F454899

General Info

Members Datasets Scaffolds Average Seq Length
496 259 992 260

Family's Representative Sequence

Representative Sequence 3300020080|Ga0206350_10756176|Ga0206350_107561762
Length 305
Sequence MADKNELIIRDLHVNVEDKEILHGINLHVKPGEVHVIMGPNGSGKSTLSNALMGHPRYTVTSGEIEFQGEVINNLSPDRRARRGIFLAFQNPLAVPGVTVTNFLRTALTNRRKGDVPPEVRPQNLDVVGDRPVYETKKASLGGDGANIDRKKRQTLISPKEFRSILKDKLSLLKMDEKFTRRYLNDGFSGGEKKRLEVLQMAVLEPKVAFLDEPDSGLDIDAIRIVGEGVNALRGKEMAIVVITHQQRILSYLDVDYVHVMMQGNIVKEGGSELSREIEEKGYGWIREELGIQPTLEEVREEVGV

Samples

Sample ID Description Type Environment
1 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
171 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.1
Metatranscriptomes 11.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 5.24
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206350_10756176 3300020080 Bacteria 2684
2 JGI25406J46586_10032073 3300003203 Bacteria 1957
3 JGI25407J50210_10001361 3300003373 Bacteria 5529
4 JGI25407J50210_10004649 3300003373 Bacteria 3345
5 JGI25407J50210_10046347 3300003373 Bacteria 1107
6 JGI25407J50210_10052098 3300003373 Bacteria 1036
7 Ga0058863_10063941 3300004799 Bacteria 2519
8 Ga0058863_11963593 3300004799 Bacteria 2569
9 Ga0058861_12075991 3300004800 Bacteria 3119
10 Ga0058860_12232752 3300004801 Bacteria 4933
11 Ga0058862_12839065 3300004803 Bacteria 2961
12 Ga0058862_12867370 3300004803 Bacteria 3401
13 Ga0070658_10029234 3300005327 Bacteria 4427
14 Ga0070683_100526624 3300005329 Bacteria 1130
15 Ga0070670_100117916 3300005331 Bacteria 2289
16 Ga0068868_100164327 3300005338 Bacteria 1835
17 Ga0070691_10005778 3300005341 Bacteria 5645
18 Ga0070687_100020939 3300005343 Bacteria 3066
19 Ga0070661_100038877 3300005344 Bacteria 3465
20 Ga0070661_100042593 3300005344 Bacteria 3314
21 Ga0070668_100027717 3300005347 Bacteria 4300
22 Ga0070674_100137991 3300005356 Bacteria 1827
23 Ga0070659_100044560 3300005366 Bacteria 3473
24 Ga0070713_100003027 3300005436 Bacteria 11039
25 Ga0070713_100118440 3300005436 Bacteria 2319
26 Ga0070711_100005147 3300005439 Bacteria 7793
27 Ga0070700_100019443 3300005441 Bacteria 3919
28 Ga0070708_100190544 3300005445 Bacteria 1918
29 Ga0070662_100025400 3300005457 Bacteria 4090
30 Ga0070681_10026484 3300005458 Bacteria 5827
31 Ga0070681_10071219 3300005458 Bacteria 3441
32 Ga0070681_10144289 3300005458 Bacteria 2310
33 Ga0070706_100001383 3300005467 Bacteria 25747
34 Ga0070706_100006470 3300005467 Bacteria 11058
35 Ga0070706_100034927 3300005467 Bacteria 4642
36 Ga0070706_100067605 3300005467 Bacteria 3305
37 Ga0070706_100106128 3300005467 Bacteria 2613
38 Ga0070707_100001466 3300005468 Bacteria 23117
39 Ga0070707_100083511 3300005468 Bacteria 3086
40 Ga0070707_100094093 3300005468 Bacteria 2901
41 Ga0070707_100414843 3300005468 Bacteria 1307
42 Ga0070698_100020900 3300005471 Bacteria 6859
43 Ga0070698_100042205 3300005471 Bacteria 4678
44 Ga0070698_100080071 3300005471 Bacteria 3262
45 Ga0070698_100123046 3300005471 Bacteria 2552
46 Ga0070698_100172488 3300005471 Bacteria 2103
47 Ga0070698_100236025 3300005471 Bacteria 1762
48 Ga0070699_100045379 3300005518 Bacteria 3803
49 Ga0070699_100103722 3300005518 Bacteria 2494
50 Ga0070699_100387113 3300005518 Bacteria 1263
51 Ga0070699_100401416 3300005518 Bacteria 1239
52 Ga0070679_100021266 3300005530 Bacteria 6331
53 Ga0070679_100111822 3300005530 Bacteria 2717
54 Ga0070679_100138519 3300005530 Bacteria 2414
55 Ga0070697_100006878 3300005536 Bacteria 8837
56 Ga0070697_100129329 3300005536 Bacteria 2117
57 Ga0070686_100475923 3300005544 Bacteria 965
58 Ga0070696_100385068 3300005546 Bacteria 1094
59 Ga0068855_100080145 3300005563 Bacteria 3786
60 Ga0068855_100472356 3300005563 Bacteria 1366
61 Ga0070664_100037519 3300005564 Bacteria 4075
62 Ga0070664_100437810 3300005564 Bacteria 1199
63 Ga0068857_100017491 3300005577 Bacteria 6283
64 Ga0068854_100201786 3300005578 Bacteria 1564
65 Ga0068854_100428944 3300005578 Bacteria 1100
66 Ga0068856_100024071 3300005614 Bacteria 5925
67 Ga0068856_100119826 3300005614 Bacteria 2633
68 Ga0068856_100343473 3300005614 Bacteria 1511
69 Ga0068856_100688498 3300005614 Bacteria 1043
70 Ga0070702_100212041 3300005615 Bacteria 1290
71 Ga0068864_100334398 3300005618 Bacteria 1426
72 Ga0068864_100617812 3300005618 Bacteria 1053
73 Ga0068861_100145608 3300005719 Bacteria 1938
74 Ga0081455_10022910 3300005937 Bacteria 5823
75 Ga0081455_10023768 3300005937 Bacteria 5694
76 Ga0081538_10000042 3300005981 Bacteria 115656
77 Ga0081538_10000098 3300005981 Bacteria 84863
78 Ga0081538_10000270 3300005981 Bacteria 59449
79 Ga0081538_10001427 3300005981 Bacteria 24558
80 Ga0081538_10002696 3300005981 Bacteria 17076
