F454751

General Info

Members Datasets Scaffolds Average Seq Length
495 326 990 119

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0196920|Ga0395899_0196920_956_1372
Length 138
Sequence MSDSCCGGGHSHEAPGATTTVAAPVDLDRREDQINLSPVAATKVKSLLEQEGRDDLSLRISVQPGGCSGLRYQLFFDERTLDGDVVTDFDGVAVVVDRMSVPYLNGAVIDFVDTIEKQGFTIDNPNATGSCACGDSFN

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
62 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
136 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
187 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
292 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
304 2643221561 Nocardioides sp. Root151 Isolate Unclassified
305 2643221576 Nocardioides sp. Root614 Isolate Unclassified
306 2643221590 Nocardioides sp. Root682 Isolate Unclassified
307 2643221604 Nocardioides sp. Root190 Isolate Unclassified
308 2643221617 Nocardioides sp. Root79 Isolate Unclassified
309 2643221620 Nocardioides sp. Root240 Isolate Unclassified
310 2643221696 Nocardioides sp. Root140 Isolate Unclassified
311 2738541305 Nocardioides sp. CF167 Isolate Unclassified
312 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
313 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
314 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
315 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
316 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
317 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
318 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
319 2891562705 Microbispora tritici MT50 Isolate Unclassified
320 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
321 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
322 2922554459 Rhodococcus sp. 66b Isolate Unclassified
323 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
324 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
325 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
326 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.64
Metatranscriptomes 11.52
Isolates 4.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.26
Nodule 0
Rhizoplane 4.85
Rhizosphere 82.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0196920 3300037312 Bacteria 1407
2 JGI24744J21845_10009530 3300002077 Bacteria 1992
3 Ga0058862_12737353 3300004803 Bacteria 546
4 Ga0058862_12869315 3300004803 Bacteria 717
5 Ga0070658_10000108 3300005327 Bacteria 73704
6 Ga0070658_10655617 3300005327 Bacteria 911
7 Ga0070683_100381343 3300005329 Bacteria 1343
8 Ga0070683_102246263 3300005329 Bacteria 524
9 Ga0070690_100524030 3300005330 Bacteria 890
10 Ga0070670_100737972 3300005331 Bacteria 887
11 Ga0070680_100315053 3300005336 Bacteria 1328
12 Ga0070680_100413324 3300005336 Bacteria 1151
13 Ga0070682_100035749 3300005337 Bacteria 3034
14 Ga0070682_100158008 3300005337 Bacteria 1563
15 Ga0070682_101999688 3300005337 Bacteria 510
16 Ga0068868_100100797 3300005338 Bacteria 2336
17 Ga0070660_100645101 3300005339 Bacteria 886
18 Ga0070692_10046789 3300005345 Bacteria 2237
19 Ga0070668_100403292 3300005347 Bacteria 1168
20 Ga0070669_100248454 3300005353 Bacteria 1416
21 Ga0070675_100087605 3300005354 Bacteria 2603
22 Ga0070674_100012101 3300005356 Bacteria 5286
23 Ga0070673_100042370 3300005364 Bacteria 3510
24 Ga0070659_100295860 3300005366 Bacteria 1349
25 Ga0070667_100748923 3300005367 Bacteria 905
26 Ga0070714_100217833 3300005435 Bacteria 1753
27 Ga0070714_100576929 3300005435 Bacteria 1079
28 Ga0070710_10410587 3300005437 Bacteria 910
29 Ga0070701_10005213 3300005438 Bacteria 5346
30 Ga0070700_100006435 3300005441 Bacteria 6283
31 Ga0070700_100086553 3300005441 Bacteria 2035
32 Ga0070700_101005144 3300005441 Bacteria 686
33 Ga0070708_101022165 3300005445 Bacteria 775
34 Ga0070663_100012134 3300005455 Bacteria 5438
35 Ga0070678_100395912 3300005456 Bacteria 1199
36 Ga0070678_101423109 3300005456 Bacteria 648
37 Ga0070681_10250769 3300005458 Bacteria 1683
38 Ga0068867_100030779 3300005459 Bacteria 3871
39 Ga0070685_10011861 3300005466 Bacteria 4568
40 Ga0070707_100209324 3300005468 Bacteria 1901
41 Ga0070698_100010105 3300005471 Bacteria 10081
42 Ga0070679_100115562 3300005530 Bacteria 2669
43 Ga0070679_100213646 3300005530 Bacteria 1892
44 Ga0070684_100142372 3300005535 Bacteria 2169
45 Ga0070684_101391699 3300005535 Bacteria 661
46 Ga0068853_100711115 3300005539 Bacteria 959
47 Ga0070672_100007050 3300005543 Bacteria 7599
48 Ga0070672_100190848 3300005543 Bacteria 1710
49 Ga0070686_100771645 3300005544 Bacteria 773
50 Ga0070693_100871831 3300005547 Bacteria 673
51 Ga0068857_100382946 3300005577 Bacteria 1306
52 Ga0068854_100115990 3300005578 Bacteria 2026
53 Ga0068852_100120415 3300005616 Bacteria 2401
54 Ga0068864_100037762 3300005618 Bacteria 4123
55 Ga0068861_100003359 3300005719 Bacteria 10606
