F454751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 495 | 326 | 990 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0196920|Ga0395899_0196920_956_1372 |
| Length | 138 |
| Sequence | MSDSCCGGGHSHEAPGATTTVAAPVDLDRREDQINLSPVAATKVKSLLEQEGRDDLSLRISVQPGGCSGLRYQLFFDERTLDGDVVTDFDGVAVVVDRMSVPYLNGAVIDFVDTIEKQGFTIDNPNATGSCACGDSFN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 62 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 73 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 136 | 3300031633 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 137 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 151 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 171 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 172 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 181 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 182 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 183 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 187 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 191 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 192 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 193 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 252 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 292 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 303 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 304 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 305 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 306 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 307 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 308 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 309 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 310 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 311 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 312 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 313 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 314 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 315 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 316 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 317 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 318 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 319 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 320 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 321 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 322 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 323 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 324 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 325 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 326 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.64 |
| Metatranscriptomes | 11.52 |
| Isolates | 4.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.26 |
| Nodule | 0 |
| Rhizoplane | 4.85 |
| Rhizosphere | 82.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0196920 | 3300037312 | Bacteria | 1407 |
| 2 | JGI24744J21845_10009530 | 3300002077 | Bacteria | 1992 |
| 3 | Ga0058862_12737353 | 3300004803 | Bacteria | 546 |
| 4 | Ga0058862_12869315 | 3300004803 | Bacteria | 717 |
| 5 | Ga0070658_10000108 | 3300005327 | Bacteria | 73704 |
| 6 | Ga0070658_10655617 | 3300005327 | Bacteria | 911 |
| 7 | Ga0070683_100381343 | 3300005329 | Bacteria | 1343 |
| 8 | Ga0070683_102246263 | 3300005329 | Bacteria | 524 |
| 9 | Ga0070690_100524030 | 3300005330 | Bacteria | 890 |
| 10 | Ga0070670_100737972 | 3300005331 | Bacteria | 887 |
| 11 | Ga0070680_100315053 | 3300005336 | Bacteria | 1328 |
| 12 | Ga0070680_100413324 | 3300005336 | Bacteria | 1151 |
| 13 | Ga0070682_100035749 | 3300005337 | Bacteria | 3034 |
| 14 | Ga0070682_100158008 | 3300005337 | Bacteria | 1563 |
| 15 | Ga0070682_101999688 | 3300005337 | Bacteria | 510 |
| 16 | Ga0068868_100100797 | 3300005338 | Bacteria | 2336 |
| 17 | Ga0070660_100645101 | 3300005339 | Bacteria | 886 |
| 18 | Ga0070692_10046789 | 3300005345 | Bacteria | 2237 |
| 19 | Ga0070668_100403292 | 3300005347 | Bacteria | 1168 |
| 20 | Ga0070669_100248454 | 3300005353 | Bacteria | 1416 |
| 21 | Ga0070675_100087605 | 3300005354 | Bacteria | 2603 |
| 22 | Ga0070674_100012101 | 3300005356 | Bacteria | 5286 |
| 23 | Ga0070673_100042370 | 3300005364 | Bacteria | 3510 |
| 24 | Ga0070659_100295860 | 3300005366 | Bacteria | 1349 |
| 25 | Ga0070667_100748923 | 3300005367 | Bacteria | 905 |
| 26 | Ga0070714_100217833 | 3300005435 | Bacteria | 1753 |
| 27 | Ga0070714_100576929 | 3300005435 | Bacteria | 1079 |
| 28 | Ga0070710_10410587 | 3300005437 | Bacteria | 910 |
| 29 | Ga0070701_10005213 | 3300005438 | Bacteria | 5346 |
| 30 | Ga0070700_100006435 | 3300005441 | Bacteria | 6283 |
| 31 | Ga0070700_100086553 | 3300005441 | Bacteria | 2035 |
| 32 | Ga0070700_101005144 | 3300005441 | Bacteria | 686 |
| 33 | Ga0070708_101022165 | 3300005445 | Bacteria | 775 |
| 34 | Ga0070663_100012134 | 3300005455 | Bacteria | 5438 |
| 35 | Ga0070678_100395912 | 3300005456 | Bacteria | 1199 |
| 36 | Ga0070678_101423109 | 3300005456 | Bacteria | 648 |
| 37 | Ga0070681_10250769 | 3300005458 | Bacteria | 1683 |
| 38 | Ga0068867_100030779 | 3300005459 | Bacteria | 3871 |
| 39 | Ga0070685_10011861 | 3300005466 | Bacteria | 4568 |
| 40 | Ga0070707_100209324 | 3300005468 | Bacteria | 1901 |
| 41 | Ga0070698_100010105 | 3300005471 | Bacteria | 10081 |
| 42 | Ga0070679_100115562 | 3300005530 | Bacteria | 2669 |
| 43 | Ga0070679_100213646 | 3300005530 | Bacteria | 1892 |
| 44 | Ga0070684_100142372 | 3300005535 | Bacteria | 2169 |
| 45 | Ga0070684_101391699 | 3300005535 | Bacteria | 661 |
| 46 | Ga0068853_100711115 | 3300005539 | Bacteria | 959 |
| 47 | Ga0070672_100007050 | 3300005543 | Bacteria | 7599 |
| 48 | Ga0070672_100190848 | 3300005543 | Bacteria | 1710 |
| 49 | Ga0070686_100771645 | 3300005544 | Bacteria | 773 |
| 50 | Ga0070693_100871831 | 3300005547 | Bacteria | 673 |
| 51 | Ga0068857_100382946 | 3300005577 | Bacteria | 1306 |
| 52 | Ga0068854_100115990 | 3300005578 | Bacteria | 2026 |
| 53 | Ga0068852_100120415 | 3300005616 | Bacteria | 2401 |
| 54 | Ga0068864_100037762 | 3300005618 | Bacteria | 4123 |
| 55 | Ga0068861_100003359 | 3300005719 | Bacteria | 10606 |