81 Ga0081538_10003459 3300005981 Bacteria 14912
82 Ga0081538_10003664 3300005981 Bacteria 14435
83 Ga0081538_10004160 3300005981 Bacteria 13429
84 Ga0081538_10005925 3300005981 Bacteria 10887
85 Ga0081538_10010591 3300005981 Bacteria 7550
86 Ga0081538_10016665 3300005981 Bacteria 5620
87 Ga0081538_10027144 3300005981 Bacteria 3979
88 Ga0081538_10195003 3300005981 Bacteria 842
89 Ga0070717_10094170 3300006028 Bacteria 2533
90 Ga0070717_10121573 3300006028 Bacteria 2237
91 Ga0075363_100292681 3300006048 Bacteria 944
92 Ga0070716_100141706 3300006173 Bacteria 1534
93 Ga0070712_100110794 3300006175 Bacteria 2048
94 Ga0070712_100410376 3300006175 Bacteria 1120
95 Ga0075428_100000551 3300006844 Bacteria 38313
96 Ga0075428_100020060 3300006844 Bacteria 7402
97 Ga0075428_100022408 3300006844 Bacteria 6994
98 Ga0075428_100043843 3300006844 Bacteria 4918
99 Ga0075428_100084872 3300006844 Bacteria 3454
100 Ga0075430_100000024 3300006846 Bacteria 80210
101 Ga0075430_100013037 3300006846 Bacteria 7085
102 Ga0075430_100041834 3300006846 Bacteria 3876
103 Ga0075430_100583212 3300006846 Bacteria 922
104 Ga0075431_100002303 3300006847 Bacteria 18341
105 Ga0075431_100014133 3300006847 Bacteria 8071
106 Ga0075431_100185470 3300006847 Bacteria 2133
107 Ga0075431_100234980 3300006847 Bacteria 1866
108 Ga0075431_100310496 3300006847 Bacteria 1592
109 Ga0075433_10692688 3300006852 Bacteria 893
110 Ga0075429_100010612 3300006880 Bacteria 7970
111 Ga0075429_100018025 3300006880 Bacteria 6106
112 Ga0075436_100011335 3300006914 Bacteria 6116
113 Ga0075436_100172391 3300006914 Bacteria 1528
114 Ga0105240_10038914 3300009093 Bacteria 6096
115 Ga0105240_10994965 3300009093 Bacteria 897
116 Ga0111539_10017102 3300009094 Bacteria 8977
117 Ga0111539_10253055 3300009094 Bacteria 2051
118 Ga0111539_10320896 3300009094 Bacteria 1802
119 Ga0111539_10884237 3300009094 Bacteria 1039
120 Ga0105245_10035334 3300009098 Bacteria 4435
121 Ga0105245_10438875 3300009098 Bacteria 1312
122 Ga0105247_10129401 3300009101 Bacteria 1644
123 Ga0114129_10003125 3300009147 Bacteria 23224
124 Ga0114129_10033761 3300009147 Bacteria 7228
125 Ga0114129_10211769 3300009147 Bacteria 2620
126 Ga0105242_10011104 3300009176 Bacteria 6922
127 Ga0105237_10001168 3300009545 Bacteria 35077
128 Ga0105237_10147499 3300009545 Bacteria 2348
129 Ga0105237_10703866 3300009545 Bacteria 1017
130 Ga0105249_10003298 3300009553 Bacteria 13982
131 Ga0105239_10356108 3300010375 Bacteria 1652
132 Ga0154016_116235 3300013045 Bacteria 2732
133 Ga0157370_10047447 3300013104 Bacteria 4117
134 Ga0157374_10021233 3300013296 Bacteria 5773
135 Ga0163162_10030194 3300013306 Bacteria 5371
136 Ga0157372_10072934 3300013307 Bacteria 3869
137 Ga0157372_10119288 3300013307 Bacteria 3028
138 Ga0157372_10183073 3300013307 Bacteria 2425
139 Ga0157375_10563518 3300013308 Bacteria 1300
140 Ga0157380_10756112 3300014326 Bacteria 984
141 Ga0157376_10281123 3300014969 Bacteria 1567
142 Ga0182007_10012991 3300015262 Bacteria 3190
143 Ga0182007_10086183 3300015262 Bacteria 1032
144 Ga0163161_10580107 3300017792 Bacteria 922
145 Ga0197907_10746922 3300020069 Bacteria 1177
146 Ga0197907_10818165 3300020069 Bacteria 2566
147 Ga0197907_11331894 3300020069 Bacteria 3910
148 Ga0206356_10189296 3300020070 Bacteria 1376
149 Ga0206356_10220869 3300020070 Bacteria 3615
150 Ga0206349_1395013 3300020075 Bacteria 2962
151 Ga0206349_1518133 3300020075 Bacteria 1675
152 Ga0206355_1206627 3300020076 Bacteria 3023
153 Ga0206355_1272512 3300020076 Bacteria 1157
154 Ga0206351_10058212 3300020077 Bacteria 1602
155 Ga0206351_10582120 3300020077 Bacteria 3718
156 Ga0206351_10587411 3300020077 Bacteria 1671
157 Ga0206352_11041036 3300020078 Bacteria 9433
158 Ga0206352_11204717 3300020078 Bacteria 3223
159 Ga0206350_10040769 3300020080 Bacteria 3340
160 Ga0206350_10071761 3300020080 Bacteria 1151
161 Ga0206350_10399709 3300020080 Bacteria 4798
162 Ga0206350_11044585 3300020080 Bacteria 4697
163 Ga0206350_11044920 3300020080 Bacteria 4078
164 Ga0206350_11600899 3300020080 Bacteria 1434
165 Ga0206350_11642325 3300020080 Bacteria 1572
166 Ga0206354_10128226 3300020081 Bacteria 3615
167 Ga0206354_10742351 3300020081 Bacteria 1459
168 Ga0206354_11705756 3300020081 Bacteria 2691
169 Ga0206353_10080410 3300020082 Bacteria 2702
170 Ga0206353_11122905 3300020082 Bacteria 1132
171 Ga0206353_11252580 3300020082 Bacteria 2195
172 Ga0154015_1453172 3300020610 Bacteria 3125
173 Ga0213874_10000320 3300021377 Bacteria 9520
174 Ga0213874_10012036 3300021377 Bacteria 2209
175 Ga0213876_10035503 3300021384 Bacteria 2629
176 Ga0213875_10027392 3300021388 Bacteria 2711
177 Ga0213871_10054362 3300021441 Bacteria 1104