56 Ga0068851_10027499 3300005834 Bacteria 2804
57 Ga0068870_10014561 3300005840 Bacteria 3716
58 Ga0068870_10194647 3300005840 Bacteria 1225
59 Ga0068863_100692270 3300005841 Bacteria 1013
60 Ga0075365_10010977 3300006038 Bacteria 5307
61 Ga0075365_10014742 3300006038 Bacteria 4707
62 Ga0075365_10049966 3300006038 Bacteria 2757
63 Ga0075365_10236008 3300006038 Bacteria 1284
64 Ga0075365_10623557 3300006038 Bacteria 762
65 Ga0075365_10686157 3300006038 Bacteria 724
66 Ga0075365_10730116 3300006038 Bacteria 699
67 Ga0075368_10384068 3300006042 Bacteria 615
68 Ga0075363_100388722 3300006048 Bacteria 819
69 Ga0075364_10093461 3300006051 Bacteria 1997
70 Ga0075364_10152521 3300006051 Bacteria 1558
71 Ga0075364_11079502 3300006051 Bacteria 545
72 Ga0075367_10787202 3300006178 Bacteria 606
73 Ga0075370_10046479 3300006353 Bacteria 2456
74 Ga0075370_10819968 3300006353 Bacteria 568
75 Ga0068871_101385686 3300006358 Bacteria 663
76 Ga0068865_100018163 3300006881 Bacteria 4535
77 Ga0099794_10286206 3300007265 Bacteria 852
78 Ga0105245_10101968 3300009098 Bacteria 2657
79 Ga0105245_10801544 3300009098 Bacteria 980
80 Ga0114129_11668402 3300009147 Bacteria 778
81 Ga0105243_10038026 3300009148 Bacteria 3746
82 Ga0105248_10886890 3300009177 Bacteria 1007
83 Ga0105248_12392955 3300009177 Bacteria 602
84 Ga0105239_10151037 3300010375 Bacteria 2592
85 Ga0105239_12241190 3300010375 Bacteria 635
86 Ga0105246_10251179 3300011119 Bacteria 1404
87 Ga0157317_1021752 3300012475 Bacteria 575
88 Ga0154014_141112 3300013052 Bacteria 588
89 Ga0157373_10447428 3300013100 Bacteria 929
90 Ga0157369_10016567 3300013105 Bacteria 8285
91 Ga0157369_10824476 3300013105 Bacteria 953
92 Ga0157369_11216324 3300013105 Bacteria 769
93 Ga0157372_10065485 3300013307 Bacteria 4080
94 Ga0157372_10079897 3300013307 Bacteria 3700
95 Ga0157372_10722806 3300013307 Bacteria 1158
96 Ga0157380_10008910 3300014326 Bacteria 7168
97 Ga0157380_12346722 3300014326 Bacteria 598
98 Ga0182008_10027037 3300014497 Bacteria 2908
99 Ga0182008_10384119 3300014497 Bacteria 751
100 Ga0163161_10150622 3300017792 Bacteria 1768
101 Ga0184596_101227 3300019176 Bacteria 534
102 Ga0197907_10146759 3300020069 Bacteria 528
103 Ga0197907_10322276 3300020069 Bacteria 916
104 Ga0197907_11237439 3300020069 Bacteria 711
105 Ga0206349_1619355 3300020075 Bacteria 682
106 Ga0206349_1817926 3300020075 Bacteria 840
107 Ga0206349_1962344 3300020075 Bacteria 569
108 Ga0206355_1154318 3300020076 Bacteria 3713
109 Ga0206355_1712316 3300020076 Bacteria 790
110 Ga0206351_10341761 3300020077 Bacteria 1054
111 Ga0206352_10231795 3300020078 Bacteria 1216
112 Ga0206352_10578904 3300020078 Bacteria 768
113 Ga0206352_10970858 3300020078 Bacteria 573
114 Ga0206354_10142487 3300020081 Bacteria 579
115 Ga0206353_11664223 3300020082 Bacteria 3223
116 Ga0154015_1350112 3300020610 Bacteria 613
117 Ga0154015_1598831 3300020610 Bacteria 743
118 Ga0213875_10474808 3300021388 Bacteria 600
119 Ga0213875_10648598 3300021388 Bacteria 511
120 Ga0224712_10048069 3300022467 Bacteria 1645
121 Ga0224712_10122458 3300022467 Bacteria 1128
122 Ga0224712_10222992 3300022467 Bacteria 863
123 Ga0207682_10479408 3300025893 Bacteria 589
124 Ga0207692_10003208 3300025898 Bacteria 6362
125 Ga0207692_10461132 3300025898 Bacteria 801
126 Ga0207647_10199558 3300025904 Bacteria 1158
127 Ga0207699_10042779 3300025906 Bacteria 2627
128 Ga0207643_10016651 3300025908 Bacteria 4010
129 Ga0207705_10000394 3300025909 Bacteria 38574
130 Ga0207707_10285653 3300025912 Bacteria 1428
131 Ga0207707_10358641 3300025912 Bacteria 1255
132 Ga0207695_11237800 3300025913 Bacteria 627
133 Ga0207693_10487732 3300025915 Bacteria 962
134 Ga0207663_10227172 3300025916 Bacteria 1361
135 Ga0207660_10011743 3300025917 Bacteria 5711
136 Ga0207660_10148702 3300025917 Bacteria 1798
137 Ga0207662_10051965 3300025918 Bacteria 2439
138 Ga0207657_10427929 3300025919 Bacteria 1040
139 Ga0207657_10562199 3300025919 Bacteria 891
140 Ga0207652_10188091 3300025921 Bacteria 1857
141 Ga0207652_11219653 3300025921 Bacteria 654
142 Ga0207646_10284885 3300025922 Bacteria 1493
143 Ga0207681_10221868 3300025923 Bacteria 1463
144 Ga0207687_10223585 3300025927 Bacteria 1484
145 Ga0207700_10033181 3300025928 Bacteria 3692
146 Ga0207664_10071408 3300025929 Bacteria 2796
147 Ga0207664_11596395 3300025929 Bacteria 574
148 Ga0207690_10219512 3300025932 Bacteria 1454
149 Ga0207690_11452646 3300025932 Bacteria 573
150 Ga0207709_10079021 3300025935 Bacteria 2114
151 Ga0207669_11058817 3300025937 Bacteria 683
152 Ga0207665_10080913 3300025939 Bacteria 2235
153 Ga0207691_10009955 3300025940 Bacteria 9129
154 Ga0207691_10202026 3300025940 Bacteria 1729
155 Ga0207661_10355552 3300025944 Bacteria 1322
