450909_003791_957_1919 315
373 3300042435 Ga0439434_0001561 Ga0439434_0001561_3973_4992 315
374 3300044658 Ga0466972_0029370 Ga0466972_0029370_166_1140 315
375 3300044765 Ga0466970_0091423 Ga0466970_0091423_193_1170 315
376 3300044842 Ga0466957_0044507 Ga0466957_0044507_43_1002 315
377 3300046471 Ga0495650_0000440 Ga0495650_0000440_35742_36689 315
378 3300046474 Ga0495605_0018642 Ga0495605_0018642_2253_3230 315
379 3300046491 Ga0495584_0025293 Ga0495584_0025293_682_1659 315
380 3300046492 Ga0495585_0079473 Ga0495585_0079473_103_1050 315
381 3300046499 Ga0495594_0126095 Ga0495594_0126095_167_1114 315
382 3300046501 Ga0495607_0000317 Ga0495607_0000317_36766_37743 315
383 3300046501 Ga0495607_0113130 Ga0495607_0113130_440_1390 315
384 3300046506 Ga0495583_0033420 Ga0495583_0033420_535_1482 315
385 3300046506 Ga0495583_0074301 Ga0495583_0074301_179_1126 315
386 3300046507 Ga0495606_0009337 Ga0495606_0009337_742_1689 315
387 3300046513 Ga0495616_0014626 Ga0495616_0014626_1886_2863 315
388 3300046518 Ga0495631_0041989 Ga0495631_0041989_554_1501 315
389 3300046520 Ga0495637_0010987 Ga0495637_0010987_430_1419 315
390 3300046522 Ga0495643_0073096 Ga0495643_0073096_669_1616 315
391 3300046524 Ga0495648_0000459 Ga0495648_0000459_34970_35917 315
392 3300046524 Ga0495648_0043060 Ga0495648_0043060_338_1297 315
393 3300046524 Ga0495648_0157980 Ga0495648_0157980_128_1117 315
394 3300046525 Ga0495663_0003362 Ga0495663_0003362_309_1256 315
395 3300046528 Ga0495642_0009054 Ga0495642_0009054_1670_2647 315
396 3300046538 Ga0495609_0000009 Ga0495609_0000009_275086_276063 315
397 3300046538 Ga0495609_0013033 Ga0495609_0013033_1798_2850 315
398 3300046538 Ga0495609_0097092 Ga0495609_0097092_228_1217 315
399 3300046557 Ga0495622_0012589 Ga0495622_0012589_781_1728 315
400 3300046558 Ga0495633_0000391 Ga0495633_0000391_407_1354 315
401 3300046616 Ga0495668_0172145 Ga0495668_0172145_105_1052 315
402 3300046648 Ga0495611_0039751 Ga0495611_0039751_759_1748 315
403 3300046660 Ga0495625_0000106 Ga0495625_0000106_100607_101554 315
404 3300046660 Ga0495625_0020905 Ga0495625_0020905_1470_2432 315
405 3300046660 Ga0495625_0034464 Ga0495625_0034464_366_1313 315
406 3300046660 Ga0495625_0042326 Ga0495625_0042326_470_1459 315
407 3300046660 Ga0495625_0202671 Ga0495625_0202671_23_970 315
408 3300046665 Ga0495661_0000113 Ga0495661_0000113_78795_79772 315
409 3300046665 Ga0495661_0082032 Ga0495661_0082032_643_1590 315
410 3300046684 Ga0495669_0000148 Ga0495669_0000148_4567_5556 315
411 3300046691 Ga0495670_0000002 Ga0495670_0000002_79527_80486 315
412 3300046694 Ga0495649_0072392 Ga0495649_0072392_341_1288 315
413 3300046694 Ga0495649_0084774 Ga0495649_0084774_498_1487 315
414 3300046794 Ga0495589_0000037 Ga0495589_0000037_78800_79777 315
415 3300046809 Ga0495600_0028612 Ga0495600_0028612_2498_3445 315
416 3300047323 Ga0495683_0006914 Ga0495683_0006914_395_1342 315
417 3300047443 Ga0495687_000068 Ga0495687_000068_37912_38901 315
418 3300047443 Ga0495687_000168 Ga0495687_000168_78800_79777 315
419 3300047443 Ga0495687_000563 Ga0495687_000563_12383_13330 315
420 3300047445 Ga0495677_0000011 Ga0495677_0000011_70061_71038 315
421 3300047445 Ga0495677_0002971 Ga0495677_0002971_44_991 315
422 3300047472 Ga0495686_0016175 Ga0495686_0016175_2519_3514 315
423 3300048091 Ga0495626_0000772 Ga0495626_0000772_17419_18396 315