178 Ga0224712_10001105 3300022467 Bacteria 5973
179 Ga0224712_10006948 3300022467 Bacteria 3265
180 Ga0224712_10007354 3300022467 Bacteria 3203
181 Ga0224712_10028612 3300022467 Bacteria 1994
182 Ga0224712_10049031 3300022467 Bacteria 1633
183 Ga0224712_10052157 3300022467 Bacteria 1596
184 Ga0224712_10052599 3300022467 Bacteria 1591
185 Ga0224712_10067592 3300022467 Bacteria 1442
186 Ga0224712_10072352 3300022467 Bacteria 1403
187 Ga0207710_10129708 3300025900 Bacteria 1210
188 Ga0207680_10283542 3300025903 Bacteria 1151
189 Ga0207684_10000522 3300025910 Bacteria 47590
190 Ga0207684_10013421 3300025910 Bacteria 7088
191 Ga0207707_10004423 3300025912 Bacteria 12388
192 Ga0207707_10068676 3300025912 Bacteria 3088
193 Ga0207695_10014458 3300025913 Bacteria 9348
194 Ga0207671_10000921 3300025914 Bacteria 36898
195 Ga0207693_10058695 3300025915 Bacteria 3014
196 Ga0207693_10284585 3300025915 Bacteria 1295
197 Ga0207663_10008771 3300025916 Bacteria 5311
198 Ga0207657_10052940 3300025919 Bacteria 3520
199 Ga0207657_10093248 3300025919 Bacteria 2508
200 Ga0207652_10008669 3300025921 Bacteria 8186
201 Ga0207652_10017135 3300025921 Bacteria 5925
202 Ga0207652_10082989 3300025921 Bacteria 2805
203 Ga0207646_10000708 3300025922 Bacteria 43282
204 Ga0207646_10031723 3300025922 Bacteria 4782
205 Ga0207646_10241141 3300025922 Bacteria 1633
206 Ga0207646_10329238 3300025922 Bacteria 1380
207 Ga0207650_10016271 3300025925 Bacteria 5195
208 Ga0207687_10027422 3300025927 Bacteria 3821
209 Ga0207700_10003147 3300025928 Bacteria 9524
210 Ga0207700_10247078 3300025928 Bacteria 1523
211 Ga0207700_10682619 3300025928 Bacteria 916
212 Ga0207664_10008169 3300025929 Bacteria 7287
213 Ga0207690_10083524 3300025932 Bacteria 2236
214 Ga0207706_10009656 3300025933 Bacteria 8856
215 Ga0207669_10097868 3300025937 Bacteria 1931
216 Ga0207665_10261011 3300025939 Bacteria 1283
217 Ga0207665_10340332 3300025939 Bacteria 1130
218 Ga0207679_10025232 3300025945 Bacteria 4086
219 Ga0207667_10042300 3300025949 Bacteria 4844
220 Ga0207667_10170868 3300025949 Bacteria 2234
221 Ga0207712_10109048 3300025961 Bacteria 2073
222 Ga0207668_10081544 3300025972 Bacteria 2347
223 Ga0207640_10246000 3300025981 Bacteria 1385
224 Ga0207677_10099819 3300026023 Bacteria 2133
225 Ga0207708_10034923 3300026075 Bacteria 3825
226 Ga0207708_10056791 3300026075 Bacteria 2986
227 Ga0207708_10063650 3300026075 Bacteria 2818
228 Ga0207702_10099209 3300026078 Bacteria 2567
229 Ga0207702_10294958 3300026078 Bacteria 1537
230 Ga0207648_10140856 3300026089 Bacteria 2125
231 Ga0207676_10311100 3300026095 Bacteria 1442
232 Ga0207674_10045062 3300026116 Bacteria 4539
233 Ga0207675_100000627 3300026118 Bacteria 34607
234 Ga0207698_10036207 3300026142 Bacteria 3620
235 Ga0207428_10083948 3300027907 Bacteria 2483
236 Ga0207428_10239080 3300027907 Bacteria 1357
237 Ga0268266_10021719 3300028379 Bacteria 5470
238 Ga0268265_10698686 3300028380 Bacteria 980
239 Ga0265337_1003128 3300028556 Bacteria 7291
240 Ga0265326_10002279 3300028558 Bacteria 6491
241 Ga0265319_1000796 3300028563 Bacteria 20409
242 Ga0265319_1019709 3300028563 Bacteria 2513
243 Ga0265318_10003759 3300028577 Bacteria 7552
244 Ga0265318_10007122 3300028577 Bacteria 5085
245 Ga0265322_10021983 3300028654 Bacteria 1826
246 Ga0265336_10000060 3300028666 Bacteria 103055
247 Ga0265338_10000234 3300028800 Bacteria 103028
248 Ga0265338_10006019 3300028800 Bacteria 15583
249 Ga0265338_10042856 3300028800 Bacteria 4207
250 Ga0265338_10089975 3300028800 Bacteria 2542
251 Ga0265324_10052147 3300029957 Bacteria 1405
252 Ga0265340_10000014 3300031247 Bacteria 103055
253 Ga0265327_10012748 3300031251 Bacteria 5644
254 Ga0265316_10043399 3300031344 Bacteria 3584
255 Ga0307408_100157555 3300031548 Bacteria 1800
256 Ga0307408_100191203 3300031548 Bacteria 1649
257 Ga0316579_10021260 3300031691 Bacteria 2889
258 Ga0316579_10157016 3300031691 Bacteria 1099
259 Ga0265314_10015093 3300031711 Bacteria 6144
260 Ga0265342_10016297 3300031712 Bacteria 4862
261 Ga0316576_10024453 3300031727 Bacteria 4218
262 Ga0316576_10094811 3300031727 Bacteria 2226
263 Ga0316577_10013793 3300031733 Bacteria 4428
264 Ga0316577_10016927 3300031733 Bacteria 4023
265 Ga0316577_10076071 3300031733 Bacteria 1874
266 Ga0316577_10079253 3300031733 Bacteria 1835
267 Ga0307413_10348671 3300031824 Bacteria 1141
268 Ga0307410_10316669 3300031852 Bacteria 1236
269 Ga0307410_10445205 3300031852 Bacteria 1055
270 Ga0307406_10161486 3300031901 Bacteria 1611
271 Ga0307407_10026880 3300031903 Bacteria 3054
272 Ga0307409_100061915 3300031995 Bacteria 2927
273 Ga0307409_100176584 3300031995 Bacteria 1886
274 Ga0307409_100185160 3300031995 Bacteria 1847