156 Ga0207661_10931155 3300025944 Bacteria 800
157 Ga0207667_11638687 3300025949 Bacteria 611
158 Ga0207712_10318795 3300025961 Bacteria 1282
159 Ga0207668_10228115 3300025972 Bacteria 1500
160 Ga0207703_11401952 3300026035 Bacteria 672
161 Ga0207639_10166611 3300026041 Bacteria 1862
162 Ga0207678_10000897 3300026067 Bacteria 27312
163 Ga0207678_10003714 3300026067 Bacteria 13726
164 Ga0207708_10001687 3300026075 Bacteria 16343
165 Ga0207702_10604801 3300026078 Bacteria 1076
166 Ga0207648_10014220 3300026089 Bacteria 7361
167 Ga0207648_10587989 3300026089 Bacteria 1025
168 Ga0207648_10905147 3300026089 Bacteria 824
169 Ga0207674_10192866 3300026116 Bacteria 1987
170 Ga0207675_100001326 3300026118 Bacteria 24790
171 Ga0207675_100686772 3300026118 Bacteria 1032
172 Ga0207698_10076937 3300026142 Bacteria 2673
173 Ga0209813_10172092 3300027866 Bacteria 787
174 Ga0209974_10094577 3300027876 Bacteria 1039
175 Ga0265334_10287891 3300028573 Bacteria 563
176 Ga0265338_10005567 3300028800 Bacteria 16386
177 Ga0265338_10006545 3300028800 Bacteria 14804
178 Ga0265338_10417961 3300028800 Bacteria 953
179 Ga0265763_1001941 3300030763 Bacteria 1539
180 Ga0265766_1002461 3300030863 Bacteria 1026
181 Ga0265766_1013145 3300030863 Bacteria 618
182 Ga0265776_100428 3300030880 Bacteria 1480
183 Ga0265764_100965 3300030882 Bacteria 1199
184 Ga0265764_116549 3300030882 Bacteria 513
185 Ga0265769_100930 3300030888 Bacteria 1301
186 Ga0265768_100454 3300030963 Bacteria 1614
187 Ga0265774_105333 3300031011 Bacteria 562
188 Ga0265773_1006007 3300031018 Bacteria 902
189 Ga0265325_10089811 3300031241 Bacteria 1516
190 Ga0265339_10019099 3300031249 Bacteria 4027
191 Ga0265316_10161957 3300031344 Bacteria 1672
192 Ga0265316_10170174 3300031344 Bacteria 1625
193 Ga0307408_101231071 3300031548 Bacteria 699
194 Ga0310117_110776 3300031592 Bacteria 966
195 Ga0265313_10015665 3300031595 Bacteria 4401
196 Ga0310103_114835 3300031614 Bacteria 1028
197 Ga0310108_120169 3300031633 Bacteria 616
198 Ga0310101_110523 3300031690 Bacteria 1041
199 Ga0265314_10055182 3300031711 Bacteria 2745
200 Ga0265342_10691915 3300031712 Bacteria 510
201 Ga0307405_10681888 3300031731 Bacteria 849
202 Ga0307413_10156875 3300031824 Bacteria 1594
203 Ga0307413_11014723 3300031824 Bacteria 712
204 Ga0307410_10341873 3300031852 Bacteria 1193
205 Ga0307410_11704789 3300031852 Bacteria 558
206 Ga0307406_10016487 3300031901 Bacteria 4294
207 Ga0307407_10412643 3300031903 Bacteria 971
208 Ga0307407_10559291 3300031903 Bacteria 847
209 Ga0307412_10053470 3300031911 Bacteria 2677
210 Ga0307409_100000367 3300031995 Bacteria 18921
211 Ga0307416_100015640 3300032002 Bacteria 5246
212 Ga0307416_103188868 3300032002 Bacteria 549
213 Ga0307414_10427146 3300032004 Bacteria 1157
214 Ga0307415_100000032 3300032126 Bacteria 59889
215 Ga0307415_100075041 3300032126 Bacteria 2392
216 Ga0307415_100252576 3300032126 Bacteria 1434
217 Ga0316585_10079289 3300032137 Bacteria 1069
218 Ga0316593_10040205 3300032168 Bacteria 1554
219 Ga0316592_1038841 3300033524 Bacteria 1050
220 Ga0316588_1074390 3300033528 Bacteria 836
221 Ga0316587_1116597 3300033529 Bacteria 521
222 Ga0316596_1072667 3300033541 Bacteria 922
223 Ga0373934_0026501 3300035086 Bacteria 2249
224 Ga0373923_0018320 3300035111 Bacteria 2693
225 Ga0373923_0349931 3300035111 Bacteria 705
226 Ga0373936_0056154 3300035113 Bacteria 1600
227 Ga0373953_0135287 3300035117 Bacteria 1052
228 Ga0373953_0168129 3300035117 Bacteria 943
229 Ga0373954_0070794 3300035118 Bacteria 1657
230 Ga0373956_0101551 3300035119 Bacteria 1334
231 Ga0373956_0149318 3300035119 Bacteria 1099
232 Ga0373957_0180500 3300035120 Bacteria 875
233 Ga0373955_0011723 3300035172 Bacteria 4189
234 Ga0316574_0049933 3300035398 Bacteria 2602
235 Ga0373924_0069449 3300035410 Bacteria 1484
236 Ga0373924_0170941 3300035410 Bacteria 955
237 Ga0373927_0150530 3300035695 Bacteria 1524
238 Ga0373933_0009019 3300035724 Bacteria 5442
239 Ga0373933_0148932 3300035724 Bacteria 1481
240 Ga0373937_0115946 3300036401 Bacteria 2494
241 Ga0373937_0560267 3300036401 Bacteria 1085
242 Ga0265778_017597 3300036457 Bacteria 864
243 Ga0265778_049333 3300036457 Bacteria 574
244 Ga0310112_011423 3300036458 Bacteria 1270
245 Ga0316582_0404005 3300036647 Bacteria 941
246 Ga0316584_0231823 3300036712 Bacteria 1353
247 Ga0373925_0000157 3300037068 Bacteria 72993
248 Ga0395899_0025224 3300037312 Bacteria 4489
249 Ga0395899_0424666 3300037312 Bacteria 875
250 Ga0395900_0440867 3300037418 Bacteria 1260
251 Ga0395898_0282733 3300037466 Bacteria 1583
252 Ga0395898_1523031 3300037466 Bacteria 594
253 Ga0395905_0360850 3300037471 Bacteria 1346
254 Ga0395905_0477211 3300037471 Bacteria 1146
255 Ga0436364_1061164 3300037853 Bacteria 634
256 Ga0395901_0010220 3300038443 Bacteria 9506