424 3300048905 Ga0496102_0002779 Ga0496102_0002779_3795_4742 315
425 3300048905 Ga0496102_0089177 Ga0496102_0089177_1293_2252 315
426 3300048906 Ga0496103_0001865 Ga0496103_0001865_2304_3251 315
427 3300048909 Ga0496106_0034658 Ga0496106_0034658_2148_3107 315
428 3300048912 Ga0496109_0112418 Ga0496109_0112418_339_1286 315
429 3300048913 Ga0496110_0026296 Ga0496110_0026296_2462_3409 315
430 3300048918 Ga0496115_0000269 Ga0496115_0000269_34461_35408 315
431 3300048918 Ga0496115_0001129 Ga0496115_0001129_18242_19204 315
432 3300048919 Ga0496116_0033048 Ga0496116_0033048_238_1185 315
433 3300048920 Ga0496117_0000887 Ga0496117_0000887_34692_35639 315
434 3300048920 Ga0496117_0013570 Ga0496117_0013570_5411_6394 315
435 3300048921 Ga0496118_0005843 Ga0496118_0005843_10455_11402 315
436 3300048921 Ga0496118_0029534 Ga0496118_0029534_27_1010 315
437 3300048921 Ga0496118_0241159 Ga0496118_0241159_26_988 315
438 3300048922 Ga0496119_0019694 Ga0496119_0019694_52_1035 315
439 3300048923 Ga0496120_0026787 Ga0496120_0026787_2326_3273 315
440 3300048924 Ga0496121_0000009 Ga0496121_0000009_332403_333386 315
441 3300048924 Ga0496121_0004850 Ga0496121_0004850_10447_11394 315
442 3300048925 Ga0496122_0047324 Ga0496122_0047324_1989_2936 315
443 3300048926 Ga0496123_0058045 Ga0496123_0058045_1226_2182 315
444 3300048927 Ga0496124_0000874 Ga0496124_0000874_25174_26130 315
445 3300048927 Ga0496124_0000960 Ga0496124_0000960_10460_11407 315
446 3300048927 Ga0496124_0005202 Ga0496124_0005202_3489_4445 315
447 3300048927 Ga0496124_0012507 Ga0496124_0012507_5954_6910 315
448 3300048927 Ga0496124_0045594 Ga0496124_0045594_2553_3512 315
449 3300048927 Ga0496124_0196942 Ga0496124_0196942_208_1164 315
450 3300048928 Ga0496125_0000956 Ga0496125_0000956_10450_11397 315
451 3300048929 Ga0496126_0000321 Ga0496126_0000321_66879_67826 315
452 3300049569 Ga0501032_0000174 Ga0501032_0000174_11042_12115 315
453 3300049569 Ga0501032_0205700 Ga0501032_0205700_229_1212 315
454 3300049570 Ga0501033_0012210 Ga0501033_0012210_2137_3120 315
455 3300049571 Ga0501034_0001672 Ga0501034_0001672_26305_27378 315
456 3300049571 Ga0501034_0023822 Ga0501034_0023822_4613_5596 315
457 3300049572 Ga0501036_0010134 Ga0501036_0010134_6181_7254 315
458 3300049573 Ga0501037_0171244 Ga0501037_0171244_536_1519 315
459 3300049574 Ga0501038_0000906 Ga0501038_0000906_19803_20876 315
460 3300049575 Ga0501039_0019301 Ga0501039_0019301_141_1214 315
461 3300049579 Ga0501043_0030136 Ga0501043_0030136_2010_3083 315
462 3300049580 Ga0501046_0002375 Ga0501046_0002375_10284_11357 315
463 3300049580 Ga0501046_0069743 Ga0501046_0069743_760_1743 315
464 3300049581 Ga0501047_0001336 Ga0501047_0001336_9905_10978 315
465 3300049581 Ga0501047_0193738 Ga0501047_0193738_30_1013 315
466 3300049582 Ga0501048_0309996 Ga0501048_0309996_24_1007 315
467 3300049583 Ga0501067_0090640 Ga0501067_0090640_587_1660 315
468 3300049584 Ga0501068_0012788 Ga0501068_0012788_2432_3505 315
469 3300049585 Ga0501069_0136628 Ga0501069_0136628_51_1124 315
470 3300049588 Ga0501072_0302978 Ga0501072_0302978_232_1215 315
471 3300049589 Ga0501073_0043700 Ga0501073_0043700_1591_2664 315
472 3300049742 Ga0501080_0002399 Ga0501080_0002399_9158_10231 315
473 3300049758 Ga0501241_013729 Ga0501241_013729_435_1397 315