275 Ga0307409_100486698 3300031995 Bacteria 1198
276 Ga0307416_100011205 3300032002 Bacteria 5961
277 Ga0307416_100129546 3300032002 Bacteria 2268
278 Ga0307416_100230354 3300032002 Bacteria 1785
279 Ga0307416_100265058 3300032002 Bacteria 1682
280 Ga0307415_100101071 3300032126 Bacteria 2115
281 Ga0307415_100222775 3300032126 Bacteria 1513
282 Ga0307415_100348500 3300032126 Bacteria 1245
283 Ga0316593_10000356 3300032168 Bacteria 8042
284 Ga0316593_10002269 3300032168 Bacteria 4506
285 Ga0316593_10003572 3300032168 Bacteria 3881
286 Ga0316593_10004580 3300032168 Bacteria 3565
287 Ga0316593_10013458 3300032168 Bacteria 2423
288 Ga0316593_10013882 3300032168 Bacteria 2391
289 Ga0316593_10022836 3300032168 Bacteria 1970
290 Ga0316593_10037090 3300032168 Bacteria 1609
291 Ga0316593_10075839 3300032168 Bacteria 1168
292 Ga0316593_10085385 3300032168 Bacteria 1106
293 Ga0316593_10105421 3300032168 Bacteria 1003
294 Ga0316596_1005978 3300033541 Bacteria 2807
295 Ga0373952_0022035 3300035092 Bacteria 1350
296 Ga0373939_0108636 3300035114 Bacteria 963
297 Ga0373956_0000748 3300035119 Bacteria 13414
298 Ga0373955_0118673 3300035172 Bacteria 1536
299 Ga0373961_0002373 3300035241 Bacteria 4908
300 Ga0316574_0123568 3300035398 Bacteria 1663
301 Ga0373931_0073823 3300035691 Bacteria 1867
302 Ga0373927_0000168 3300035695 Bacteria 51478
303 Ga0373927_0004412 3300035695 Bacteria 9863
304 Ga0373933_0022841 3300035724 Bacteria 3567
305 Ga0373947_0315555 3300035725 Bacteria 1044
306 Ga0373947_0387603 3300035725 Bacteria 941
307 Ga0373937_0175088 3300036401 Bacteria 2014
308 Ga0373937_0862656 3300036401 Bacteria 854
309 Ga0316582_0054810 3300036647 Bacteria 2540
310 Ga0316582_0143456 3300036647 Bacteria 1611
311 Ga0316584_0008814 3300036712 Bacteria 6969
312 Ga0316584_0024235 3300036712 Bacteria 4439
313 Ga0316584_0025252 3300036712 Bacteria 4356
314 Ga0316584_0027177 3300036712 Bacteria 4210
315 Ga0316584_0052464 3300036712 Bacteria 3050
316 Ga0316584_0126832 3300036712 Bacteria 1906
317 Ga0373925_0001237 3300037068 Bacteria 22546
318 Ga0373925_0215175 3300037068 Bacteria 1532
319 Ga0395900_0026763 3300037418 Bacteria 5903
320 Ga0395900_0181170 3300037418 Bacteria 2141
321 Ga0395900_0310445 3300037418 Bacteria 1560
322 Ga0395898_0347288 3300037466 Bacteria 1415
323 Ga0395905_0245904 3300037471 Bacteria 1671
324 Ga0436364_0453118 3300037853 Bacteria 8434
325 Ga0436364_1049004 3300037853 Bacteria 954
326 Ga0395901_0057864 3300038443 Bacteria 4032
327 Ga0395901_0125443 3300038443 Bacteria 2698
328 Ga0436365_0681063 3300039437 Bacteria 33078
329 Ga0436365_1320219 3300039437 Bacteria 1716
330 Ga0436360_0605802 3300039438 Bacteria 4501
331 Ga0436363_0191611 3300039450 Bacteria 1025
332 Ga0436363_0240724 3300039450 Bacteria 54848
333 Ga0436363_1443790 3300039450 Bacteria 16352
334 Ga0436362_0639313 3300039453 Bacteria 2176
335 Ga0439448_0078507 3300042005 Bacteria 1106
336 Ga0439448_0089337 3300042005 Bacteria 1040
337 Ga0439450_046230 3300042008 Bacteria 1024
338 Ga0439454_016262 3300042011 Bacteria 1050
339 Ga0466969_0003183 3300044656 Bacteria 8752
340 Ga0466969_0029866 3300044656 Unclassified 2781
341 Ga0466972_0041150 3300044658 Bacteria 2250
342 Ga0466965_0157917 3300044683 Bacteria 1188
343 Ga0466966_0004952 3300044684 Bacteria 8752
344 Ga0466966_0061263 3300044684 Unclassified 2374
345 Ga0466966_0302867 3300044684 Bacteria 960
346 Ga0466966_0404964 3300044684 Bacteria 820
347 Ga0466961_0083089 3300044693 Unclassified 2025
348 Ga0466963_0001284 3300044694 Bacteria 13335
349 Ga0466963_0001348 3300044694 Bacteria 13110
350 Ga0466963_0436802 3300044694 Bacteria 923
351 Ga0466964_0000514 3300044706 Bacteria 12063
352 Ga0453684_0000021 3300044712 Bacteria 873490
353 Ga0453684_0021189 3300044712 Bacteria 9730
354 Ga0453684_0025901 3300044712 Bacteria 8494
355 Ga0453684_0070977 3300044712 Bacteria 4407
356 Ga0466971_0001737 3300044719 Bacteria 9226
357 Ga0466971_0010932 3300044719 Bacteria 3970
358 Ga0466971_0252820 3300044719 Bacteria 840
359 Ga0466968_0002067 3300044735 Bacteria 7311
360 Ga0466970_0002587 3300044765 Bacteria 8718
361 Ga0466970_0024339 3300044765 Bacteria 3165
362 Ga0466970_0103830 3300044765 Bacteria 1549
363 Ga0466970_0142453 3300044765 Bacteria 1321
364 Ga0466957_0002456 3300044842 Bacteria 9949
365 Ga0466957_0019140 3300044842 Bacteria 4026
366 Ga0466957_0068064 3300044842 Bacteria 2197
367 Ga0466957_0119474 3300044842 Bacteria 1679
368 Ga0466959_0022008 3300045049 Bacteria 4709
369 Ga0466959_0028481 3300045049 Bacteria 4142
370 Ga0466959_0369367 3300045049 Bacteria 977
371 Ga0451576_0098059 3300045051 Bacteria 3048
372 Ga0451576_0109071 3300045051 Bacteria 2880