| 56 | Ga0068851_10027499 | 3300005834 | Bacteria | 2804 |
| 57 | Ga0068870_10014561 | 3300005840 | Bacteria | 3716 |
| 58 | Ga0068870_10194647 | 3300005840 | Bacteria | 1225 |
| 59 | Ga0068863_100692270 | 3300005841 | Bacteria | 1013 |
| 60 | Ga0075365_10010977 | 3300006038 | Bacteria | 5307 |
| 61 | Ga0075365_10014742 | 3300006038 | Bacteria | 4707 |
| 62 | Ga0075365_10049966 | 3300006038 | Bacteria | 2757 |
| 63 | Ga0075365_10236008 | 3300006038 | Bacteria | 1284 |
| 64 | Ga0075365_10623557 | 3300006038 | Bacteria | 762 |
| 65 | Ga0075365_10686157 | 3300006038 | Bacteria | 724 |
| 66 | Ga0075365_10730116 | 3300006038 | Bacteria | 699 |
| 67 | Ga0075368_10384068 | 3300006042 | Bacteria | 615 |
| 68 | Ga0075363_100388722 | 3300006048 | Bacteria | 819 |
| 69 | Ga0075364_10093461 | 3300006051 | Bacteria | 1997 |
| 70 | Ga0075364_10152521 | 3300006051 | Bacteria | 1558 |
| 71 | Ga0075364_11079502 | 3300006051 | Bacteria | 545 |
| 72 | Ga0075367_10787202 | 3300006178 | Bacteria | 606 |
| 73 | Ga0075370_10046479 | 3300006353 | Bacteria | 2456 |
| 74 | Ga0075370_10819968 | 3300006353 | Bacteria | 568 |
| 75 | Ga0068871_101385686 | 3300006358 | Bacteria | 663 |
| 76 | Ga0068865_100018163 | 3300006881 | Bacteria | 4535 |
| 77 | Ga0099794_10286206 | 3300007265 | Bacteria | 852 |
| 78 | Ga0105245_10101968 | 3300009098 | Bacteria | 2657 |
| 79 | Ga0105245_10801544 | 3300009098 | Bacteria | 980 |
| 80 | Ga0114129_11668402 | 3300009147 | Bacteria | 778 |
| 81 | Ga0105243_10038026 | 3300009148 | Bacteria | 3746 |
| 82 | Ga0105248_10886890 | 3300009177 | Bacteria | 1007 |
| 83 | Ga0105248_12392955 | 3300009177 | Bacteria | 602 |
| 84 | Ga0105239_10151037 | 3300010375 | Bacteria | 2592 |
| 85 | Ga0105239_12241190 | 3300010375 | Bacteria | 635 |
| 86 | Ga0105246_10251179 | 3300011119 | Bacteria | 1404 |
| 87 | Ga0157317_1021752 | 3300012475 | Bacteria | 575 |
| 88 | Ga0154014_141112 | 3300013052 | Bacteria | 588 |
| 89 | Ga0157373_10447428 | 3300013100 | Bacteria | 929 |
| 90 | Ga0157369_10016567 | 3300013105 | Bacteria | 8285 |
| 91 | Ga0157369_10824476 | 3300013105 | Bacteria | 953 |
| 92 | Ga0157369_11216324 | 3300013105 | Bacteria | 769 |
| 93 | Ga0157372_10065485 | 3300013307 | Bacteria | 4080 |
| 94 | Ga0157372_10079897 | 3300013307 | Bacteria | 3700 |
| 95 | Ga0157372_10722806 | 3300013307 | Bacteria | 1158 |
| 96 | Ga0157380_10008910 | 3300014326 | Bacteria | 7168 |
| 97 | Ga0157380_12346722 | 3300014326 | Bacteria | 598 |
| 98 | Ga0182008_10027037 | 3300014497 | Bacteria | 2908 |
| 99 | Ga0182008_10384119 | 3300014497 | Bacteria | 751 |
| 100 | Ga0163161_10150622 | 3300017792 | Bacteria | 1768 |
| 101 | Ga0184596_101227 | 3300019176 | Bacteria | 534 |
| 102 | Ga0197907_10146759 | 3300020069 | Bacteria | 528 |
| 103 | Ga0197907_10322276 | 3300020069 | Bacteria | 916 |
| 104 | Ga0197907_11237439 | 3300020069 | Bacteria | 711 |
| 105 | Ga0206349_1619355 | 3300020075 | Bacteria | 682 |
| 106 | Ga0206349_1817926 | 3300020075 | Bacteria | 840 |
| 107 | Ga0206349_1962344 | 3300020075 | Bacteria | 569 |
| 108 | Ga0206355_1154318 | 3300020076 | Bacteria | 3713 |
| 109 | Ga0206355_1712316 | 3300020076 | Bacteria | 790 |
| 110 | Ga0206351_10341761 | 3300020077 | Bacteria | 1054 |
| 111 | Ga0206352_10231795 | 3300020078 | Bacteria | 1216 |
| 112 | Ga0206352_10578904 | 3300020078 | Bacteria | 768 |
| 113 | Ga0206352_10970858 | 3300020078 | Bacteria | 573 |
| 114 | Ga0206354_10142487 | 3300020081 | Bacteria | 579 |
| 115 | Ga0206353_11664223 | 3300020082 | Bacteria | 3223 |
| 116 | Ga0154015_1350112 | 3300020610 | Bacteria | 613 |
| 117 | Ga0154015_1598831 | 3300020610 | Bacteria | 743 |
| 118 | Ga0213875_10474808 | 3300021388 | Bacteria | 600 |
| 119 | Ga0213875_10648598 | 3300021388 | Bacteria | 511 |
| 120 | Ga0224712_10048069 | 3300022467 | Bacteria | 1645 |
| 121 | Ga0224712_10122458 | 3300022467 | Bacteria | 1128 |
| 122 | Ga0224712_10222992 | 3300022467 | Bacteria | 863 |
| 123 | Ga0207682_10479408 | 3300025893 | Bacteria | 589 |
| 124 | Ga0207692_10003208 | 3300025898 | Bacteria | 6362 |
| 125 | Ga0207692_10461132 | 3300025898 | Bacteria | 801 |
| 126 | Ga0207647_10199558 | 3300025904 | Bacteria | 1158 |
| 127 | Ga0207699_10042779 | 3300025906 | Bacteria | 2627 |
| 128 | Ga0207643_10016651 | 3300025908 | Bacteria | 4010 |
| 129 | Ga0207705_10000394 | 3300025909 | Bacteria | 38574 |
| 130 | Ga0207707_10285653 | 3300025912 | Bacteria | 1428 |
| 131 | Ga0207707_10358641 | 3300025912 | Bacteria | 1255 |
| 132 | Ga0207695_11237800 | 3300025913 | Bacteria | 627 |
| 133 | Ga0207693_10487732 | 3300025915 | Bacteria | 962 |
| 134 | Ga0207663_10227172 | 3300025916 | Bacteria | 1361 |
| 135 | Ga0207660_10011743 | 3300025917 | Bacteria | 5711 |
| 136 | Ga0207660_10148702 | 3300025917 | Bacteria | 1798 |
| 137 | Ga0207662_10051965 | 3300025918 | Bacteria | 2439 |
| 138 | Ga0207657_10427929 | 3300025919 | Bacteria | 1040 |
| 139 | Ga0207657_10562199 | 3300025919 | Bacteria | 891 |
| 140 | Ga0207652_10188091 | 3300025921 | Bacteria | 1857 |
| 141 | Ga0207652_11219653 | 3300025921 | Bacteria | 654 |
| 142 | Ga0207646_10284885 | 3300025922 | Bacteria | 1493 |
| 143 | Ga0207681_10221868 | 3300025923 | Bacteria | 1463 |
| 144 | Ga0207687_10223585 | 3300025927 | Bacteria | 1484 |
| 145 | Ga0207700_10033181 | 3300025928 | Bacteria | 3692 |
| 146 | Ga0207664_10071408 | 3300025929 | Bacteria | 2796 |
| 147 | Ga0207664_11596395 | 3300025929 | Bacteria | 574 |
| 148 | Ga0207690_10219512 | 3300025932 | Bacteria | 1454 |
| 149 | Ga0207690_11452646 | 3300025932 | Bacteria | 573 |
| 150 | Ga0207709_10079021 | 3300025935 | Bacteria | 2114 |
| 151 | Ga0207669_11058817 | 3300025937 | Bacteria | 683 |
| 152 | Ga0207665_10080913 | 3300025939 | Bacteria | 2235 |
| 153 | Ga0207691_10009955 | 3300025940 | Bacteria | 9129 |
| 154 | Ga0207691_10202026 | 3300025940 | Bacteria | 1729 |
| 155 | Ga0207661_10355552 | 3300025944 | Bacteria | 1322 |
| 156 | Ga0207661_10931155 | 3300025944 | Bacteria | 800 |
| 157 | Ga0207667_11638687 | 3300025949 | Bacteria | 611 |
| 158 | Ga0207712_10318795 | 3300025961 | Bacteria | 1282 |
| 159 | Ga0207668_10228115 | 3300025972 | Bacteria | 1500 |
| 160 | Ga0207703_11401952 | 3300026035 | Bacteria | 672 |