257 Ga0395901_0072718 3300038443 Bacteria 3585
258 Ga0395901_0120893 3300038443 Bacteria 2752
259 Ga0436365_1510703 3300039437 Bacteria 746
260 Ga0439438_025187 3300041405 Bacteria 1623
261 Ga0439447_112275 3300041407 Bacteria 625
262 Ga0439461_0010968 3300041410 Bacteria 1674
263 Ga0451789_0605474 3300041443 Bacteria 921
264 Ga0451791_1932806 3300041451 Bacteria 513
265 Ga0451807_0289417 3300041486 Bacteria 551
266 Ga0451837_1764938 3300041494 Bacteria 817
267 Ga0451847_0815854 3300041503 Bacteria 1011
268 Ga0451853_2038950 3300041512 Bacteria 702
269 Ga0439431_0051371 3300041997 Bacteria 1069
270 Ga0439442_012146 3300042002 Bacteria 1759
271 Ga0439445_0103532 3300042004 Bacteria 808
272 Ga0439432_149614 3300042006 Bacteria 685
273 Ga0439446_0006528 3300042156 Bacteria 3045
274 Ga0439434_0004064 3300042435 Bacteria 4271
275 Ga0466972_0099045 3300044658 Bacteria 1380
276 Ga0466972_0109256 3300044658 Bacteria 1307
277 Ga0466972_0445785 3300044658 Bacteria 608
278 Ga0466965_0004896 3300044683 Bacteria 5980
279 Ga0466965_0025950 3300044683 Bacteria 2839
280 Ga0466965_0577410 3300044683 Bacteria 637
281 Ga0466966_0595340 3300044684 Bacteria 665
282 Ga0466961_0060843 3300044693 Bacteria 2401
283 Ga0466961_0424864 3300044693 Bacteria 805
284 Ga0466961_0446910 3300044693 Bacteria 782
285 Ga0466963_0056511 3300044694 Bacteria 2612
286 Ga0466963_0072651 3300044694 Bacteria 2318
287 Ga0466963_0074084 3300044694 Bacteria 2296
288 Ga0466963_0947163 3300044694 Bacteria 606
289 Ga0466964_0005611 3300044706 Bacteria 4663
290 Ga0466964_0157367 3300044706 Bacteria 1059
291 Ga0466964_0573833 3300044706 Bacteria 615
292 Ga0466971_0028543 3300044719 Bacteria 2496
293 Ga0466971_0153184 3300044719 Bacteria 1077
294 Ga0466971_0154169 3300044719 Bacteria 1073
295 Ga0466971_0465085 3300044719 Bacteria 621
296 Ga0466968_0023342 3300044735 Bacteria 2519
297 Ga0466970_0012339 3300044765 Bacteria 4367
298 Ga0466970_0015953 3300044765 Bacteria 3867
299 Ga0466970_0083448 3300044765 Bacteria 1729
300 Ga0466970_0191725 3300044765 Bacteria 1136
301 Ga0466970_0328645 3300044765 Bacteria 865
302 Ga0466970_0474909 3300044765 Bacteria 718
303 Ga0466970_0871145 3300044765 Bacteria 529
304 Ga0466970_0889466 3300044765 Bacteria 523
305 Ga0466957_0164507 3300044842 Bacteria 1442
306 Ga0466957_0607117 3300044842 Bacteria 766
307 Ga0466957_1358883 3300044842 Bacteria 516
308 Ga0466960_0005570 3300044901 Bacteria 4994
309 Ga0466960_0020278 3300044901 Bacteria 2942
310 Ga0466960_0088641 3300044901 Bacteria 1573
311 Ga0466960_0367969 3300044901 Bacteria 823
312 Ga0466960_0430028 3300044901 Bacteria 764
313 Ga0466959_0230548 3300045049 Bacteria 1282
314 Ga0466958_0052250 3300045836 Bacteria 2476
315 Ga0466958_0149174 3300045836 Bacteria 1475
316 Ga0466958_0688262 3300045836 Bacteria 666
317 Ga0466967_0047816 3300045976 Bacteria 3731
318 Ga0466967_0081787 3300045976 Bacteria 2918
319 Ga0466967_0153929 3300045976 Bacteria 2152
320 Ga0466967_0280597 3300045976 Bacteria 1598
321 Ga0466967_0996205 3300045976 Bacteria 834
322 Ga0466967_1180455 3300045976 Bacteria 763
323 Ga0495592_0231636 3300046454 Bacteria 1229
324 Ga0495651_0028321 3300046462 Bacteria 4366
325 Ga0495651_0068479 3300046462 Bacteria 2705
326 Ga0495653_0041539 3300046463 Bacteria 3589
327 Ga0495653_0090702 3300046463 Bacteria 2235
328 Ga0495662_0125483 3300046476 Bacteria 1261
329 Ga0495664_0073765 3300046477 Bacteria 2040
330 Ga0495618_0070142 3300046514 Bacteria 2228
331 Ga0495628_0094744 3300046516 Bacteria 2307
332 Ga0495640_0098586 3300046533 Bacteria 1920
333 Ga0495586_0077349 3300046535 Bacteria 1824
334 Ga0495586_0130717 3300046535 Bacteria 1406
335 Ga0495587_0002850 3300046536 Bacteria 11583
336 Ga0495587_0049966 3300046536 Bacteria 2474
337 Ga0495645_0059145 3300046543 Bacteria 2779
338 Ga0495645_0134377 3300046543 Bacteria 1731
339 Ga0495667_0064123 3300046559 Bacteria 2403
340 Ga0495668_0002288 3300046616 Bacteria 16104
341 Ga0495635_0017170 3300046663 Bacteria 5054
342 Ga0495599_0035720 3300046678 Bacteria 3120
343 Ga0495599_0120304 3300046678 Bacteria 1632
344 Ga0495623_0036778 3300046679 Bacteria 3136
345 Ga0495646_0015252 3300046680 Bacteria 4879
346 Ga0495646_0109113 3300046680 Bacteria 1577
347 Ga0495613_0684417 3300046689 Bacteria 676
348 Ga0495600_0686886 3300046809 Bacteria 616
349 Ga0495604_0037228 3300047317 Bacteria 3832
350 Ga0495604_0118256 3300047317 Bacteria 1921
351 Ga0495674_0134929 3300047319 Bacteria 2077
352 Ga0495680_0036485 3300047322 Bacteria 3945
353 Ga0495680_0122502 3300047322 Bacteria 1918
354 Ga0495675_0239524 3300047444 Bacteria 1092
355 Ga0495684_0026178 3300047471 Bacteria 4481
356 Ga0495684_0064884 3300047471 Bacteria 2775
357 Ga0495593_0094480 3300047673 Bacteria 1538
358 Ga0495593_0401662 3300047673 Bacteria 685