373 Ga0466958_0076184 3300045836 Bacteria 2059
374 Ga0466967_0002467 3300045976 Bacteria 11525
375 Ga0466967_0013731 3300045976 Bacteria 6274
376 Ga0466967_0168104 3300045976 Bacteria 2061
377 Ga0495629_0060442 3300046459 Bacteria 2649
378 Ga0495653_0000231 3300046463 Bacteria 45492
379 Ga0495580_0122128 3300046472 Bacteria 1808
380 Ga0495664_0000086 3300046477 Bacteria 45525
381 Ga0495585_0087560 3300046492 Bacteria 1681
382 Ga0495596_0033185 3300046500 Bacteria 2054
383 Ga0495618_0000054 3300046514 Bacteria 83787
384 Ga0495630_0000328 3300046517 Bacteria 37847
385 Ga0495642_0042351 3300046528 Bacteria 1855
386 Ga0495586_0011853 3300046535 Bacteria 4633
387 Ga0495586_0038716 3300046535 Bacteria 2562
388 Ga0495645_0000088 3300046543 Bacteria 63785
389 Ga0495645_0000535 3300046543 Bacteria 26139
390 Ga0495634_0178879 3300046642 Bacteria 1329
391 Ga0495588_0136568 3300046674 Bacteria 1295
392 Ga0495657_0000006 3300046675 Bacteria 250610
393 Ga0495646_0061992 3300046680 Bacteria 2225
394 Ga0495647_0192618 3300046681 Bacteria 891
395 Ga0495613_0237444 3300046689 Bacteria 1275
396 Ga0495600_0040220 3300046809 Bacteria 3045
397 Ga0495581_0169983 3300047315 Bacteria 1275
398 Ga0495672_0114541 3300047320 Bacteria 1442
399 Ga0495676_0043753 3300047321 Bacteria 3661
400 Ga0495680_0161792 3300047322 Bacteria 1625
401 Ga0495684_0002596 3300047471 Bacteria 14354
402 Ga0495615_0117305 3300048090 Bacteria 767
403 Ga0496100_0009467 3300048903 Bacteria 5475
404 Ga0496101_0045104 3300048904 Bacteria 3157
405 Ga0496101_0212920 3300048904 Bacteria 1497
406 Ga0496102_0000096 3300048905 Bacteria 124941
407 Ga0496102_0120946 3300048905 Bacteria 2445
408 Ga0496103_0000035 3300048906 Bacteria 182242
409 Ga0496103_0101615 3300048906 Bacteria 1820
410 Ga0496103_0107398 3300048906 Bacteria 1770
411 Ga0496104_0000034 3300048907 Bacteria 186572
412 Ga0496105_0060414 3300048908 Bacteria 3127
413 Ga0496107_0045550 3300048910 Bacteria 3155
414 Ga0496107_0168052 3300048910 Bacteria 1627
415 Ga0496107_0398772 3300048910 Bacteria 1023
416 Ga0496108_0249664 3300048911 Bacteria 1543
417 Ga0496109_0002551 3300048912 Bacteria 15262
418 Ga0496110_0001995 3300048913 Bacteria 15182
419 Ga0496110_0035084 3300048913 Bacteria 4349
420 Ga0496111_0015657 3300048914 Bacteria 5211
421 Ga0496111_0163009 3300048914 Bacteria 1656
422 Ga0496112_0003066 3300048915 Bacteria 13688
423 Ga0496113_0003146 3300048916 Bacteria 9821
424 Ga0496113_0157705 3300048916 Bacteria 1793
425 Ga0496114_0027751 3300048917 Bacteria 4640
426 Ga0496114_0138792 3300048917 Bacteria 2103
427 Ga0496115_0008929 3300048918 Bacteria 7433
428 Ga0496115_0015290 3300048918 Bacteria 5819
429 Ga0501034_0210196 3300049571 Bacteria 1901
430 Ga0501037_0081852 3300049573 Bacteria 2340
431 Ga0501039_0159805 3300049575 Bacteria 1771
432 Ga0501039_0379269 3300049575 Bacteria 1111
433 Ga0501041_0026839 3300049577 Bacteria 3468
434 Ga0501047_0077674 3300049581 Bacteria 3193
435 Ga0501047_0142853 3300049581 Bacteria 2271
436 Ga0501047_0197071 3300049581 Bacteria 1876
437 Ga0501048_0142650 3300049582 Bacteria 1694
438 Ga0501069_0060839 3300049585 Bacteria 2108
439 Ga0501070_0152767 3300049586 Bacteria 1904
440 Ga0501070_0239662 3300049586 Bacteria 1485
441 Ga0501071_0352009 3300049587 Bacteria 1121
442 Ga0501071_0539599 3300049587 Bacteria 895
443 Ga0501072_0061766 3300049588 Bacteria 2955
444 Ga0501074_0018034 3300049590 Bacteria 5127
445 Ga0501074_0118526 3300049590 Bacteria 1893
446 Ga0501074_0219061 3300049590 Bacteria 1355
447 Ga0501074_0275113 3300049590 Bacteria 1197
448 Ga0501074_0353651 3300049590 Bacteria 1043
449 Ga0501075_0193323 3300049591 Bacteria 1552
450 Ga0501075_0260824 3300049591 Bacteria 1321
451 Ga0501075_0270862 3300049591 Bacteria 1294
452 Ga0501076_0055315 3300049592 Bacteria 3147
453 Ga0501076_0080358 3300049592 Bacteria 2617
454 Ga0501076_0319598 3300049592 Bacteria 1273
455 Ga0501079_0142824 3300049741 Bacteria 1865
456 Ga0501080_0260376 3300049742 Bacteria 1580
457 Ga0501080_0275447 3300049742 Bacteria 1531
458 Ga0501044_0019096 3300049823 Bacteria 7339
459 Ga0501044_0456177 3300049823 Bacteria 1184
460 Ga0501045_0021485 3300049824 Bacteria 4617
461 Ga0501045_0062859 3300049824 Bacteria 2724
462 Ga0501045_0119128 3300049824 Bacteria 1960
463 nmdc:mga05p37_189517_c1 3300050507 Bacteria 2498
464 nmdc:mga05p37_736_c1 3300050507 Bacteria 36292
465 nmdc:mga05p37_9802_c1 3300050507 Bacteria 11368
466 nmdc:mga09592_501961_c1 3300050508 Bacteria 1044
467 nmdc:mga09592_5132_c1 3300050508 Bacteria 10642
468 nmdc:mga09592_532348_c1 3300050508 Bacteria 1010
469 nmdc:mga0qj67_114953_c1 3300050509 Bacteria 1467
470 nmdc:mga0qj67_7113_c1 3300050509 Bacteria 8257