474 3300049823 Ga0501044_0042146 Ga0501044_0042146_2138_3211 315
475 3300049823 Ga0501044_0193935 Ga0501044_0193935_884_1867 315
476 3300050493 nmdc:mga0k408_98499_c1 nmdc:mga0k408_98499_c1_326_1291 315
477 3300050494 nmdc:mga06z11_47_c1 nmdc:mga06z11_47_c1_5865_6818 315
478 3300050495 nmdc:mga04h51_18_c1 nmdc:mga04h51_18_c1_27308_28261 315
479 3300053079 Ga0500610_0000607 Ga0500610_0000607_6948_7937 315
480 3300053087 Ga0500643_001242 Ga0500643_001242_8546_9517 315
481 3300053087 Ga0500643_046710 Ga0500643_046710_72_1019 315
482 3300053093 Ga0500651_0022471 Ga0500651_0022471_1260_2312 315
483 3300053094 Ga0500566_0006685 Ga0500566_0006685_4197_5159 315
484 3300053108 Ga0500562_003564 Ga0500562_003564_2580_3572 315
485 3300053119 Ga0500595_001506 Ga0500595_001506_2134_3081 315
486 3300053130 Ga0500642_0004805 Ga0500642_0004805_1199_2146 315
487 3300053133 Ga0500655_000422 Ga0500655_000422_220_1272 315
488 3300053140 Ga0500573_0000086 Ga0500573_0000086_22780_23730 315
489 3300053148 Ga0500590_082605 Ga0500590_082605_122_1081 315
490 3300053156 Ga0500622_0062020 Ga0500622_0062020_187_1239 315
491 3300053177 Ga0500636_0072405 Ga0500636_0072405_637_1689 315
492 3300053724 Ga0500570_000114 Ga0500570_000114_1317_2282 315
493 3300053730 Ga0500645_000002 Ga0500645_000002_348928_349917 315
494 3300053730 Ga0500645_002885 Ga0500645_002885_2511_3485 315
495 3300053730 Ga0500645_046518 Ga0500645_046518_231_1223 315
496 3300053733 Ga0500552_005812 Ga0500552_005812_262_1221 315
497 3300053735 Ga0500596_003355 Ga0500596_003355_10_957 315
498 3300060353 Ga0501082_0090397 Ga0501082_0090397_973_2046 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

33

114

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

192

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

223

0.81

PF07993

NAD_binding_4

Male sterility protein

46

185

0.79

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

182

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

212

0.73

PF13460

NAD_binding_10

NAD(P)H-binding

7

213

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly3.cif.gz_F mouse tdh mutant r180k with nad+ bound 0.8527 2 225
4yrb-assembly1.cif.gz_A mouse tdh mutant r180k with nad+ bound 0.8412 2 226
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8217 2 298
1kj9-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with mg-atp 0.82 1 66
4yrb-assembly1.cif.gz_B mouse tdh mutant r180k with nad+ bound 0.8105 2 236
ID Description Score Start End Superfamily
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 1 300 3.40.50.720
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 1 300 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8721 1 225 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8708 1 225 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8679 1 225 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527ZEG2-F1-model_v4 NAD(P)-dependent oxidoreductase 1.001 1 94
AF-A0A4Q3J4J0-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9975 64 314
AF-A0A443GX30-F1-model_v4 deleted 0.9955 1 112
AF-A0A1R3VMN7-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9946 1 100
AF-A0A1L9QL27-F1-model_v4 NAD-dependent epimerase/dehydratase 0.99 2 314

Feature Viewer

pLDDT pTM Quality
94.93 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map