| 161 | Ga0207639_10166611 | 3300026041 | Bacteria | 1862 |
| 162 | Ga0207678_10000897 | 3300026067 | Bacteria | 27312 |
| 163 | Ga0207678_10003714 | 3300026067 | Bacteria | 13726 |
| 164 | Ga0207708_10001687 | 3300026075 | Bacteria | 16343 |
| 165 | Ga0207702_10604801 | 3300026078 | Bacteria | 1076 |
| 166 | Ga0207648_10014220 | 3300026089 | Bacteria | 7361 |
| 167 | Ga0207648_10587989 | 3300026089 | Bacteria | 1025 |
| 168 | Ga0207648_10905147 | 3300026089 | Bacteria | 824 |
| 169 | Ga0207674_10192866 | 3300026116 | Bacteria | 1987 |
| 170 | Ga0207675_100001326 | 3300026118 | Bacteria | 24790 |
| 171 | Ga0207675_100686772 | 3300026118 | Bacteria | 1032 |
| 172 | Ga0207698_10076937 | 3300026142 | Bacteria | 2673 |
| 173 | Ga0209813_10172092 | 3300027866 | Bacteria | 787 |
| 174 | Ga0209974_10094577 | 3300027876 | Bacteria | 1039 |
| 175 | Ga0265334_10287891 | 3300028573 | Bacteria | 563 |
| 176 | Ga0265338_10005567 | 3300028800 | Bacteria | 16386 |
| 177 | Ga0265338_10006545 | 3300028800 | Bacteria | 14804 |
| 178 | Ga0265338_10417961 | 3300028800 | Bacteria | 953 |
| 179 | Ga0265763_1001941 | 3300030763 | Bacteria | 1539 |
| 180 | Ga0265766_1002461 | 3300030863 | Bacteria | 1026 |
| 181 | Ga0265766_1013145 | 3300030863 | Bacteria | 618 |
| 182 | Ga0265776_100428 | 3300030880 | Bacteria | 1480 |
| 183 | Ga0265764_100965 | 3300030882 | Bacteria | 1199 |
| 184 | Ga0265764_116549 | 3300030882 | Bacteria | 513 |
| 185 | Ga0265769_100930 | 3300030888 | Bacteria | 1301 |
| 186 | Ga0265768_100454 | 3300030963 | Bacteria | 1614 |
| 187 | Ga0265774_105333 | 3300031011 | Bacteria | 562 |
| 188 | Ga0265773_1006007 | 3300031018 | Bacteria | 902 |
| 189 | Ga0265325_10089811 | 3300031241 | Bacteria | 1516 |
| 190 | Ga0265339_10019099 | 3300031249 | Bacteria | 4027 |
| 191 | Ga0265316_10161957 | 3300031344 | Bacteria | 1672 |
| 192 | Ga0265316_10170174 | 3300031344 | Bacteria | 1625 |
| 193 | Ga0307408_101231071 | 3300031548 | Bacteria | 699 |
| 194 | Ga0310117_110776 | 3300031592 | Bacteria | 966 |
| 195 | Ga0265313_10015665 | 3300031595 | Bacteria | 4401 |
| 196 | Ga0310103_114835 | 3300031614 | Bacteria | 1028 |
| 197 | Ga0310108_120169 | 3300031633 | Bacteria | 616 |
| 198 | Ga0310101_110523 | 3300031690 | Bacteria | 1041 |
| 199 | Ga0265314_10055182 | 3300031711 | Bacteria | 2745 |
| 200 | Ga0265342_10691915 | 3300031712 | Bacteria | 510 |
| 201 | Ga0307405_10681888 | 3300031731 | Bacteria | 849 |
| 202 | Ga0307413_10156875 | 3300031824 | Bacteria | 1594 |
| 203 | Ga0307413_11014723 | 3300031824 | Bacteria | 712 |
| 204 | Ga0307410_10341873 | 3300031852 | Bacteria | 1193 |
| 205 | Ga0307410_11704789 | 3300031852 | Bacteria | 558 |
| 206 | Ga0307406_10016487 | 3300031901 | Bacteria | 4294 |
| 207 | Ga0307407_10412643 | 3300031903 | Bacteria | 971 |
| 208 | Ga0307407_10559291 | 3300031903 | Bacteria | 847 |
| 209 | Ga0307412_10053470 | 3300031911 | Bacteria | 2677 |
| 210 | Ga0307409_100000367 | 3300031995 | Bacteria | 18921 |
| 211 | Ga0307416_100015640 | 3300032002 | Bacteria | 5246 |
| 212 | Ga0307416_103188868 | 3300032002 | Bacteria | 549 |
| 213 | Ga0307414_10427146 | 3300032004 | Bacteria | 1157 |
| 214 | Ga0307415_100000032 | 3300032126 | Bacteria | 59889 |
| 215 | Ga0307415_100075041 | 3300032126 | Bacteria | 2392 |
| 216 | Ga0307415_100252576 | 3300032126 | Bacteria | 1434 |
| 217 | Ga0316585_10079289 | 3300032137 | Bacteria | 1069 |
| 218 | Ga0316593_10040205 | 3300032168 | Bacteria | 1554 |
| 219 | Ga0316592_1038841 | 3300033524 | Bacteria | 1050 |
| 220 | Ga0316588_1074390 | 3300033528 | Bacteria | 836 |
| 221 | Ga0316587_1116597 | 3300033529 | Bacteria | 521 |
| 222 | Ga0316596_1072667 | 3300033541 | Bacteria | 922 |
| 223 | Ga0373934_0026501 | 3300035086 | Bacteria | 2249 |
| 224 | Ga0373923_0018320 | 3300035111 | Bacteria | 2693 |
| 225 | Ga0373923_0349931 | 3300035111 | Bacteria | 705 |
| 226 | Ga0373936_0056154 | 3300035113 | Bacteria | 1600 |
| 227 | Ga0373953_0135287 | 3300035117 | Bacteria | 1052 |
| 228 | Ga0373953_0168129 | 3300035117 | Bacteria | 943 |
| 229 | Ga0373954_0070794 | 3300035118 | Bacteria | 1657 |
| 230 | Ga0373956_0101551 | 3300035119 | Bacteria | 1334 |
| 231 | Ga0373956_0149318 | 3300035119 | Bacteria | 1099 |
| 232 | Ga0373957_0180500 | 3300035120 | Bacteria | 875 |
| 233 | Ga0373955_0011723 | 3300035172 | Bacteria | 4189 |
| 234 | Ga0316574_0049933 | 3300035398 | Bacteria | 2602 |
| 235 | Ga0373924_0069449 | 3300035410 | Bacteria | 1484 |
| 236 | Ga0373924_0170941 | 3300035410 | Bacteria | 955 |
| 237 | Ga0373927_0150530 | 3300035695 | Bacteria | 1524 |
| 238 | Ga0373933_0009019 | 3300035724 | Bacteria | 5442 |
| 239 | Ga0373933_0148932 | 3300035724 | Bacteria | 1481 |
| 240 | Ga0373937_0115946 | 3300036401 | Bacteria | 2494 |
| 241 | Ga0373937_0560267 | 3300036401 | Bacteria | 1085 |
| 242 | Ga0265778_017597 | 3300036457 | Bacteria | 864 |
| 243 | Ga0265778_049333 | 3300036457 | Bacteria | 574 |
| 244 | Ga0310112_011423 | 3300036458 | Bacteria | 1270 |
| 245 | Ga0316582_0404005 | 3300036647 | Bacteria | 941 |
| 246 | Ga0316584_0231823 | 3300036712 | Bacteria | 1353 |
| 247 | Ga0373925_0000157 | 3300037068 | Bacteria | 72993 |
| 248 | Ga0395899_0025224 | 3300037312 | Bacteria | 4489 |
| 249 | Ga0395899_0424666 | 3300037312 | Bacteria | 875 |
| 250 | Ga0395900_0440867 | 3300037418 | Bacteria | 1260 |
| 251 | Ga0395898_0282733 | 3300037466 | Bacteria | 1583 |
| 252 | Ga0395898_1523031 | 3300037466 | Bacteria | 594 |
| 253 | Ga0395905_0360850 | 3300037471 | Bacteria | 1346 |
| 254 | Ga0395905_0477211 | 3300037471 | Bacteria | 1146 |
| 255 | Ga0436364_1061164 | 3300037853 | Bacteria | 634 |
| 256 | Ga0395901_0010220 | 3300038443 | Bacteria | 9506 |
| 257 | Ga0395901_0072718 | 3300038443 | Bacteria | 3585 |
| 258 | Ga0395901_0120893 | 3300038443 | Bacteria | 2752 |
| 259 | Ga0436365_1510703 | 3300039437 | Bacteria | 746 |
| 260 | Ga0439438_025187 | 3300041405 | Bacteria | 1623 |
| 261 | Ga0439447_112275 | 3300041407 | Bacteria | 625 |
| 262 | Ga0439461_0010968 | 3300041410 | Bacteria | 1674 |
| 263 | Ga0451789_0605474 | 3300041443 | Bacteria | 921 |
| 264 | Ga0451791_1932806 | 3300041451 | Bacteria | 513 |
| 265 | Ga0451807_0289417 | 3300041486 | Bacteria | 551 |