471 nmdc:mga0qj67_908_c1 3300050509 Bacteria 20357
472 nmdc:mga06r32_162736_c1 3300050510 Bacteria 2214
473 nmdc:mga06r32_283707_c1 3300050510 Bacteria 1643
474 nmdc:mga06r32_306924_c1 3300050510 Bacteria 1572
475 nmdc:mga08y16_103469_c1 3300050511 Bacteria 2965
476 nmdc:mga08y16_182296_c1 3300050511 Bacteria 2180
477 nmdc:mga08y16_233592_c1 3300050511 Bacteria 1902
478 nmdc:mga08y16_563154_c1 3300050511 Bacteria 1152
479 nmdc:mga08y16_747950_c1 3300050511 Bacteria 974
480 nmdc:mga0n895_688267_c1 3300050512 Bacteria 1019
481 nmdc:mga0n895_725311_c1 3300050512 Bacteria 988
482 nmdc:mga08x19_12700_c1 3300050514 Bacteria 5079
483 nmdc:mga08x19_239790_c1 3300050514 Bacteria 1249
484 nmdc:mga0a205_52814_c1 3300050515 Bacteria 3922
485 Ga0495601_0000673 3300053077 Bacteria 18239
486 Ga0495601_0025531 3300053077 Bacteria 3644
487 Ga0495612_0031273 3300053078 Bacteria 2146
488 Ga0500637_0048336 3300053178 Bacteria 2419
489 Ga0587082_010855 3300059504 Bacteria 1323
490 Ga0587083_0015930 3300059505 Bacteria 1321
491 Ga0501082_0273492 3300060353 Bacteria 1470
492 Ga0466962_0006796 3300061719 Bacteria 5489
493 Ga0530510_0049984 3300061734 Bacteria 3020
494 Ga0530510_0157504 3300061734 Bacteria 1679
495 Ga0530510_0175447 3300061734 Bacteria 1588
496 Ga0530510_0869373 3300061734 Bacteria 689
497 Ga0206350_10756176
498 JGI25406J46586_10032073
499 JGI25407J50210_10001361
500 JGI25407J50210_10004649
501 JGI25407J50210_10046347
502 JGI25407J50210_10052098
503 Ga0058863_10063941
504 Ga0058863_11963593
505 Ga0058861_12075991
506 Ga0058860_12232752
507 Ga0058862_12839065
508 Ga0058862_12867370
509 Ga0070658_10029234
510 Ga0070683_100526624
511 Ga0070670_100117916
512 Ga0068868_100164327
513 Ga0070691_10005778
514 Ga0070687_100020939
515 Ga0070661_100038877
516 Ga0070661_100042593
517 Ga0070668_100027717
518 Ga0070674_100137991
519 Ga0070659_100044560
520 Ga0070713_100003027
521 Ga0070713_100118440
522 Ga0070711_100005147
523 Ga0070700_100019443
524 Ga0070708_100190544
525 Ga0070662_100025400
526 Ga0070681_10026484
527 Ga0070681_10071219
528 Ga0070681_10144289
529 Ga0070706_100001383
530 Ga0070706_100006470
531 Ga0070706_100034927
532 Ga0070706_100067605
533 Ga0070706_100106128
534 Ga0070707_100001466
535 Ga0070707_100083511
536 Ga0070707_100094093
537 Ga0070707_100414843
538 Ga0070698_100020900
539 Ga0070698_100042205
540 Ga0070698_100080071
541 Ga0070698_100123046
542 Ga0070698_100172488
543 Ga0070698_100236025
544 Ga0070699_100045379
545 Ga0070699_100103722
546 Ga0070699_100387113
547 Ga0070699_100401416
548 Ga0070679_100021266
549 Ga0070679_100111822
550 Ga0070679_100138519
551 Ga0070697_100006878
552 Ga0070697_100129329
553 Ga0070686_100475923
554 Ga0070696_100385068
555 Ga0068855_100080145
556 Ga0068855_100472356
557 Ga0070664_100037519
558 Ga0070664_100437810
559 Ga0068857_100017491
560 Ga0068854_100201786
561 Ga0068854_100428944
562 Ga0068856_100024071
563 Ga0068856_100119826
564 Ga0068856_100343473
565 Ga0068856_100688498
566 Ga0070702_100212041
567 Ga0068864_100334398
568 Ga0068864_100617812
569 Ga0068861_100145608
570 Ga0081455_10022910
571 Ga0081455_10023768
572 Ga0081538_10000042
573 Ga0081538_10000098
574 Ga0081538_10000270
575 Ga0081538_10001427
576 Ga0081538_10002696
577 Ga0081538_10003459
578 Ga0081538_10003664
579 Ga0081538_10004160
580 Ga0081538_10005925
581 Ga0081538_10010591
582 Ga0081538_10016665
583 Ga0081538_10027144
584 Ga0081538_10195003
585 Ga0070717_10094170
586 Ga0070717_10121573
587 Ga0075363_100292681
588 Ga0070716_100141706
589 Ga0070712_100110794
590 Ga0070712_100410376
591 Ga0075428_100000551
592 Ga0075428_100020060
593 Ga0075428_100022408
594 Ga0075428_100043843
595 Ga0075428_100084872
596 Ga0075430_100000024
597 Ga0075430_100013037
598 Ga0075430_100041834
599 Ga0075430_100583212
600 Ga0075431_100002303
601 Ga0075431_100014133
602 Ga0075431_100185470
603 Ga0075431_100234980
604 Ga0075431_100310496
605 Ga0075433_10692688
606 Ga0075429_100010612
607 Ga0075429_100018025
608 Ga0075436_100011335
609 Ga0075436_100172391
610 Ga0105240_10038914
611 Ga0105240_10994965
612 Ga0111539_10017102
613 Ga0111539_10253055
614 Ga0111539_10320896
615 Ga0111539_10884237
616 Ga0105245_10035334
617 Ga0105245_10438875
618 Ga0105247_10129401
619 Ga0114129_10003125
620 Ga0114129_10033761
621 Ga0114129_10211769
622 Ga0105242_10011104
623 Ga0105237_10001168
624 Ga0105237_10147499
625 Ga0105237_10703866
626 Ga0105249_10003298
627 Ga0105239_10356108
628 Ga0154016_116235
629 Ga0157370_10047447
630 Ga0157374_10021233
631 Ga0163162_10030194
632 Ga0157372_10072934
633 Ga0157372_10119288
634 Ga0157372_10183073
635 Ga0157375_10563518
636 Ga0157380_10756112
637 Ga0157376_10281123
638 Ga0182007_10012991