359 Ga0495602_0042042 3300048088 Bacteria 4167
360 Ga0495602_0123242 3300048088 Bacteria 2081
361 Ga0496100_0255161 3300048903 Bacteria 1298
362 Ga0496100_0559254 3300048903 Bacteria 885
363 Ga0496101_0089944 3300048904 Bacteria 2282
364 Ga0496102_0023288 3300048905 Bacteria 5498
365 Ga0496103_0030118 3300048906 Bacteria 3301
366 Ga0496104_0005838 3300048907 Bacteria 10783
367 Ga0496105_0003593 3300048908 Bacteria 11513
368 Ga0496106_0534186 3300048909 Bacteria 941
369 Ga0496107_0023573 3300048910 Bacteria 4351
370 Ga0496108_0239871 3300048911 Bacteria 1577
371 Ga0496108_1472803 3300048911 Bacteria 567
372 Ga0496109_0019013 3300048912 Bacteria 6051
373 Ga0496109_0145107 3300048912 Bacteria 2220
374 Ga0496109_0184007 3300048912 Bacteria 1963
375 Ga0496109_0351979 3300048912 Bacteria 1391
376 Ga0496110_0122830 3300048913 Bacteria 2341
377 Ga0496110_1293126 3300048913 Bacteria 638
378 Ga0496111_0078856 3300048914 Bacteria 2402
379 Ga0496113_0274321 3300048916 Bacteria 1348
380 Ga0496114_0072030 3300048917 Bacteria 2905
381 Ga0496115_0001458 3300048918 Bacteria 16992
382 Ga0496119_0377000 3300048922 Bacteria 681
383 Ga0496125_0045276 3300048928 Bacteria 3706
384 Ga0501311_022955 3300049527 Bacteria 860
385 Ga0501317_040731 3300049533 Bacteria 708
386 Ga0501317_084095 3300049533 Bacteria 554
387 Ga0501320_070981 3300049536 Bacteria 504
388 Ga0501321_044431 3300049537 Bacteria 634
389 Ga0501031_0041571 3300049568 Bacteria 3001
390 Ga0501031_0882957 3300049568 Bacteria 572
391 Ga0501032_0308237 3300049569 Bacteria 1023
392 Ga0501034_0573723 3300049571 Bacteria 1036
393 Ga0501036_0403721 3300049572 Bacteria 1140
394 Ga0501036_1737633 3300049572 Bacteria 502
395 Ga0501037_0039040 3300049573 Bacteria 3496
396 Ga0501037_0183709 3300049573 Bacteria 1483
397 Ga0501037_0902465 3300049573 Bacteria 579
398 Ga0501038_0006895 3300049574 Bacteria 10495
399 Ga0501038_0853822 3300049574 Bacteria 674
400 Ga0501039_0172567 3300049575 Bacteria 1700
401 Ga0501039_0852684 3300049575 Bacteria 710
402 Ga0501040_0230767 3300049576 Bacteria 1318
403 Ga0501040_0949365 3300049576 Bacteria 623
404 Ga0501041_0152598 3300049577 Bacteria 1443
405 Ga0501041_0642322 3300049577 Bacteria 678
406 Ga0501042_0122510 3300049578 Bacteria 1872
407 Ga0501042_0521759 3300049578 Bacteria 863
408 Ga0501042_1144552 3300049578 Bacteria 567
409 Ga0501043_0026014 3300049579 Bacteria 4591
410 Ga0501046_0440449 3300049580 Bacteria 938
411 Ga0501046_0733891 3300049580 Bacteria 694
412 Ga0501047_0000189 3300049581 Bacteria 74827
413 Ga0501047_0183807 3300049581 Bacteria 1956
414 Ga0501048_0174341 3300049582 Bacteria 1524
415 Ga0501048_0186591 3300049582 Bacteria 1470
416 Ga0501048_0610588 3300049582 Bacteria 783
417 Ga0501048_1393973 3300049582 Bacteria 504
418 Ga0501067_0144957 3300049583 Bacteria 1323
419 Ga0501069_0082329 3300049585 Bacteria 1814
420 Ga0501069_0531926 3300049585 Bacteria 702
421 Ga0501070_0004209 3300049586 Bacteria 12372
422 Ga0501073_0060941 3300049589 Bacteria 2633
423 Ga0501074_0004634 3300049590 Bacteria 9846
424 Ga0501074_0175660 3300049590 Bacteria 1528
425 Ga0501075_0695212 3300049591 Bacteria 775
426 Ga0501075_0964034 3300049591 Bacteria 648
427 Ga0501076_0830927 3300049592 Bacteria 762
428 Ga0501079_0000560 3300049741 Bacteria 24402
429 Ga0501079_1477465 3300049741 Bacteria 535
430 Ga0501080_0001095 3300049742 Bacteria 22325
431 Ga0501080_1065361 3300049742 Bacteria 699
432 Ga0501081_0239496 3300049743 Bacteria 1323
433 Ga0501081_0649140 3300049743 Bacteria 791
434 Ga0501035_1200700 3300049822 Bacteria 588
435 Ga0501044_0193717 3300049823 Bacteria 1994
436 Ga0501045_0167247 3300049824 Bacteria 1638
437 Ga0501045_0620666 3300049824 Bacteria 800
438 nmdc:mga00v17_32253_c1 3300050491 Bacteria 3095
439 nmdc:mga00v17_45217_c1 3300050491 Bacteria 2659
440 nmdc:mga00v17_554636_c1 3300050491 Bacteria 743
441 nmdc:mga0yw44_10082_c1 3300050492 Bacteria 4810
442 nmdc:mga0yw44_1051209_c1 3300050492 Bacteria 551
443 nmdc:mga0yw44_118354_c1 3300050492 Bacteria 1704
444 nmdc:mga0yw44_193994_c1 3300050492 Bacteria 1340
445 nmdc:mga0yw44_206750_c1 3300050492 Bacteria 1298
446 nmdc:mga0yw44_31193_c1 3300050492 Bacteria 3097
447 nmdc:mga0yw44_713522_c1 3300050492 Bacteria 681
448 nmdc:mga0yw44_749709_c1 3300050492 Bacteria 663
449 nmdc:mga06z11_417267_c1 3300050494 Bacteria 809
450 nmdc:mga07m45_121747_c1 3300050496 Bacteria 1507
451 Ga0495601_0061839 3300053077 Bacteria 2377
452 Ga0495612_0030698 3300053078 Bacteria 2165
453 Ga0495595_0060279 3300053084 Bacteria 1776
454 Ga0495595_0072241 3300053084 Bacteria 1632
455 Ga0495619_0735242 3300053085 Bacteria 670
456 Ga0500560_161886 3300053107 Bacteria 739
457 Ga0500603_097216 3300053150 Bacteria 871
458 Ga0501084_0243388 3300054114 Bacteria 1518