| 266 | Ga0451837_1764938 | 3300041494 | Bacteria | 817 |
| 267 | Ga0451847_0815854 | 3300041503 | Bacteria | 1011 |
| 268 | Ga0451853_2038950 | 3300041512 | Bacteria | 702 |
| 269 | Ga0439431_0051371 | 3300041997 | Bacteria | 1069 |
| 270 | Ga0439442_012146 | 3300042002 | Bacteria | 1759 |
| 271 | Ga0439445_0103532 | 3300042004 | Bacteria | 808 |
| 272 | Ga0439432_149614 | 3300042006 | Bacteria | 685 |
| 273 | Ga0439446_0006528 | 3300042156 | Bacteria | 3045 |
| 274 | Ga0439434_0004064 | 3300042435 | Bacteria | 4271 |
| 275 | Ga0466972_0099045 | 3300044658 | Bacteria | 1380 |
| 276 | Ga0466972_0109256 | 3300044658 | Bacteria | 1307 |
| 277 | Ga0466972_0445785 | 3300044658 | Bacteria | 608 |
| 278 | Ga0466965_0004896 | 3300044683 | Bacteria | 5980 |
| 279 | Ga0466965_0025950 | 3300044683 | Bacteria | 2839 |
| 280 | Ga0466965_0577410 | 3300044683 | Bacteria | 637 |
| 281 | Ga0466966_0595340 | 3300044684 | Bacteria | 665 |
| 282 | Ga0466961_0060843 | 3300044693 | Bacteria | 2401 |
| 283 | Ga0466961_0424864 | 3300044693 | Bacteria | 805 |
| 284 | Ga0466961_0446910 | 3300044693 | Bacteria | 782 |
| 285 | Ga0466963_0056511 | 3300044694 | Bacteria | 2612 |
| 286 | Ga0466963_0072651 | 3300044694 | Bacteria | 2318 |
| 287 | Ga0466963_0074084 | 3300044694 | Bacteria | 2296 |
| 288 | Ga0466963_0947163 | 3300044694 | Bacteria | 606 |
| 289 | Ga0466964_0005611 | 3300044706 | Bacteria | 4663 |
| 290 | Ga0466964_0157367 | 3300044706 | Bacteria | 1059 |
| 291 | Ga0466964_0573833 | 3300044706 | Bacteria | 615 |
| 292 | Ga0466971_0028543 | 3300044719 | Bacteria | 2496 |
| 293 | Ga0466971_0153184 | 3300044719 | Bacteria | 1077 |
| 294 | Ga0466971_0154169 | 3300044719 | Bacteria | 1073 |
| 295 | Ga0466971_0465085 | 3300044719 | Bacteria | 621 |
| 296 | Ga0466968_0023342 | 3300044735 | Bacteria | 2519 |
| 297 | Ga0466970_0012339 | 3300044765 | Bacteria | 4367 |
| 298 | Ga0466970_0015953 | 3300044765 | Bacteria | 3867 |
| 299 | Ga0466970_0083448 | 3300044765 | Bacteria | 1729 |
| 300 | Ga0466970_0191725 | 3300044765 | Bacteria | 1136 |
| 301 | Ga0466970_0328645 | 3300044765 | Bacteria | 865 |
| 302 | Ga0466970_0474909 | 3300044765 | Bacteria | 718 |
| 303 | Ga0466970_0871145 | 3300044765 | Bacteria | 529 |
| 304 | Ga0466970_0889466 | 3300044765 | Bacteria | 523 |
| 305 | Ga0466957_0164507 | 3300044842 | Bacteria | 1442 |
| 306 | Ga0466957_0607117 | 3300044842 | Bacteria | 766 |
| 307 | Ga0466957_1358883 | 3300044842 | Bacteria | 516 |
| 308 | Ga0466960_0005570 | 3300044901 | Bacteria | 4994 |
| 309 | Ga0466960_0020278 | 3300044901 | Bacteria | 2942 |
| 310 | Ga0466960_0088641 | 3300044901 | Bacteria | 1573 |
| 311 | Ga0466960_0367969 | 3300044901 | Bacteria | 823 |
| 312 | Ga0466960_0430028 | 3300044901 | Bacteria | 764 |
| 313 | Ga0466959_0230548 | 3300045049 | Bacteria | 1282 |
| 314 | Ga0466958_0052250 | 3300045836 | Bacteria | 2476 |
| 315 | Ga0466958_0149174 | 3300045836 | Bacteria | 1475 |
| 316 | Ga0466958_0688262 | 3300045836 | Bacteria | 666 |
| 317 | Ga0466967_0047816 | 3300045976 | Bacteria | 3731 |
| 318 | Ga0466967_0081787 | 3300045976 | Bacteria | 2918 |
| 319 | Ga0466967_0153929 | 3300045976 | Bacteria | 2152 |
| 320 | Ga0466967_0280597 | 3300045976 | Bacteria | 1598 |
| 321 | Ga0466967_0996205 | 3300045976 | Bacteria | 834 |
| 322 | Ga0466967_1180455 | 3300045976 | Bacteria | 763 |
| 323 | Ga0495592_0231636 | 3300046454 | Bacteria | 1229 |
| 324 | Ga0495651_0028321 | 3300046462 | Bacteria | 4366 |
| 325 | Ga0495651_0068479 | 3300046462 | Bacteria | 2705 |
| 326 | Ga0495653_0041539 | 3300046463 | Bacteria | 3589 |
| 327 | Ga0495653_0090702 | 3300046463 | Bacteria | 2235 |
| 328 | Ga0495662_0125483 | 3300046476 | Bacteria | 1261 |
| 329 | Ga0495664_0073765 | 3300046477 | Bacteria | 2040 |
| 330 | Ga0495618_0070142 | 3300046514 | Bacteria | 2228 |
| 331 | Ga0495628_0094744 | 3300046516 | Bacteria | 2307 |
| 332 | Ga0495640_0098586 | 3300046533 | Bacteria | 1920 |
| 333 | Ga0495586_0077349 | 3300046535 | Bacteria | 1824 |
| 334 | Ga0495586_0130717 | 3300046535 | Bacteria | 1406 |
| 335 | Ga0495587_0002850 | 3300046536 | Bacteria | 11583 |
| 336 | Ga0495587_0049966 | 3300046536 | Bacteria | 2474 |
| 337 | Ga0495645_0059145 | 3300046543 | Bacteria | 2779 |
| 338 | Ga0495645_0134377 | 3300046543 | Bacteria | 1731 |
| 339 | Ga0495667_0064123 | 3300046559 | Bacteria | 2403 |
| 340 | Ga0495668_0002288 | 3300046616 | Bacteria | 16104 |
| 341 | Ga0495635_0017170 | 3300046663 | Bacteria | 5054 |
| 342 | Ga0495599_0035720 | 3300046678 | Bacteria | 3120 |
| 343 | Ga0495599_0120304 | 3300046678 | Bacteria | 1632 |
| 344 | Ga0495623_0036778 | 3300046679 | Bacteria | 3136 |
| 345 | Ga0495646_0015252 | 3300046680 | Bacteria | 4879 |
| 346 | Ga0495646_0109113 | 3300046680 | Bacteria | 1577 |
| 347 | Ga0495613_0684417 | 3300046689 | Bacteria | 676 |
| 348 | Ga0495600_0686886 | 3300046809 | Bacteria | 616 |
| 349 | Ga0495604_0037228 | 3300047317 | Bacteria | 3832 |
| 350 | Ga0495604_0118256 | 3300047317 | Bacteria | 1921 |
| 351 | Ga0495674_0134929 | 3300047319 | Bacteria | 2077 |
| 352 | Ga0495680_0036485 | 3300047322 | Bacteria | 3945 |
| 353 | Ga0495680_0122502 | 3300047322 | Bacteria | 1918 |
| 354 | Ga0495675_0239524 | 3300047444 | Bacteria | 1092 |
| 355 | Ga0495684_0026178 | 3300047471 | Bacteria | 4481 |
| 356 | Ga0495684_0064884 | 3300047471 | Bacteria | 2775 |
| 357 | Ga0495593_0094480 | 3300047673 | Bacteria | 1538 |
| 358 | Ga0495593_0401662 | 3300047673 | Bacteria | 685 |
| 359 | Ga0495602_0042042 | 3300048088 | Bacteria | 4167 |
| 360 | Ga0495602_0123242 | 3300048088 | Bacteria | 2081 |
| 361 | Ga0496100_0255161 | 3300048903 | Bacteria | 1298 |
| 362 | Ga0496100_0559254 | 3300048903 | Bacteria | 885 |
| 363 | Ga0496101_0089944 | 3300048904 | Bacteria | 2282 |
| 364 | Ga0496102_0023288 | 3300048905 | Bacteria | 5498 |
| 365 | Ga0496103_0030118 | 3300048906 | Bacteria | 3301 |
| 366 | Ga0496104_0005838 | 3300048907 | Bacteria | 10783 |
| 367 | Ga0496105_0003593 | 3300048908 | Bacteria | 11513 |
| 368 | Ga0496106_0534186 | 3300048909 | Bacteria | 941 |
| 369 | Ga0496107_0023573 | 3300048910 | Bacteria | 4351 |
| 370 | Ga0496108_0239871 | 3300048911 | Bacteria | 1577 |
| 371 | Ga0496108_1472803 | 3300048911 | Bacteria | 567 |