639 Ga0182007_10086183
640 Ga0163161_10580107
641 Ga0197907_10746922
642 Ga0197907_10818165
643 Ga0197907_11331894
644 Ga0206356_10189296
645 Ga0206356_10220869
646 Ga0206349_1395013
647 Ga0206349_1518133
648 Ga0206355_1206627
649 Ga0206355_1272512
650 Ga0206351_10058212
651 Ga0206351_10582120
652 Ga0206351_10587411
653 Ga0206352_11041036
654 Ga0206352_11204717
655 Ga0206350_10040769
656 Ga0206350_10071761
657 Ga0206350_10399709
658 Ga0206350_11044585
659 Ga0206350_11044920
660 Ga0206350_11600899
661 Ga0206350_11642325
662 Ga0206354_10128226
663 Ga0206354_10742351
664 Ga0206354_11705756
665 Ga0206353_10080410
666 Ga0206353_11122905
667 Ga0206353_11252580
668 Ga0154015_1453172
669 Ga0213874_10000320
670 Ga0213874_10012036
671 Ga0213876_10035503
672 Ga0213875_10027392
673 Ga0213871_10054362
674 Ga0224712_10001105
675 Ga0224712_10006948
676 Ga0224712_10007354
677 Ga0224712_10028612
678 Ga0224712_10049031
679 Ga0224712_10052157
680 Ga0224712_10052599
681 Ga0224712_10067592
682 Ga0224712_10072352
683 Ga0207710_10129708
684 Ga0207680_10283542
685 Ga0207684_10000522
686 Ga0207684_10013421
687 Ga0207707_10004423
688 Ga0207707_10068676
689 Ga0207695_10014458
690 Ga0207671_10000921
691 Ga0207693_10058695
692 Ga0207693_10284585
693 Ga0207663_10008771
694 Ga0207657_10052940
695 Ga0207657_10093248
696 Ga0207652_10008669
697 Ga0207652_10017135
698 Ga0207652_10082989
699 Ga0207646_10000708
700 Ga0207646_10031723
701 Ga0207646_10241141
702 Ga0207646_10329238
703 Ga0207650_10016271
704 Ga0207687_10027422
705 Ga0207700_10003147
706 Ga0207700_10247078
707 Ga0207700_10682619
708 Ga0207664_10008169
709 Ga0207690_10083524
710 Ga0207706_10009656
711 Ga0207669_10097868
712 Ga0207665_10261011
713 Ga0207665_10340332
714 Ga0207679_10025232
715 Ga0207667_10042300
716 Ga0207667_10170868
717 Ga0207712_10109048
718 Ga0207668_10081544
719 Ga0207640_10246000
720 Ga0207677_10099819
721 Ga0207708_10034923
722 Ga0207708_10056791
723 Ga0207708_10063650
724 Ga0207702_10099209
725 Ga0207702_10294958
726 Ga0207648_10140856
727 Ga0207676_10311100
728 Ga0207674_10045062
729 Ga0207675_100000627
730 Ga0207698_10036207
731 Ga0207428_10083948
732 Ga0207428_10239080
733 Ga0268266_10021719
734 Ga0268265_10698686
735 Ga0265337_1003128
736 Ga0265326_10002279
737 Ga0265319_1000796
738 Ga0265319_1019709
739 Ga0265318_10003759
740 Ga0265318_10007122
741 Ga0265322_10021983
742 Ga0265336_10000060
743 Ga0265338_10000234
744 Ga0265338_10006019
745 Ga0265338_10042856
746 Ga0265338_10089975
747 Ga0265324_10052147
748 Ga0265340_10000014
749 Ga0265327_10012748
750 Ga0265316_10043399
751 Ga0307408_100157555
752 Ga0307408_100191203
753 Ga0316579_10021260
754 Ga0316579_10157016
755 Ga0265314_10015093
756 Ga0265342_10016297
757 Ga0316576_10024453
758 Ga0316576_10094811
759 Ga0316577_10013793
760 Ga0316577_10016927
761 Ga0316577_10076071
762 Ga0316577_10079253
763 Ga0307413_10348671
764 Ga0307410_10316669
765 Ga0307410_10445205
766 Ga0307406_10161486
767 Ga0307407_10026880
768 Ga0307409_100061915
769 Ga0307409_100176584
770 Ga0307409_100185160
771 Ga0307409_100486698
772 Ga0307416_100011205
773 Ga0307416_100129546
774 Ga0307416_100230354
775 Ga0307416_100265058
776 Ga0307415_100101071
777 Ga0307415_100222775
778 Ga0307415_100348500
779 Ga0316593_10000356
780 Ga0316593_10002269
781 Ga0316593_10003572
782 Ga0316593_10004580
783 Ga0316593_10013458
784 Ga0316593_10013882
785 Ga0316593_10022836
786 Ga0316593_10037090
787 Ga0316593_10075839
788 Ga0316593_10085385
789 Ga0316593_10105421
790 Ga0316596_1005978
791 Ga0373952_0022035
792 Ga0373939_0108636
793 Ga0373956_0000748
794 Ga0373955_0118673
795 Ga0373961_0002373
796 Ga0316574_0123568
797 Ga0373931_0073823
798 Ga0373927_0000168
799 Ga0373927_0004412
800 Ga0373933_0022841
801 Ga0373947_0315555
802 Ga0373947_0387603
803 Ga0373937_0175088
804 Ga0373937_0862656
805 Ga0316582_0054810
806 Ga0316582_0143456
807 Ga0316584_0008814
808 Ga0316584_0024235
809 Ga0316584_0025252
810 Ga0316584_0027177
811 Ga0316584_0052464
812 Ga0316584_0126832
813 Ga0373925_0001237
814 Ga0373925_0215175
815 Ga0395900_0026763
816 Ga0395900_0181170
817 Ga0395900_0310445
818 Ga0395898_0347288
819 Ga0395905_0245904
820 Ga0436364_0453118
821 Ga0436364_1049004
822 Ga0395901_0057864
823 Ga0395901_0125443
824 Ga0436365_0681063
825 Ga0436365_1320219
826 Ga0436360_0605802
827 Ga0436363_0191611
828 Ga0436363_0240724
829 Ga0436363_1443790
830 Ga0436362_0639313
831 Ga0439448_0078507
832 Ga0439448_0089337
833 Ga0439450_046230
834 Ga0439454_016262
835 Ga0466969_0003183
836 Ga0466969_0029866
837 Ga0466972_0041150
838 Ga0466965_0157917
839 Ga0466966_0004952
840 Ga0466966_0061263
841 Ga0466966_0302867
842 Ga0466966_0404964
843 Ga0466961_0083089