459 Ga0501084_0631954 3300054114 Bacteria 904
460 Ga0587070_223044 3300059491 Bacteria 512
461 Ga0587086_046967 3300059507 Bacteria 685
462 Ga0587115_101412 3300059626 Bacteria 534
463 Ga0587128_090411 3300059630 Bacteria 627
464 Ga0587069_112658 3300059642 Bacteria 568
465 Ga0587111_0088460 3300060346 Bacteria 752
466 Ga0587111_0178585 3300060346 Bacteria 589
467 Ga0501082_0562375 3300060353 Bacteria 998
468 Ga0466962_0027632 3300061719 Bacteria 2722
469 Ga0530510_0087568 3300061734 Bacteria 2269
470 Ga0530510_1081173 3300061734 Bacteria 614
471 Ga0530510_1208812 3300061734 Bacteria 579
472 2566993527 2565956761 Bacteria 6601618
473 2643825477 2643221561 Bacteria 4984412
474 2643889078 2643221576 Bacteria 5214352
475 2643958133 2643221590 Bacteria 5214697
476 2644034613 2643221604 Bacteria 5014917
477 2644098984 2643221617 Bacteria 5139111
478 2644114865 2643221620 Bacteria 5134593
479 2644531473 2643221696 Bacteria 5431823
480 2738867976 2738541305 Bacteria 4910150
481 2738887019 2738541308 Bacteria 7020677
482 2799184138 2799112218 Bacteria 4315149
483 2812332291 2811994874 Bacteria 5367947
484 2856743595 2856741275 Bacteria 8096094
485 2866615716 2866612099 Bacteria 7543886
486 2891397795 2891395885 Bacteria 9251614
487 2891554464 2891554331 Bacteria 8812224
488 2891564897 2891562705 Bacteria 8039471
489 2904540062 2904535858 Bacteria 6308016
490 2917741103 2917736166 Bacteria 9690793
491 2922560566 2922554459 Bacteria 6683962
492 2935395962 2935390628 Bacteria 7043367
493 2956942532 2956939328 Bacteria 3474458
494 3001119566 3001119090 Bacteria 3449530
495 3006427686 3006425503 Bacteria 6491253
496 Ga0395899_0196920
497 JGI24744J21845_10009530
498 Ga0058862_12737353
499 Ga0058862_12869315
500 Ga0070658_10000108
501 Ga0070658_10655617
502 Ga0070683_100381343
503 Ga0070683_102246263
504 Ga0070690_100524030
505 Ga0070670_100737972
506 Ga0070680_100315053
507 Ga0070680_100413324
508 Ga0070682_100035749
509 Ga0070682_100158008
510 Ga0070682_101999688
511 Ga0068868_100100797
512 Ga0070660_100645101
513 Ga0070692_10046789
514 Ga0070668_100403292
515 Ga0070669_100248454
516 Ga0070675_100087605
517 Ga0070674_100012101
518 Ga0070673_100042370
519 Ga0070659_100295860
520 Ga0070667_100748923
521 Ga0070714_100217833
522 Ga0070714_100576929
523 Ga0070710_10410587
524 Ga0070701_10005213
525 Ga0070700_100006435
526 Ga0070700_100086553
527 Ga0070700_101005144
528 Ga0070708_101022165
529 Ga0070663_100012134
530 Ga0070678_100395912
531 Ga0070678_101423109
532 Ga0070681_10250769
533 Ga0068867_100030779
534 Ga0070685_10011861
535 Ga0070707_100209324
536 Ga0070698_100010105
537 Ga0070679_100115562
538 Ga0070679_100213646
539 Ga0070684_100142372
540 Ga0070684_101391699
541 Ga0068853_100711115
542 Ga0070672_100007050
543 Ga0070672_100190848
544 Ga0070686_100771645
545 Ga0070693_100871831
546 Ga0068857_100382946
547 Ga0068854_100115990
548 Ga0068852_100120415
549 Ga0068864_100037762
550 Ga0068861_100003359
551 Ga0068851_10027499
552 Ga0068870_10014561
553 Ga0068870_10194647
554 Ga0068863_100692270
555 Ga0075365_10010977
556 Ga0075365_10014742
557 Ga0075365_10049966
558 Ga0075365_10236008
559 Ga0075365_10623557
560 Ga0075365_10686157
561 Ga0075365_10730116
562 Ga0075368_10384068
563 Ga0075363_100388722
564 Ga0075364_10093461
565 Ga0075364_10152521
566 Ga0075364_11079502
567 Ga0075367_10787202
568 Ga0075370_10046479
569 Ga0075370_10819968
570 Ga0068871_101385686
571 Ga0068865_100018163
572 Ga0099794_10286206
573 Ga0105245_10101968
574 Ga0105245_10801544
575 Ga0114129_11668402
576 Ga0105243_10038026
577 Ga0105248_10886890
578 Ga0105248_12392955
579 Ga0105239_10151037
580 Ga0105239_12241190
581 Ga0105246_10251179
582 Ga0157317_1021752
583 Ga0154014_141112
584 Ga0157373_10447428
585 Ga0157369_10016567
586 Ga0157369_10824476
587 Ga0157369_11216324
588 Ga0157372_10065485
589 Ga0157372_10079897
590 Ga0157372_10722806
591 Ga0157380_10008910
592 Ga0157380_12346722
593 Ga0182008_10027037
594 Ga0182008_10384119
595 Ga0163161_10150622
596 Ga0184596_101227
597 Ga0197907_10146759
598 Ga0197907_10322276
599 Ga0197907_11237439
600 Ga0206349_1619355
601 Ga0206349_1817926
602 Ga0206349_1962344
603 Ga0206355_1154318
604 Ga0206355_1712316
605 Ga0206351_10341761
606 Ga0206352_10231795
607 Ga0206352_10578904
608 Ga0206352_10970858
609 Ga0206354_10142487
610 Ga0206353_11664223
611 Ga0154015_1350112
612 Ga0154015_1598831
613 Ga0213875_10474808
614 Ga0213875_10648598
615 Ga0224712_10048069
616 Ga0224712_10122458
617 Ga0224712_10222992
618 Ga0207682_10479408
619 Ga0207692_10003208
620 Ga0207692_10461132
621 Ga0207647_10199558
622 Ga0207699_10042779
623 Ga0207643_10016651
624 Ga0207705_10000394
625 Ga0207707_10285653
626 Ga0207707_10358641
627 Ga0207695_11237800
628 Ga0207693_10487732