| 372 | Ga0496109_0019013 | 3300048912 | Bacteria | 6051 |
| 373 | Ga0496109_0145107 | 3300048912 | Bacteria | 2220 |
| 374 | Ga0496109_0184007 | 3300048912 | Bacteria | 1963 |
| 375 | Ga0496109_0351979 | 3300048912 | Bacteria | 1391 |
| 376 | Ga0496110_0122830 | 3300048913 | Bacteria | 2341 |
| 377 | Ga0496110_1293126 | 3300048913 | Bacteria | 638 |
| 378 | Ga0496111_0078856 | 3300048914 | Bacteria | 2402 |
| 379 | Ga0496113_0274321 | 3300048916 | Bacteria | 1348 |
| 380 | Ga0496114_0072030 | 3300048917 | Bacteria | 2905 |
| 381 | Ga0496115_0001458 | 3300048918 | Bacteria | 16992 |
| 382 | Ga0496119_0377000 | 3300048922 | Bacteria | 681 |
| 383 | Ga0496125_0045276 | 3300048928 | Bacteria | 3706 |
| 384 | Ga0501311_022955 | 3300049527 | Bacteria | 860 |
| 385 | Ga0501317_040731 | 3300049533 | Bacteria | 708 |
| 386 | Ga0501317_084095 | 3300049533 | Bacteria | 554 |
| 387 | Ga0501320_070981 | 3300049536 | Bacteria | 504 |
| 388 | Ga0501321_044431 | 3300049537 | Bacteria | 634 |
| 389 | Ga0501031_0041571 | 3300049568 | Bacteria | 3001 |
| 390 | Ga0501031_0882957 | 3300049568 | Bacteria | 572 |
| 391 | Ga0501032_0308237 | 3300049569 | Bacteria | 1023 |
| 392 | Ga0501034_0573723 | 3300049571 | Bacteria | 1036 |
| 393 | Ga0501036_0403721 | 3300049572 | Bacteria | 1140 |
| 394 | Ga0501036_1737633 | 3300049572 | Bacteria | 502 |
| 395 | Ga0501037_0039040 | 3300049573 | Bacteria | 3496 |
| 396 | Ga0501037_0183709 | 3300049573 | Bacteria | 1483 |
| 397 | Ga0501037_0902465 | 3300049573 | Bacteria | 579 |
| 398 | Ga0501038_0006895 | 3300049574 | Bacteria | 10495 |
| 399 | Ga0501038_0853822 | 3300049574 | Bacteria | 674 |
| 400 | Ga0501039_0172567 | 3300049575 | Bacteria | 1700 |
| 401 | Ga0501039_0852684 | 3300049575 | Bacteria | 710 |
| 402 | Ga0501040_0230767 | 3300049576 | Bacteria | 1318 |
| 403 | Ga0501040_0949365 | 3300049576 | Bacteria | 623 |
| 404 | Ga0501041_0152598 | 3300049577 | Bacteria | 1443 |
| 405 | Ga0501041_0642322 | 3300049577 | Bacteria | 678 |
| 406 | Ga0501042_0122510 | 3300049578 | Bacteria | 1872 |
| 407 | Ga0501042_0521759 | 3300049578 | Bacteria | 863 |
| 408 | Ga0501042_1144552 | 3300049578 | Bacteria | 567 |
| 409 | Ga0501043_0026014 | 3300049579 | Bacteria | 4591 |
| 410 | Ga0501046_0440449 | 3300049580 | Bacteria | 938 |
| 411 | Ga0501046_0733891 | 3300049580 | Bacteria | 694 |
| 412 | Ga0501047_0000189 | 3300049581 | Bacteria | 74827 |
| 413 | Ga0501047_0183807 | 3300049581 | Bacteria | 1956 |
| 414 | Ga0501048_0174341 | 3300049582 | Bacteria | 1524 |
| 415 | Ga0501048_0186591 | 3300049582 | Bacteria | 1470 |
| 416 | Ga0501048_0610588 | 3300049582 | Bacteria | 783 |
| 417 | Ga0501048_1393973 | 3300049582 | Bacteria | 504 |
| 418 | Ga0501067_0144957 | 3300049583 | Bacteria | 1323 |
| 419 | Ga0501069_0082329 | 3300049585 | Bacteria | 1814 |
| 420 | Ga0501069_0531926 | 3300049585 | Bacteria | 702 |
| 421 | Ga0501070_0004209 | 3300049586 | Bacteria | 12372 |
| 422 | Ga0501073_0060941 | 3300049589 | Bacteria | 2633 |
| 423 | Ga0501074_0004634 | 3300049590 | Bacteria | 9846 |
| 424 | Ga0501074_0175660 | 3300049590 | Bacteria | 1528 |
| 425 | Ga0501075_0695212 | 3300049591 | Bacteria | 775 |
| 426 | Ga0501075_0964034 | 3300049591 | Bacteria | 648 |
| 427 | Ga0501076_0830927 | 3300049592 | Bacteria | 762 |
| 428 | Ga0501079_0000560 | 3300049741 | Bacteria | 24402 |
| 429 | Ga0501079_1477465 | 3300049741 | Bacteria | 535 |
| 430 | Ga0501080_0001095 | 3300049742 | Bacteria | 22325 |
| 431 | Ga0501080_1065361 | 3300049742 | Bacteria | 699 |
| 432 | Ga0501081_0239496 | 3300049743 | Bacteria | 1323 |
| 433 | Ga0501081_0649140 | 3300049743 | Bacteria | 791 |
| 434 | Ga0501035_1200700 | 3300049822 | Bacteria | 588 |
| 435 | Ga0501044_0193717 | 3300049823 | Bacteria | 1994 |
| 436 | Ga0501045_0167247 | 3300049824 | Bacteria | 1638 |
| 437 | Ga0501045_0620666 | 3300049824 | Bacteria | 800 |
| 438 | nmdc:mga00v17_32253_c1 | 3300050491 | Bacteria | 3095 |
| 439 | nmdc:mga00v17_45217_c1 | 3300050491 | Bacteria | 2659 |
| 440 | nmdc:mga00v17_554636_c1 | 3300050491 | Bacteria | 743 |
| 441 | nmdc:mga0yw44_10082_c1 | 3300050492 | Bacteria | 4810 |
| 442 | nmdc:mga0yw44_1051209_c1 | 3300050492 | Bacteria | 551 |
| 443 | nmdc:mga0yw44_118354_c1 | 3300050492 | Bacteria | 1704 |
| 444 | nmdc:mga0yw44_193994_c1 | 3300050492 | Bacteria | 1340 |
| 445 | nmdc:mga0yw44_206750_c1 | 3300050492 | Bacteria | 1298 |
| 446 | nmdc:mga0yw44_31193_c1 | 3300050492 | Bacteria | 3097 |
| 447 | nmdc:mga0yw44_713522_c1 | 3300050492 | Bacteria | 681 |
| 448 | nmdc:mga0yw44_749709_c1 | 3300050492 | Bacteria | 663 |
| 449 | nmdc:mga06z11_417267_c1 | 3300050494 | Bacteria | 809 |
| 450 | nmdc:mga07m45_121747_c1 | 3300050496 | Bacteria | 1507 |
| 451 | Ga0495601_0061839 | 3300053077 | Bacteria | 2377 |
| 452 | Ga0495612_0030698 | 3300053078 | Bacteria | 2165 |
| 453 | Ga0495595_0060279 | 3300053084 | Bacteria | 1776 |
| 454 | Ga0495595_0072241 | 3300053084 | Bacteria | 1632 |
| 455 | Ga0495619_0735242 | 3300053085 | Bacteria | 670 |
| 456 | Ga0500560_161886 | 3300053107 | Bacteria | 739 |
| 457 | Ga0500603_097216 | 3300053150 | Bacteria | 871 |
| 458 | Ga0501084_0243388 | 3300054114 | Bacteria | 1518 |
| 459 | Ga0501084_0631954 | 3300054114 | Bacteria | 904 |
| 460 | Ga0587070_223044 | 3300059491 | Bacteria | 512 |
| 461 | Ga0587086_046967 | 3300059507 | Bacteria | 685 |
| 462 | Ga0587115_101412 | 3300059626 | Bacteria | 534 |
| 463 | Ga0587128_090411 | 3300059630 | Bacteria | 627 |
| 464 | Ga0587069_112658 | 3300059642 | Bacteria | 568 |
| 465 | Ga0587111_0088460 | 3300060346 | Bacteria | 752 |
| 466 | Ga0587111_0178585 | 3300060346 | Bacteria | 589 |
| 467 | Ga0501082_0562375 | 3300060353 | Bacteria | 998 |
| 468 | Ga0466962_0027632 | 3300061719 | Bacteria | 2722 |
| 469 | Ga0530510_0087568 | 3300061734 | Bacteria | 2269 |
| 470 | Ga0530510_1081173 | 3300061734 | Bacteria | 614 |
| 471 | Ga0530510_1208812 | 3300061734 | Bacteria | 579 |
| 472 | 2566993527 | 2565956761 | Bacteria | 6601618 |
| 473 | 2643825477 | 2643221561 | Bacteria | 4984412 |
| 474 | 2643889078 | 2643221576 | Bacteria | 5214352 |
| 475 | 2643958133 | 2643221590 | Bacteria | 5214697 |
| 476 | 2644034613 | 2643221604 | Bacteria | 5014917 |