844 Ga0466963_0001284
845 Ga0466963_0001348
846 Ga0466963_0436802
847 Ga0466964_0000514
848 Ga0453684_0000021
849 Ga0453684_0021189
850 Ga0453684_0025901
851 Ga0453684_0070977
852 Ga0466971_0001737
853 Ga0466971_0010932
854 Ga0466971_0252820
855 Ga0466968_0002067
856 Ga0466970_0002587
857 Ga0466970_0024339
858 Ga0466970_0103830
859 Ga0466970_0142453
860 Ga0466957_0002456
861 Ga0466957_0019140
862 Ga0466957_0068064
863 Ga0466957_0119474
864 Ga0466959_0022008
865 Ga0466959_0028481
866 Ga0466959_0369367
867 Ga0451576_0098059
868 Ga0451576_0109071
869 Ga0466958_0076184
870 Ga0466967_0002467
871 Ga0466967_0013731
872 Ga0466967_0168104
873 Ga0495629_0060442
874 Ga0495653_0000231
875 Ga0495580_0122128
876 Ga0495664_0000086
877 Ga0495585_0087560
878 Ga0495596_0033185
879 Ga0495618_0000054
880 Ga0495630_0000328
881 Ga0495642_0042351
882 Ga0495586_0011853
883 Ga0495586_0038716
884 Ga0495645_0000088
885 Ga0495645_0000535
886 Ga0495634_0178879
887 Ga0495588_0136568
888 Ga0495657_0000006
889 Ga0495646_0061992
890 Ga0495647_0192618
891 Ga0495613_0237444
892 Ga0495600_0040220
893 Ga0495581_0169983
894 Ga0495672_0114541
895 Ga0495676_0043753
896 Ga0495680_0161792
897 Ga0495684_0002596
898 Ga0495615_0117305
899 Ga0496100_0009467
900 Ga0496101_0045104
901 Ga0496101_0212920
902 Ga0496102_0000096
903 Ga0496102_0120946
904 Ga0496103_0000035
905 Ga0496103_0101615
906 Ga0496103_0107398
907 Ga0496104_0000034
908 Ga0496105_0060414
909 Ga0496107_0045550
910 Ga0496107_0168052
911 Ga0496107_0398772
912 Ga0496108_0249664
913 Ga0496109_0002551
914 Ga0496110_0001995
915 Ga0496110_0035084
916 Ga0496111_0015657
917 Ga0496111_0163009
918 Ga0496112_0003066
919 Ga0496113_0003146
920 Ga0496113_0157705
921 Ga0496114_0027751
922 Ga0496114_0138792
923 Ga0496115_0008929
924 Ga0496115_0015290
925 Ga0501034_0210196
926 Ga0501037_0081852
927 Ga0501039_0159805
928 Ga0501039_0379269
929 Ga0501041_0026839
930 Ga0501047_0077674
931 Ga0501047_0142853
932 Ga0501047_0197071
933 Ga0501048_0142650
934 Ga0501069_0060839
935 Ga0501070_0152767
936 Ga0501070_0239662
937 Ga0501071_0352009
938 Ga0501071_0539599
939 Ga0501072_0061766
940 Ga0501074_0018034
941 Ga0501074_0118526
942 Ga0501074_0219061
943 Ga0501074_0275113
944 Ga0501074_0353651
945 Ga0501075_0193323
946 Ga0501075_0260824
947 Ga0501075_0270862
948 Ga0501076_0055315
949 Ga0501076_0080358
950 Ga0501076_0319598
951 Ga0501079_0142824
952 Ga0501080_0260376
953 Ga0501080_0275447
954 Ga0501044_0019096
955 Ga0501044_0456177
956 Ga0501045_0021485
957 Ga0501045_0062859
958 Ga0501045_0119128
959 nmdc:mga05p37_189517_c1
960 nmdc:mga05p37_736_c1
961 nmdc:mga05p37_9802_c1
962 nmdc:mga09592_501961_c1
963 nmdc:mga09592_5132_c1
964 nmdc:mga09592_532348_c1
965 nmdc:mga0qj67_114953_c1
966 nmdc:mga0qj67_7113_c1
967 nmdc:mga0qj67_908_c1
968 nmdc:mga06r32_162736_c1
969 nmdc:mga06r32_283707_c1
970 nmdc:mga06r32_306924_c1
971 nmdc:mga08y16_103469_c1
972 nmdc:mga08y16_182296_c1
973 nmdc:mga08y16_233592_c1
974 nmdc:mga08y16_563154_c1
975 nmdc:mga08y16_747950_c1
976 nmdc:mga0n895_688267_c1
977 nmdc:mga0n895_725311_c1
978 nmdc:mga08x19_12700_c1
979 nmdc:mga08x19_239790_c1
980 nmdc:mga0a205_52814_c1
981 Ga0495601_0000673
982 Ga0495601_0025531
983 Ga0495612_0031273
984 Ga0500637_0048336
985 Ga0587082_010855
986 Ga0587083_0015930
987 Ga0501082_0273492
988 Ga0466962_0006796
989 Ga0530510_0049984
990 Ga0530510_0157504
991 Ga0530510_0175447
992 Ga0530510_0869373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

216

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.941 8 240
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9404 8 251
2d2e-assembly1.cif.gz_A crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 0.9142 8 254
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9142 8 240
2d3w-assembly1.cif.gz_C crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery 0.9137 8 251
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 8 254 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 7 256 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9248 7 256 3.40.50.300
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9161 8 254 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8894 7 254 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538K8F6-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9724 6 228 GO:0005524
GO:0016887
AF-A0A538EV32-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9702 6 254 GO:0005524
GO:0016887
AF-A0A538K8F6-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9639 6 228 GO:0005524
GO:0016887
AF-A0A382HLW2-F1-model_v4 ABC transporter domain-containing protein 0.9595 14 246 GO:0005524
GO:0016887
AF-A0A7X6GVV0-F1-model_v4 deleted 0.9586 8 253

Map