629 Ga0207663_10227172
630 Ga0207660_10011743
631 Ga0207660_10148702
632 Ga0207662_10051965
633 Ga0207657_10427929
634 Ga0207657_10562199
635 Ga0207652_10188091
636 Ga0207652_11219653
637 Ga0207646_10284885
638 Ga0207681_10221868
639 Ga0207687_10223585
640 Ga0207700_10033181
641 Ga0207664_10071408
642 Ga0207664_11596395
643 Ga0207690_10219512
644 Ga0207690_11452646
645 Ga0207709_10079021
646 Ga0207669_11058817
647 Ga0207665_10080913
648 Ga0207691_10009955
649 Ga0207691_10202026
650 Ga0207661_10355552
651 Ga0207661_10931155
652 Ga0207667_11638687
653 Ga0207712_10318795
654 Ga0207668_10228115
655 Ga0207703_11401952
656 Ga0207639_10166611
657 Ga0207678_10000897
658 Ga0207678_10003714
659 Ga0207708_10001687
660 Ga0207702_10604801
661 Ga0207648_10014220
662 Ga0207648_10587989
663 Ga0207648_10905147
664 Ga0207674_10192866
665 Ga0207675_100001326
666 Ga0207675_100686772
667 Ga0207698_10076937
668 Ga0209813_10172092
669 Ga0209974_10094577
670 Ga0265334_10287891
671 Ga0265338_10005567
672 Ga0265338_10006545
673 Ga0265338_10417961
674 Ga0265763_1001941
675 Ga0265766_1002461
676 Ga0265766_1013145
677 Ga0265776_100428
678 Ga0265764_100965
679 Ga0265764_116549
680 Ga0265769_100930
681 Ga0265768_100454
682 Ga0265774_105333
683 Ga0265773_1006007
684 Ga0265325_10089811
685 Ga0265339_10019099
686 Ga0265316_10161957
687 Ga0265316_10170174
688 Ga0307408_101231071
689 Ga0310117_110776
690 Ga0265313_10015665
691 Ga0310103_114835
692 Ga0310108_120169
693 Ga0310101_110523
694 Ga0265314_10055182
695 Ga0265342_10691915
696 Ga0307405_10681888
697 Ga0307413_10156875
698 Ga0307413_11014723
699 Ga0307410_10341873
700 Ga0307410_11704789
701 Ga0307406_10016487
702 Ga0307407_10412643
703 Ga0307407_10559291
704 Ga0307412_10053470
705 Ga0307409_100000367
706 Ga0307416_100015640
707 Ga0307416_103188868
708 Ga0307414_10427146
709 Ga0307415_100000032
710 Ga0307415_100075041
711 Ga0307415_100252576
712 Ga0316585_10079289
713 Ga0316593_10040205
714 Ga0316592_1038841
715 Ga0316588_1074390
716 Ga0316587_1116597
717 Ga0316596_1072667
718 Ga0373934_0026501
719 Ga0373923_0018320
720 Ga0373923_0349931
721 Ga0373936_0056154
722 Ga0373953_0135287
723 Ga0373953_0168129
724 Ga0373954_0070794
725 Ga0373956_0101551
726 Ga0373956_0149318
727 Ga0373957_0180500
728 Ga0373955_0011723
729 Ga0316574_0049933
730 Ga0373924_0069449
731 Ga0373924_0170941
732 Ga0373927_0150530
733 Ga0373933_0009019
734 Ga0373933_0148932
735 Ga0373937_0115946
736 Ga0373937_0560267
737 Ga0265778_017597
738 Ga0265778_049333
739 Ga0310112_011423
740 Ga0316582_0404005
741 Ga0316584_0231823
742 Ga0373925_0000157
743 Ga0395899_0025224
744 Ga0395899_0424666
745 Ga0395900_0440867
746 Ga0395898_0282733
747 Ga0395898_1523031
748 Ga0395905_0360850
749 Ga0395905_0477211
750 Ga0436364_1061164
751 Ga0395901_0010220
752 Ga0395901_0072718
753 Ga0395901_0120893
754 Ga0436365_1510703
755 Ga0439438_025187
756 Ga0439447_112275
757 Ga0439461_0010968
758 Ga0451789_0605474
759 Ga0451791_1932806
760 Ga0451807_0289417
761 Ga0451837_1764938
762 Ga0451847_0815854
763 Ga0451853_2038950
764 Ga0439431_0051371
765 Ga0439442_012146
766 Ga0439445_0103532
767 Ga0439432_149614
768 Ga0439446_0006528
769 Ga0439434_0004064
770 Ga0466972_0099045
771 Ga0466972_0109256
772 Ga0466972_0445785
773 Ga0466965_0004896
774 Ga0466965_0025950
775 Ga0466965_0577410
776 Ga0466966_0595340
777 Ga0466961_0060843
778 Ga0466961_0424864
779 Ga0466961_0446910
780 Ga0466963_0056511
781 Ga0466963_0072651
782 Ga0466963_0074084
783 Ga0466963_0947163
784 Ga0466964_0005611
785 Ga0466964_0157367
786 Ga0466964_0573833
787 Ga0466971_0028543
788 Ga0466971_0153184
789 Ga0466971_0154169
790 Ga0466971_0465085
791 Ga0466968_0023342
792 Ga0466970_0012339
793 Ga0466970_0015953
794 Ga0466970_0083448
795 Ga0466970_0191725
796 Ga0466970_0328645
797 Ga0466970_0474909
798 Ga0466970_0871145
799 Ga0466970_0889466
800 Ga0466957_0164507
801 Ga0466957_0607117
802 Ga0466957_1358883
803 Ga0466960_0005570
804 Ga0466960_0020278
805 Ga0466960_0088641
806 Ga0466960_0367969
807 Ga0466960_0430028
808 Ga0466959_0230548
809 Ga0466958_0052250
810 Ga0466958_0149174
811 Ga0466958_0688262
812 Ga0466967_0047816
813 Ga0466967_0081787
814 Ga0466967_0153929
815 Ga0466967_0280597
816 Ga0466967_0996205
817 Ga0466967_1180455
818 Ga0495592_0231636
819 Ga0495651_0028321
820 Ga0495651_0068479
821 Ga0495653_0041539
822 Ga0495653_0090702
823 Ga0495662_0125483
824 Ga0495664_0073765
825 Ga0495618_0070142
826 Ga0495628_0094744
827 Ga0495640_0098586
828 Ga0495586_0077349
829 Ga0495586_0130717
830 Ga0495587_0002850
831 Ga0495587_0049966
832 Ga0495645_0059145
833 Ga0495645_0134377
834 Ga0495667_0064123
835 Ga0495668_0002288
836 Ga0495635_0017170
837 Ga0495599_0035720
838 Ga0495599_0120304
839 Ga0495623_0036778
840 Ga0495646_0015252
841 Ga0495646_0109113