| 477 | 2644098984 | 2643221617 | Bacteria | 5139111 |
| 478 | 2644114865 | 2643221620 | Bacteria | 5134593 |
| 479 | 2644531473 | 2643221696 | Bacteria | 5431823 |
| 480 | 2738867976 | 2738541305 | Bacteria | 4910150 |
| 481 | 2738887019 | 2738541308 | Bacteria | 7020677 |
| 482 | 2799184138 | 2799112218 | Bacteria | 4315149 |
| 483 | 2812332291 | 2811994874 | Bacteria | 5367947 |
| 484 | 2856743595 | 2856741275 | Bacteria | 8096094 |
| 485 | 2866615716 | 2866612099 | Bacteria | 7543886 |
| 486 | 2891397795 | 2891395885 | Bacteria | 9251614 |
| 487 | 2891554464 | 2891554331 | Bacteria | 8812224 |
| 488 | 2891564897 | 2891562705 | Bacteria | 8039471 |
| 489 | 2904540062 | 2904535858 | Bacteria | 6308016 |
| 490 | 2917741103 | 2917736166 | Bacteria | 9690793 |
| 491 | 2922560566 | 2922554459 | Bacteria | 6683962 |
| 492 | 2935395962 | 2935390628 | Bacteria | 7043367 |
| 493 | 2956942532 | 2956939328 | Bacteria | 3474458 |
| 494 | 3001119566 | 3001119090 | Bacteria | 3449530 |
| 495 | 3006427686 | 3006425503 | Bacteria | 6491253 |
| 496 | Ga0395899_0196920 | |||
| 497 | JGI24744J21845_10009530 | |||
| 498 | Ga0058862_12737353 | |||
| 499 | Ga0058862_12869315 | |||
| 500 | Ga0070658_10000108 | |||
| 501 | Ga0070658_10655617 | |||
| 502 | Ga0070683_100381343 | |||
| 503 | Ga0070683_102246263 | |||
| 504 | Ga0070690_100524030 | |||
| 505 | Ga0070670_100737972 | |||
| 506 | Ga0070680_100315053 | |||
| 507 | Ga0070680_100413324 | |||
| 508 | Ga0070682_100035749 | |||
| 509 | Ga0070682_100158008 | |||
| 510 | Ga0070682_101999688 | |||
| 511 | Ga0068868_100100797 | |||
| 512 | Ga0070660_100645101 | |||
| 513 | Ga0070692_10046789 | |||
| 514 | Ga0070668_100403292 | |||
| 515 | Ga0070669_100248454 | |||
| 516 | Ga0070675_100087605 | |||
| 517 | Ga0070674_100012101 | |||
| 518 | Ga0070673_100042370 | |||
| 519 | Ga0070659_100295860 | |||
| 520 | Ga0070667_100748923 | |||
| 521 | Ga0070714_100217833 | |||
| 522 | Ga0070714_100576929 | |||
| 523 | Ga0070710_10410587 | |||
| 524 | Ga0070701_10005213 | |||
| 525 | Ga0070700_100006435 | |||
| 526 | Ga0070700_100086553 | |||
| 527 | Ga0070700_101005144 | |||
| 528 | Ga0070708_101022165 | |||
| 529 | Ga0070663_100012134 | |||
| 530 | Ga0070678_100395912 | |||
| 531 | Ga0070678_101423109 | |||
| 532 | Ga0070681_10250769 | |||
| 533 | Ga0068867_100030779 | |||
| 534 | Ga0070685_10011861 | |||
| 535 | Ga0070707_100209324 | |||
| 536 | Ga0070698_100010105 | |||
| 537 | Ga0070679_100115562 | |||
| 538 | Ga0070679_100213646 | |||
| 539 | Ga0070684_100142372 | |||
| 540 | Ga0070684_101391699 | |||
| 541 | Ga0068853_100711115 | |||
| 542 | Ga0070672_100007050 | |||
| 543 | Ga0070672_100190848 | |||
| 544 | Ga0070686_100771645 | |||
| 545 | Ga0070693_100871831 | |||
| 546 | Ga0068857_100382946 | |||
| 547 | Ga0068854_100115990 | |||
| 548 | Ga0068852_100120415 | |||
| 549 | Ga0068864_100037762 | |||
| 550 | Ga0068861_100003359 | |||
| 551 | Ga0068851_10027499 | |||
| 552 | Ga0068870_10014561 | |||
| 553 | Ga0068870_10194647 | |||
| 554 | Ga0068863_100692270 | |||
| 555 | Ga0075365_10010977 | |||
| 556 | Ga0075365_10014742 | |||
| 557 | Ga0075365_10049966 | |||
| 558 | Ga0075365_10236008 | |||
| 559 | Ga0075365_10623557 | |||
| 560 | Ga0075365_10686157 | |||
| 561 | Ga0075365_10730116 | |||
| 562 | Ga0075368_10384068 | |||
| 563 | Ga0075363_100388722 | |||
| 564 | Ga0075364_10093461 | |||
| 565 | Ga0075364_10152521 | |||
| 566 | Ga0075364_11079502 | |||
| 567 | Ga0075367_10787202 | |||
| 568 | Ga0075370_10046479 | |||
| 569 | Ga0075370_10819968 | |||
| 570 | Ga0068871_101385686 | |||
| 571 | Ga0068865_100018163 | |||
| 572 | Ga0099794_10286206 | |||
| 573 | Ga0105245_10101968 | |||
| 574 | Ga0105245_10801544 | |||
| 575 | Ga0114129_11668402 | |||
| 576 | Ga0105243_10038026 | |||
| 577 | Ga0105248_10886890 | |||
| 578 | Ga0105248_12392955 | |||
| 579 | Ga0105239_10151037 | |||
| 580 | Ga0105239_12241190 | |||
| 581 | Ga0105246_10251179 | |||
| 582 | Ga0157317_1021752 | |||
| 583 | Ga0154014_141112 | |||
| 584 | Ga0157373_10447428 | |||
| 585 | Ga0157369_10016567 | |||
| 586 | Ga0157369_10824476 | |||
| 587 | Ga0157369_11216324 | |||
| 588 | Ga0157372_10065485 | |||
| 589 | Ga0157372_10079897 | |||
| 590 | Ga0157372_10722806 | |||
| 591 | Ga0157380_10008910 | |||
| 592 | Ga0157380_12346722 | |||
| 593 | Ga0182008_10027037 | |||
| 594 | Ga0182008_10384119 | |||
| 595 | Ga0163161_10150622 | |||
| 596 | Ga0184596_101227 | |||
| 597 | Ga0197907_10146759 | |||
| 598 | Ga0197907_10322276 | |||
| 599 | Ga0197907_11237439 | |||
| 600 | Ga0206349_1619355 | |||
| 601 | Ga0206349_1817926 | |||
| 602 | Ga0206349_1962344 | |||
| 603 | Ga0206355_1154318 | |||
| 604 | Ga0206355_1712316 | |||
| 605 | Ga0206351_10341761 | |||
| 606 | Ga0206352_10231795 | |||
| 607 | Ga0206352_10578904 | |||
| 608 | Ga0206352_10970858 | |||
| 609 | Ga0206354_10142487 | |||
| 610 | Ga0206353_11664223 | |||
| 611 | Ga0154015_1350112 | |||
| 612 | Ga0154015_1598831 | |||
| 613 | Ga0213875_10474808 | |||
| 614 | Ga0213875_10648598 | |||
| 615 | Ga0224712_10048069 | |||
| 616 | Ga0224712_10122458 | |||
| 617 | Ga0224712_10222992 | |||
| 618 | Ga0207682_10479408 | |||
| 619 | Ga0207692_10003208 | |||
| 620 | Ga0207692_10461132 | |||
| 621 | Ga0207647_10199558 | |||
| 622 | Ga0207699_10042779 | |||
| 623 | Ga0207643_10016651 | |||
| 624 | Ga0207705_10000394 | |||
| 625 | Ga0207707_10285653 | |||
| 626 | Ga0207707_10358641 | |||
| 627 | Ga0207695_11237800 | |||
| 628 | Ga0207693_10487732 | |||
| 629 | Ga0207663_10227172 | |||
| 630 | Ga0207660_10011743 | |||
| 631 | Ga0207660_10148702 | |||
| 632 | Ga0207662_10051965 | |||
| 633 | Ga0207657_10427929 | |||
| 634 | Ga0207657_10562199 | |||
| 635 | Ga0207652_10188091 | |||
| 636 | Ga0207652_11219653 | |||
| 637 | Ga0207646_10284885 | |||
| 638 | Ga0207681_10221868 | |||
| 639 | Ga0207687_10223585 | |||
| 640 | Ga0207700_10033181 | |||
| 641 | Ga0207664_10071408 | |||
| 642 | Ga0207664_11596395 | |||
| 643 | Ga0207690_10219512 | |||
| 644 | Ga0207690_11452646 | |||
| 645 | Ga0207709_10079021 | |||
| 646 | Ga0207669_11058817 | |||
| 647 | Ga0207665_10080913 | |||
| 648 | Ga0207691_10009955 | |||
| 649 | Ga0207691_10202026 | |||
| 650 | Ga0207661_10355552 | |||
| 651 | Ga0207661_10931155 | |||
| 652 | Ga0207667_11638687 | |||
| 653 | Ga0207712_10318795 | |||
| 654 | Ga0207668_10228115 | |||
| 655 | Ga0207703_11401952 | |||
| 656 | Ga0207639_10166611 | |||
| 657 | Ga0207678_10000897 | |||
| 658 | Ga0207678_10003714 | |||
| 659 | Ga0207708_10001687 | |||
| 660 | Ga0207702_10604801 | |||
| 661 | Ga0207648_10014220 | |||
| 662 | Ga0207648_10587989 | |||
| 663 | Ga0207648_10905147 | |||
| 664 | Ga0207674_10192866 | |||
| 665 | Ga0207675_100001326 | |||
| 666 | Ga0207675_100686772 | |||
| 667 | Ga0207698_10076937 | |||
| 668 | Ga0209813_10172092 | |||
| 669 | Ga0209974_10094577 | |||
| 670 | Ga0265334_10287891 | |||
| 671 | Ga0265338_10005567 | |||
| 672 | Ga0265338_10006545 | |||
| 673 | Ga0265338_10417961 | |||
| 674 | Ga0265763_1001941 | |||
| 675 | Ga0265766_1002461 | |||
| 676 | Ga0265766_1013145 | |||
| 677 | Ga0265776_100428 | |||
| 678 | Ga0265764_100965 | |||
| 679 | Ga0265764_116549 | |||
| 680 | Ga0265769_100930 | |||
| 681 | Ga0265768_100454 | |||
| 682 | Ga0265774_105333 | |||
| 683 | Ga0265773_1006007 | |||
| 684 | Ga0265325_10089811 | |||
| 685 | Ga0265339_10019099 | |||
| 686 | Ga0265316_10161957 | |||
| 687 | Ga0265316_10170174 | |||
| 688 | Ga0307408_101231071 | |||
| 689 | Ga0310117_110776 | |||
| 690 | Ga0265313_10015665 | |||
| 691 | Ga0310103_114835 | |||
| 692 | Ga0310108_120169 | |||
| 693 | Ga0310101_110523 | |||
| 694 | Ga0265314_10055182 | |||
| 695 | Ga0265342_10691915 | |||
| 696 | Ga0307405_10681888 | |||
| 697 | Ga0307413_10156875 | |||
| 698 | Ga0307413_11014723 | |||
| 699 | Ga0307410_10341873 | |||
| 700 | Ga0307410_11704789 | |||
| 701 | Ga0307406_10016487 | |||
| 702 | Ga0307407_10412643 | |||
| 703 | Ga0307407_10559291 | |||
| 704 | Ga0307412_10053470 | |||
| 705 | Ga0307409_100000367 | |||
| 706 | Ga0307416_100015640 | |||
| 707 | Ga0307416_103188868 | |||
| 708 | Ga0307414_10427146 | |||
| 709 | Ga0307415_100000032 | |||
| 710 | Ga0307415_100075041 | |||
| 711 | Ga0307415_100252576 | |||
| 712 | Ga0316585_10079289 | |||
| 713 | Ga0316593_10040205 | |||
| 714 | Ga0316592_1038841 | |||
| 715 | Ga0316588_1074390 | |||
| 716 | Ga0316587_1116597 | |||
| 717 | Ga0316596_1072667 | |||
| 718 | Ga0373934_0026501 | |||
| 719 | Ga0373923_0018320 | |||
| 720 | Ga0373923_0349931 | |||
| 721 | Ga0373936_0056154 | |||
| 722 | Ga0373953_0135287 | |||
| 723 | Ga0373953_0168129 | |||
| 724 | Ga0373954_0070794 | |||
| 725 | Ga0373956_0101551 | |||
| 726 | Ga0373956_0149318 | |||
| 727 | Ga0373957_0180500 | |||
| 728 | Ga0373955_0011723 | |||
| 729 | Ga0316574_0049933 | |||
| 730 | Ga0373924_0069449 | |||
| 731 | Ga0373924_0170941 | |||
| 732 | Ga0373927_0150530 | |||
| 733 | Ga0373933_0009019 | |||
| 734 | Ga0373933_0148932 | |||
| 735 | Ga0373937_0115946 | |||
| 736 | Ga0373937_0560267 | |||
| 737 | Ga0265778_017597 | |||
| 738 | Ga0265778_049333 | |||
| 739 | Ga0310112_011423 | |||
| 740 | Ga0316582_0404005 | |||
| 741 | Ga0316584_0231823 | |||
| 742 | Ga0373925_0000157 | |||
| 743 | Ga0395899_0025224 | |||
| 744 | Ga0395899_0424666 | |||
| 745 | Ga0395900_0440867 | |||
| 746 | Ga0395898_0282733 | |||
| 747 | Ga0395898_1523031 | |||
| 748 | Ga0395905_0360850 | |||
| 749 | Ga0395905_0477211 | |||
| 750 | Ga0436364_1061164 | |||
| 751 | Ga0395901_0010220 | |||
| 752 | Ga0395901_0072718 | |||
| 753 | Ga0395901_0120893 | |||
| 754 | Ga0436365_1510703 | |||
| 755 | Ga0439438_025187 | |||
| 756 | Ga0439447_112275 | |||
| 757 | Ga0439461_0010968 | |||
| 758 | Ga0451789_0605474 | |||
| 759 | Ga0451791_1932806 | |||
| 760 | Ga0451807_0289417 | |||
| 761 | Ga0451837_1764938 | |||
| 762 | Ga0451847_0815854 | |||
| 763 | Ga0451853_2038950 | |||
| 764 | Ga0439431_0051371 | |||
| 765 | Ga0439442_012146 | |||
| 766 | Ga0439445_0103532 | |||
| 767 | Ga0439432_149614 | |||
| 768 | Ga0439446_0006528 | |||
| 769 | Ga0439434_0004064 | |||
| 770 | Ga0466972_0099045 | |||
| 771 | Ga0466972_0109256 | |||
| 772 | Ga0466972_0445785 | |||
| 773 | Ga0466965_0004896 | |||
| 774 | Ga0466965_0025950 | |||
| 775 | Ga0466965_0577410 | |||
| 776 | Ga0466966_0595340 | |||
| 777 | Ga0466961_0060843 | |||
| 778 | Ga0466961_0424864 | |||
| 779 | Ga0466961_0446910 | |||
| 780 | Ga0466963_0056511 | |||
| 781 | Ga0466963_0072651 | |||
| 782 | Ga0466963_0074084 | |||
| 783 | Ga0466963_0947163 | |||
| 784 | Ga0466964_0005611 | |||
| 785 | Ga0466964_0157367 | |||
| 786 | Ga0466964_0573833 | |||
| 787 | Ga0466971_0028543 | |||
| 788 | Ga0466971_0153184 | |||
| 789 | Ga0466971_0154169 | |||
| 790 | Ga0466971_0465085 | |||
| 791 | Ga0466968_0023342 | |||
| 792 | Ga0466970_0012339 | |||
| 793 | Ga0466970_0015953 | |||
| 794 | Ga0466970_0083448 | |||
| 795 | Ga0466970_0191725 | |||
| 796 | Ga0466970_0328645 | |||
| 797 | Ga0466970_0474909 | |||
| 798 | Ga0466970_0871145 | |||
| 799 | Ga0466970_0889466 | |||
| 800 | Ga0466957_0164507 | |||
| 801 | Ga0466957_0607117 | |||
| 802 | Ga0466957_1358883 | |||
| 803 | Ga0466960_0005570 | |||
| 804 | Ga0466960_0020278 | |||
| 805 | Ga0466960_0088641 | |||
| 806 | Ga0466960_0367969 | |||
| 807 | Ga0466960_0430028 | |||
| 808 | Ga0466959_0230548 | |||
| 809 | Ga0466958_0052250 | |||
| 810 | Ga0466958_0149174 | |||
| 811 | Ga0466958_0688262 | |||
| 812 | Ga0466967_0047816 | |||
| 813 | Ga0466967_0081787 | |||
| 814 | Ga0466967_0153929 | |||
| 815 | Ga0466967_0280597 | |||
| 816 | Ga0466967_0996205 | |||
| 817 | Ga0466967_1180455 | |||
| 818 | Ga0495592_0231636 | |||
| 819 | Ga0495651_0028321 | |||
| 820 | Ga0495651_0068479 | |||
| 821 | Ga0495653_0041539 | |||
| 822 | Ga0495653_0090702 | |||
| 823 | Ga0495662_0125483 | |||
| 824 | Ga0495664_0073765 | |||
| 825 | Ga0495618_0070142 | |||
| 826 | Ga0495628_0094744 | |||
| 827 | Ga0495640_0098586 | |||
| 828 | Ga0495586_0077349 | |||
| 829 | Ga0495586_0130717 | |||
| 830 | Ga0495587_0002850 | |||
| 831 | Ga0495587_0049966 | |||
| 832 | Ga0495645_0059145 | |||
| 833 | Ga0495645_0134377 | |||
| 834 | Ga0495667_0064123 | |||
| 835 | Ga0495668_0002288 | |||
| 836 | Ga0495635_0017170 | |||
| 837 | Ga0495599_0035720 | |||
| 838 | Ga0495599_0120304 | |||
| 839 | Ga0495623_0036778 | |||
| 840 | Ga0495646_0015252 | |||
| 841 | Ga0495646_0109113 | |||
| 842 | Ga0495613_0684417 | |||
| 843 | Ga0495600_0686886 | |||