842 Ga0495613_0684417
843 Ga0495600_0686886
844 Ga0495604_0037228
845 Ga0495604_0118256
846 Ga0495674_0134929
847 Ga0495680_0036485
848 Ga0495680_0122502
849 Ga0495675_0239524
850 Ga0495684_0026178
851 Ga0495684_0064884
852 Ga0495593_0094480
853 Ga0495593_0401662
854 Ga0495602_0042042
855 Ga0495602_0123242
856 Ga0496100_0255161
857 Ga0496100_0559254
858 Ga0496101_0089944
859 Ga0496102_0023288
860 Ga0496103_0030118
861 Ga0496104_0005838
862 Ga0496105_0003593
863 Ga0496106_0534186
864 Ga0496107_0023573
865 Ga0496108_0239871
866 Ga0496108_1472803
867 Ga0496109_0019013
868 Ga0496109_0145107
869 Ga0496109_0184007
870 Ga0496109_0351979
871 Ga0496110_0122830
872 Ga0496110_1293126
873 Ga0496111_0078856
874 Ga0496113_0274321
875 Ga0496114_0072030
876 Ga0496115_0001458
877 Ga0496119_0377000
878 Ga0496125_0045276
879 Ga0501311_022955
880 Ga0501317_040731
881 Ga0501317_084095
882 Ga0501320_070981
883 Ga0501321_044431
884 Ga0501031_0041571
885 Ga0501031_0882957
886 Ga0501032_0308237
887 Ga0501034_0573723
888 Ga0501036_0403721
889 Ga0501036_1737633
890 Ga0501037_0039040
891 Ga0501037_0183709
892 Ga0501037_0902465
893 Ga0501038_0006895
894 Ga0501038_0853822
895 Ga0501039_0172567
896 Ga0501039_0852684
897 Ga0501040_0230767
898 Ga0501040_0949365
899 Ga0501041_0152598
900 Ga0501041_0642322
901 Ga0501042_0122510
902 Ga0501042_0521759
903 Ga0501042_1144552
904 Ga0501043_0026014
905 Ga0501046_0440449
906 Ga0501046_0733891
907 Ga0501047_0000189
908 Ga0501047_0183807
909 Ga0501048_0174341
910 Ga0501048_0186591
911 Ga0501048_0610588
912 Ga0501048_1393973
913 Ga0501067_0144957
914 Ga0501069_0082329
915 Ga0501069_0531926
916 Ga0501070_0004209
917 Ga0501073_0060941
918 Ga0501074_0004634
919 Ga0501074_0175660
920 Ga0501075_0695212
921 Ga0501075_0964034
922 Ga0501076_0830927
923 Ga0501079_0000560
924 Ga0501079_1477465
925 Ga0501080_0001095
926 Ga0501080_1065361
927 Ga0501081_0239496
928 Ga0501081_0649140
929 Ga0501035_1200700
930 Ga0501044_0193717
931 Ga0501045_0167247
932 Ga0501045_0620666
933 nmdc:mga00v17_32253_c1
934 nmdc:mga00v17_45217_c1
935 nmdc:mga00v17_554636_c1
936 nmdc:mga0yw44_10082_c1
937 nmdc:mga0yw44_1051209_c1
938 nmdc:mga0yw44_118354_c1
939 nmdc:mga0yw44_193994_c1
940 nmdc:mga0yw44_206750_c1
941 nmdc:mga0yw44_31193_c1
942 nmdc:mga0yw44_713522_c1
943 nmdc:mga0yw44_749709_c1
944 nmdc:mga06z11_417267_c1
945 nmdc:mga07m45_121747_c1
946 Ga0495601_0061839
947 Ga0495612_0030698
948 Ga0495595_0060279
949 Ga0495595_0072241
950 Ga0495619_0735242
951 Ga0500560_161886
952 Ga0500603_097216
953 Ga0501084_0243388
954 Ga0501084_0631954
955 Ga0587070_223044
956 Ga0587086_046967
957 Ga0587115_101412
958 Ga0587128_090411
959 Ga0587069_112658
960 Ga0587111_0088460
961 Ga0587111_0178585
962 Ga0501082_0562375
963 Ga0466962_0027632
964 Ga0530510_0087568
965 Ga0530510_1081173
966 Ga0530510_1208812
967 2566993527
968 2643825477
969 2643889078
970 2643958133
971 2644034613
972 2644098984
973 2644114865
974 2644531473
975 2738867976
976 2738887019
977 2799184138
978 2812332291
979 2856743595
980 2866615716
981 2891397795
982 2891554464
983 2891564897
984 2904540062
985 2917741103
986 2922560566
987 2935395962
988 2956942532
989 3001119566
990 3006427686

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

33

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8799 15 109
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.855 16 108
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.844 15 110
2k4z-assembly1.cif.gz_A solution nmr structure of allochromatium vinosum dsrr: northeast structural genomics consortium target op5 0.8385 15 110
2d2a-assembly2.cif.gz_A crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8374 15 120
ID Description Score Start End Superfamily
af_O43045_97_205_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8963 16 117 2.60.300.12
af_Q54P40_100_209_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8923 16 118 2.60.300.12
af_D4A4L5_49_154_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8873 16 119 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8799 15 109 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8711 15 109 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A1X0R4M4-F1-model_v4 ADP/ATP translocase (ADP,ATP carrier protein) 0.9384 14 97 GO:0005471
GO:0005743
GO:0016226
GO:0051536
GO:0140021
GO:1990544
AF-A0A6N8UQF9-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.931 17 110 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A4Q3NPK0-F1-model_v4 deleted 0.926 15 107
AF-A0A259FTK2-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9201 15 102 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A0R2Q3V8-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9166 10 111 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Map