| 844 | Ga0495604_0037228 | |||
| 845 | Ga0495604_0118256 | |||
| 846 | Ga0495674_0134929 | |||
| 847 | Ga0495680_0036485 | |||
| 848 | Ga0495680_0122502 | |||
| 849 | Ga0495675_0239524 | |||
| 850 | Ga0495684_0026178 | |||
| 851 | Ga0495684_0064884 | |||
| 852 | Ga0495593_0094480 | |||
| 853 | Ga0495593_0401662 | |||
| 854 | Ga0495602_0042042 | |||
| 855 | Ga0495602_0123242 | |||
| 856 | Ga0496100_0255161 | |||
| 857 | Ga0496100_0559254 | |||
| 858 | Ga0496101_0089944 | |||
| 859 | Ga0496102_0023288 | |||
| 860 | Ga0496103_0030118 | |||
| 861 | Ga0496104_0005838 | |||
| 862 | Ga0496105_0003593 | |||
| 863 | Ga0496106_0534186 | |||
| 864 | Ga0496107_0023573 | |||
| 865 | Ga0496108_0239871 | |||
| 866 | Ga0496108_1472803 | |||
| 867 | Ga0496109_0019013 | |||
| 868 | Ga0496109_0145107 | |||
| 869 | Ga0496109_0184007 | |||
| 870 | Ga0496109_0351979 | |||
| 871 | Ga0496110_0122830 | |||
| 872 | Ga0496110_1293126 | |||
| 873 | Ga0496111_0078856 | |||
| 874 | Ga0496113_0274321 | |||
| 875 | Ga0496114_0072030 | |||
| 876 | Ga0496115_0001458 | |||
| 877 | Ga0496119_0377000 | |||
| 878 | Ga0496125_0045276 | |||
| 879 | Ga0501311_022955 | |||
| 880 | Ga0501317_040731 | |||
| 881 | Ga0501317_084095 | |||
| 882 | Ga0501320_070981 | |||
| 883 | Ga0501321_044431 | |||
| 884 | Ga0501031_0041571 | |||
| 885 | Ga0501031_0882957 | |||
| 886 | Ga0501032_0308237 | |||
| 887 | Ga0501034_0573723 | |||
| 888 | Ga0501036_0403721 | |||
| 889 | Ga0501036_1737633 | |||
| 890 | Ga0501037_0039040 | |||
| 891 | Ga0501037_0183709 | |||
| 892 | Ga0501037_0902465 | |||
| 893 | Ga0501038_0006895 | |||
| 894 | Ga0501038_0853822 | |||
| 895 | Ga0501039_0172567 | |||
| 896 | Ga0501039_0852684 | |||
| 897 | Ga0501040_0230767 | |||
| 898 | Ga0501040_0949365 | |||
| 899 | Ga0501041_0152598 | |||
| 900 | Ga0501041_0642322 | |||
| 901 | Ga0501042_0122510 | |||
| 902 | Ga0501042_0521759 | |||
| 903 | Ga0501042_1144552 | |||
| 904 | Ga0501043_0026014 | |||
| 905 | Ga0501046_0440449 | |||
| 906 | Ga0501046_0733891 | |||
| 907 | Ga0501047_0000189 | |||
| 908 | Ga0501047_0183807 | |||
| 909 | Ga0501048_0174341 | |||
| 910 | Ga0501048_0186591 | |||
| 911 | Ga0501048_0610588 | |||
| 912 | Ga0501048_1393973 | |||
| 913 | Ga0501067_0144957 | |||
| 914 | Ga0501069_0082329 | |||
| 915 | Ga0501069_0531926 | |||
| 916 | Ga0501070_0004209 | |||
| 917 | Ga0501073_0060941 | |||
| 918 | Ga0501074_0004634 | |||
| 919 | Ga0501074_0175660 | |||
| 920 | Ga0501075_0695212 | |||
| 921 | Ga0501075_0964034 | |||
| 922 | Ga0501076_0830927 | |||
| 923 | Ga0501079_0000560 | |||
| 924 | Ga0501079_1477465 | |||
| 925 | Ga0501080_0001095 | |||
| 926 | Ga0501080_1065361 | |||
| 927 | Ga0501081_0239496 | |||
| 928 | Ga0501081_0649140 | |||
| 929 | Ga0501035_1200700 | |||
| 930 | Ga0501044_0193717 | |||
| 931 | Ga0501045_0167247 | |||
| 932 | Ga0501045_0620666 | |||
| 933 | nmdc:mga00v17_32253_c1 | |||
| 934 | nmdc:mga00v17_45217_c1 | |||
| 935 | nmdc:mga00v17_554636_c1 | |||
| 936 | nmdc:mga0yw44_10082_c1 | |||
| 937 | nmdc:mga0yw44_1051209_c1 | |||
| 938 | nmdc:mga0yw44_118354_c1 | |||
| 939 | nmdc:mga0yw44_193994_c1 | |||
| 940 | nmdc:mga0yw44_206750_c1 | |||
| 941 | nmdc:mga0yw44_31193_c1 | |||
| 942 | nmdc:mga0yw44_713522_c1 | |||
| 943 | nmdc:mga0yw44_749709_c1 | |||
| 944 | nmdc:mga06z11_417267_c1 | |||
| 945 | nmdc:mga07m45_121747_c1 | |||
| 946 | Ga0495601_0061839 | |||
| 947 | Ga0495612_0030698 | |||
| 948 | Ga0495595_0060279 | |||
| 949 | Ga0495595_0072241 | |||
| 950 | Ga0495619_0735242 | |||
| 951 | Ga0500560_161886 | |||
| 952 | Ga0500603_097216 | |||
| 953 | Ga0501084_0243388 | |||
| 954 | Ga0501084_0631954 | |||
| 955 | Ga0587070_223044 | |||
| 956 | Ga0587086_046967 | |||
| 957 | Ga0587115_101412 | |||
| 958 | Ga0587128_090411 | |||
| 959 | Ga0587069_112658 | |||
| 960 | Ga0587111_0088460 | |||
| 961 | Ga0587111_0178585 | |||
| 962 | Ga0501082_0562375 | |||
| 963 | Ga0466962_0027632 | |||
| 964 | Ga0530510_0087568 | |||
| 965 | Ga0530510_1081173 | |||
| 966 | Ga0530510_1208812 | |||
| 967 | 2566993527 | |||
| 968 | 2643825477 | |||
| 969 | 2643889078 | |||
| 970 | 2643958133 | |||
| 971 | 2644034613 | |||
| 972 | 2644098984 | |||
| 973 | 2644114865 | |||
| 974 | 2644531473 | |||
| 975 | 2738867976 | |||
| 976 | 2738887019 | |||
| 977 | 2799184138 | |||
| 978 | 2812332291 | |||
| 979 | 2856743595 | |||
| 980 | 2866615716 | |||
| 981 | 2891397795 | |||
| 982 | 2891554464 | |||
| 983 | 2891564897 | |||
| 984 | 2904540062 | |||
| 985 | 2917741103 | |||
| 986 | 2922560566 | |||
| 987 | 2935395962 | |||
| 988 | 2956942532 | |||
| 989 | 3001119566 | |||
| 990 | 3006427686 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8799 | 15 | 109 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.855 | 16 | 108 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.844 | 15 | 110 |
| 2k4z-assembly1.cif.gz_A | solution nmr structure of allochromatium vinosum dsrr: northeast structural genomics consortium target op5 | 0.8385 | 15 | 110 |
| 2d2a-assembly2.cif.gz_A | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8374 | 15 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O43045_97_205_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8963 | 16 | 117 | 2.60.300.12 |
| af_Q54P40_100_209_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8923 | 16 | 118 | 2.60.300.12 |
| af_D4A4L5_49_154_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8873 | 16 | 119 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8799 | 15 | 109 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8711 | 15 | 109 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X0R4M4-F1-model_v4 | ADP/ATP translocase (ADP,ATP carrier protein) | 0.9384 | 14 | 97 |
GO:0005471
GO:0005743 GO:0016226 GO:0051536 GO:0140021 GO:1990544 |
| AF-A0A6N8UQF9-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.931 | 17 | 110 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A4Q3NPK0-F1-model_v4 | deleted | 0.926 | 15 | 107 |
|
| AF-A0A259FTK2-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.9201 | 15 | 102 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A0R2Q3V8-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.9166 | 10 | 111 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |