F454512

General Info

Members Datasets Scaffolds Average Seq Length
494 294 990 402

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10206705|rootL2_102067051
Length 428
Sequence MPILWSSIAIDHGAVLSPGILSLASRKKKRVQYDVIIVGGGAVGLATALQLKSSSPHLKVVVIEKETSVACHQTGNNSNVIHSGIYYKPGSLKATNCIRGYHLLIDFCRQHEIPFELCGKIIVATSETELPYLKNIFERGQQNGLTNLKMLKGEELKLYEPHVAGIAGIHVPQTGIVDYRVVAEKYAGVFQQRGGELRLGEKVIDAQLGSDKVVVVTQKASYTGKLMVNCAGLYSDKIAKLTSPKVDVRIIPFRGEYYKLKKEKEYLVKTLIYPVPDPNFPFLGVHFTTMPGGGVECGPNAVLAFAREGYTKSKVNFSELAETLAWPGFRKIVSKYWRTGLGEMQRSYSKAAFTKALQKLMPDIREEDLTEGGAGVRAQACDRTGGLLDDFLILEDRQVINVCNAPSPAATSSLAIGETVAQWAQRRF

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
247 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
275 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
276 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
277 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
278 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
279 2738541358 Bacillus sp. OV752 Isolate Unclassified
280 2738543006 Bacillus sp. OK077 Isolate Unclassified
281 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
282 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
283 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
284 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
285 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
286 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
287 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
288 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
289 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
290 2965761152 Bacillus sp. COPE52 Isolate Unclassified
291 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
292 8004592986 Serratia sp. S119 Isolate Unclassified
293 8022792930 Bacillus sp. Xin Isolate Rhizosphere
294 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.75
Metatranscriptomes 0
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0.4
Rhizoplane 3.24
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10206705 3300003322 Unclassified 2456
2 JGI24034J26672_10007973 3300002239 Bacteria 1543
3 JGI24751J29686_10002332 3300002459 Bacteria 3834
4 JGI25159J45721_1004222 3300002987 Bacteria 4838
5 JGI25151J46595_10003016 3300003187 Bacteria 9568
6 JGI25151J46595_10004318 3300003187 Bacteria 7551
7 JGI25151J46595_10011248 3300003187 Bacteria 4121
8 JGI25151J46595_10014437 3300003187 Bacteria 3518
9 rootH1_10007115 3300003316 Bacteria 3267
10 rootH1_10094622 3300003316 Bacteria 4361
11 rootH1_10132167 3300003316 Bacteria 5860
12 rootH1_10132167 3300003323 Bacteria 2972
13 rootH2_10008034 3300003320 Bacteria 73088
14 rootH2_10150236 3300003320 Unclassified 2393
15 rootH2_10246330 3300003320 Bacteria 3142
16 rootL2_10051710 3300003322 Bacteria 9069
17 rootL2_10078336 3300003322 Bacteria 3157
18 rootL2_10201280 3300003322 Bacteria 1985
19 rootH1_10006386 3300003316 Bacteria 2019
20 rootH1_10006386 3300003323 Bacteria 30831
21 rootH1_10018051 3300003323 Bacteria 8284
22 rootH1_10146650 3300003323 Unclassified 4955
23 rootH1_10162782 3300003323 Bacteria 2319
24 rootH1_10276915 3300003323 Bacteria 2173
25 Ga0065165_1000097 3300005262 Bacteria 144227
26 Ga0065165_1001998 3300005262 Bacteria 19106
27 Ga0065707_10133364 3300005295 Bacteria 1883
28 Ga0070658_10030087 3300005327 Bacteria 4364
29 Ga0070658_10107752 3300005327 Bacteria 2306
30 Ga0070676_10027475 3300005328 Bacteria 3228
31 Ga0070683_100001837 3300005329 Bacteria 16560
32 Ga0070683_100088123 3300005329 Unclassified 2912
33 Ga0070690_100076594 3300005330 Bacteria 2182
34 Ga0070670_100072592 3300005331 Bacteria 2955
35 Ga0070677_10021775 3300005333 Bacteria 2355
36 Ga0068869_100016354 3300005334 Bacteria 4998
37 Ga0070680_100035203 3300005336 Bacteria 4041
38 Ga0070682_100000015 3300005337 Bacteria 249390
39 Ga0070682_100022008 3300005337 Bacteria 3770
40 Ga0070682_100176855 3300005337 Unclassified 1487
41 Ga0068868_100000330 3300005338 Bacteria 31896
42 Ga0068868_100007006 3300005338 Bacteria 8013
43 Ga0070689_100005453 3300005340 Bacteria 8688
44 Ga0070689_100016849 3300005340 Bacteria 5356
45 Ga0070689_100032599 3300005340 Bacteria 3964
46 Ga0070691_10024827 3300005341 Unclassified 2788
47 Ga0070687_100039935 3300005343 Bacteria 2361
48 Ga0070661_100036447 3300005344 Unclassified 3575
49 Ga0070661_100067746 3300005344 Bacteria 2623
50 Ga0070668_100025628 3300005347 Bacteria 4472
51 Ga0070668_100157127 3300005347 Unclassified 1843
52 Ga0070669_100014736 3300005353 Bacteria 5566
53 Ga0070674_100004190 3300005356 Bacteria 8191
54 Ga0070673_100014062 3300005364 Bacteria 5559
55 Ga0070688_100010846 3300005365 Bacteria 5041
56 Ga0070688_100130577 3300005365 Unclassified 1694
57 Ga0070659_100023009 3300005366 Bacteria 4764
58 Ga0070709_10224479 3300005434 Unclassified 1341
59 Ga0070713_100063508 3300005436 Unclassified 3096
60 Ga0070713_100063863 3300005436 Bacteria 3089
61 Ga0070710_10045188 3300005437 Bacteria 2447
62 Ga0070708_100005060 3300005445 Bacteria 10434
63 Ga0070663_100029978 3300005455 Bacteria 3723
64 Ga0070662_100009974 3300005457 Bacteria 6220
65 Ga0070662_100040758 3300005457 Unclassified 3308
66 Ga0070681_10058585 3300005458 Bacteria 3831
67 Ga0070681_10104198 3300005458 Bacteria 2779
68 Ga0068867_100001402 3300005459 Bacteria 16643
69 Ga0068867_100082423 3300005459 Bacteria 2426
70 Ga0070685_10025170 3300005466 Bacteria 3276
71 Ga0070706_100008950 3300005467 Bacteria 9321
72 Ga0070699_100131604 3300005518 Bacteria 2205
73 Ga0070679_100000065 3300005530 Bacteria 78829
74 Ga0070684_100045893 3300005535 Bacteria 3785
75 Ga0070684_100089897 3300005535 Unclassified 2729
76 Ga0070697_100000113 3300005536 Bacteria 63284
77 Ga0070697_100004177 3300005536 Bacteria 11068
78 Ga0068853_100057829 3300005539 Bacteria 3347
79 Ga0070672_100000054 3300005543 Bacteria 50993
80 Ga0070686_100005248 3300005544 Bacteria 7156
81 Ga0070686_100028875 3300005544 Bacteria 3367
82 Ga0070665_100021889 3300005548 Bacteria 6429
83 Ga0068855_100005888 3300005563 Bacteria 14948
84 Ga0068855_100059915 3300005563 Unclassified 4453
85 Ga0068855_100172156 3300005563 Bacteria 2451
86 Ga0070664_100267448 3300005564 Unclassified 1539
87 Ga0068857_100036995 3300005577 Bacteria 4323
88 Ga0068854_100003678 3300005578 Bacteria 9595
89 Ga0068856_100006747 3300005614 Bacteria 11242
90 Ga0068856_100016946 3300005614 Bacteria 7061
91 Ga0068856_100100222 3300005614 Unclassified 2888
92 Ga0070702_100001719 3300005615 Bacteria 9090
93 Ga0068852_100021068 3300005616 Bacteria 5195
94 Ga0068852_100182898 3300005616 Bacteria 1972
95 Ga0068859_100008352 3300005617 Bacteria 10492
96 Ga0068859_100052581 3300005617 Unclassified 4095
97 Ga0068859_100062855 3300005617 Bacteria 3743
98 Ga0068864_100000009 3300005618 Bacteria 373756
99 Ga0068864_100232675 3300005618 Unclassified 1705
100 Ga0068866_10010337 3300005718 Bacteria 3998
101 Ga0068861_100043394 3300005719 Unclassified 3376
102 Ga0068861_100071565 3300005719 Bacteria 2688
103 Ga0068851_10007616 3300005834 Bacteria 4979
104 Ga0068851_10008543 3300005834 Bacteria 4738
105 Ga0068870_10011889 3300005840 Bacteria 4051
106 Ga0068863_100014986 3300005841 Bacteria 7446
107 Ga0068863_100080718 3300005841 Bacteria 3081
108 Ga0068858_100001232 3300005842 Bacteria 26450
109 Ga0068858_100002477 3300005842 Bacteria 18629
110 Ga0068858_100025917 3300005842 Bacteria 5453
111 Ga0068858_100213021 3300005842 Bacteria 1828
112 Ga0068860_100000848 3300005843 Bacteria 34178
113 Ga0068862_100000148 3300005844 Bacteria 79789
114 Ga0068862_100093814 3300005844 Bacteria 2617
115 Ga0070716_100000912 3300006173 Bacteria 12764
116 Ga0070712_100005292 3300006175 Bacteria 7988
117 Ga0070712_100034250 3300006175 Bacteria 3441
118 Ga0097621_100034508 3300006237 Unclassified 4036
119 Ga0097621_100084214 3300006237 Bacteria 2650
120 Ga0068871_100099674 3300006358 Unclassified 2432
121 Ga0075428_100037840 3300006844 Bacteria 5309
122 Ga0075430_100053846 3300006846 Bacteria 3387
123 Ga0075430_100095755 3300006846 Bacteria 2481
124 Ga0075430_100097026 3300006846 Bacteria 2463
125 Ga0075430_100166941 3300006846 Bacteria 1831
126 Ga0075434_100204628 3300006871 Bacteria 1994
127 Ga0068865_100006725 3300006881 Bacteria 7034
128 Ga0097620_100008352 3300006931 Bacteria 10492
129 Ga0097620_100052584 3300006931 Unclassified 4095
130 Ga0097620_100062848 3300006931 Bacteria 3743
131 Ga0079104_1003094 3300006946 Bacteria 8107
132 Ga0105251_10000369 3300009011 Bacteria 44159
133 Ga0105244_10017653 3300009036 Bacteria 4027
134 Ga0105250_10003339 3300009092 Bacteria 7627
135 Ga0105250_10006138 3300009092 Bacteria 5281
136 Ga0105250_10025411 3300009092 Bacteria 2386
137 Ga0105240_10278809 3300009093 Bacteria 1921
138 Ga0105240_10326941 3300009093 Unclassified 1746
139 Ga0111539_10042931 3300009094 Bacteria 5425
140 Ga0111539_10081170 3300009094 Bacteria 3814
141 Ga0105245_10000214 3300009098 Bacteria 55083
142 Ga0105245_10004000 3300009098 Bacteria 13100
143 Ga0105245_10049941 3300009098 Bacteria 3747
144 Ga0105245_10069364 3300009098 Bacteria 3196
145 Ga0105247_10002248 3300009101 Bacteria 13290
146 Ga0105247_10015066 3300009101 Unclassified 4637
147 Ga0114129_10402016 3300009147 Bacteria 1805
148 Ga0105243_10047572 3300009148 Bacteria 3378
149 Ga0105241_10000002 3300009174 Bacteria 869480
150 Ga0105241_10047249 3300009174 Unclassified 3273
151 Ga0105241_10077331 3300009174 Bacteria 2597
152 Ga0105241_10107187 3300009174 Unclassified 2231
153 Ga0105248_10011213 3300009177 Bacteria 9885
154 Ga0105248_10062351 3300009177 Bacteria 4187
155 Ga0105248_10393920 3300009177 Bacteria 1559
156 Ga0105237_10001614 3300009545 Bacteria 29283
157 Ga0105237_10025570 3300009545 Bacteria 6034
158 Ga0105237_10137013 3300009545 Unclassified 2442
159 Ga0105238_10067093 3300009551 Unclassified 3589
160 Ga0105249_10000056 3300009553 Bacteria 160443
161 Ga0105249_10007206 3300009553 Bacteria 9706
162 Ga0105249_10066163 3300009553 Bacteria 3327
163 Ga0105239_10000255 3300010375 Bacteria 79421
164 Ga0105239_10002398 3300010375 Bacteria 23899
165 Ga0105239_10234898 3300010375 Bacteria 2057
166 Ga0105246_10004262 3300011119 Bacteria 8700
167 Ga0105246_10037345 3300011119 Bacteria 3260
168 Ga0157373_10000767 3300013100 Bacteria 24785
169 Ga0157373_10003026 3300013100 Bacteria 12683
170 Ga0157373_10008361 3300013100 Bacteria 7688
171 Ga0157373_10098498 3300013100 Bacteria 2057
172 Ga0157373_10178838 3300013100 Bacteria 1493
173 Ga0157371_10000322 3300013102 Bacteria 62104
174 Ga0157371_10004323 3300013102 Bacteria 12455
175 Ga0157371_10005553 3300013102 Bacteria 10603
176 Ga0157371_10005951 3300013102 Bacteria 10181
177 Ga0157371_10012160 3300013102 Bacteria 6594
178 Ga0157371_10022417 3300013102 Bacteria 4628
179 Ga0157371_10037703 3300013102 Bacteria 3459
180 Ga0157371_10050447 3300013102 Bacteria 2957
181 Ga0157371_10157206 3300013102 Bacteria 1623
182 Ga0157370_10000478 3300013104 Bacteria 49942
183 Ga0157370_10004630 3300013104 Bacteria 15729
184 Ga0157370_10029904 3300013104 Bacteria 5339
185 Ga0157370_10118197 3300013104 Bacteria 2476
186 Ga0157370_10199846 3300013104 Bacteria 1854
187 Ga0157370_10299423 3300013104 Bacteria 1485
188 Ga0157369_10014417 3300013105 Bacteria 8924
189 Ga0157374_10003226 3300013296 Bacteria 13702
190 Ga0157374_10055049 3300013296 Bacteria 3712
191 Ga0157374_10120871 3300013296 Bacteria 2528
192 Ga0157378_10022944 3300013297 Bacteria 5494
193 Ga0157378_10061224 3300013297 Unclassified 3358
194 Ga0157378_10078815 3300013297 Unclassified 2973
195 Ga0163162_10047515 3300013306 Unclassified 4302
196 Ga0163162_10260640 3300013306 Bacteria 1865
197 Ga0157372_10005349 3300013307 Bacteria 13642
198 Ga0157372_10026752 3300013307 Bacteria 6279
199 Ga0157372_10027679 3300013307 Bacteria 6178
200 Ga0157372_10050597 3300013307 Bacteria 4621
201 Ga0157372_10057716 3300013307 Bacteria 4339
202 Ga0157372_10106218 3300013307 Bacteria 3212
203 Ga0157372_10181675 3300013307 Bacteria 2435
204 Ga0157372_10220591 3300013307 Unclassified 2198
205 Ga0157372_10234277 3300013307 Bacteria 2129
206 Ga0157375_10000011 3300013308 Bacteria 334557
207 Ga0157375_10001967 3300013308 Bacteria 17714
208 Ga0157375_10016697 3300013308 Bacteria 6604
209 Ga0157375_10031785 3300013308 Bacteria 4997
210 Ga0163163_10036173 3300014325 Bacteria 4795
211 Ga0157380_10000013 3300014326 Bacteria 131248
212 Ga0157380_10000314 3300014326 Bacteria 29344
213 Ga0157380_10310077 3300014326 Eukaryota 1458
214 Ga0182008_10009798 3300014497 Bacteria 5155
215 Ga0157377_10000759 3300014745 Bacteria 13338
216 Ga0157379_10025145 3300014968 Bacteria 5286
217 Ga0157379_10121441 3300014968 Unclassified 2350
218 Ga0157379_10228513 3300014968 Bacteria 1686
219 Ga0157376_10071422 3300014969 Unclassified 2950
220 Ga0182007_10028127 3300015262 Unclassified 1934
221 Ga0163161_10001441 3300017792 Bacteria 17574
222 Ga0209130_1000445 3300025284 Bacteria 43640
223 Ga0209676_1000191 3300025292 Bacteria 139979
224 Ga0209025_1001278 3300025294 Bacteria 34630
225 Ga0209025_1004197 3300025294 Bacteria 12715
226 Ga0209025_1004815 3300025294 Bacteria 11410
227 Ga0209025_1004906 3300025294 Bacteria 11255
228 Ga0209025_1006149 3300025294 Bacteria 9451
229 Ga0209025_1007773 3300025294 Bacteria 7895
230 Ga0209025_1015803 3300025294 Bacteria 4515
231 Ga0209025_1021738 3300025294 Bacteria 3438
232 Ga0209050_1005029 3300025298 Bacteria 8578
233 Ga0207656_10068278 3300025321 Bacteria 1575
234 Ga0207696_1004455 3300025711 Bacteria 6032
235 Ga0207696_1004802 3300025711 Bacteria 5739
236 Ga0207655_1008326 3300025728 Bacteria 6598
237 Ga0207713_1000433 3300025735 Bacteria 44170
238 Ga0207692_10027931 3300025898 Unclassified 2663
239 Ga0207692_10043531 3300025898 Bacteria 2235
240 Ga0207642_10088046 3300025899 Unclassified 1526
241 Ga0207647_10039151 3300025904 Unclassified 2994
242 Ga0207647_10061390 3300025904 Unclassified 2294
243 Ga0207699_10045726 3300025906 Bacteria 2557
244 Ga0207699_10052872 3300025906 Bacteria 2406
245 Ga0207645_10000019 3300025907 Bacteria 110182
246 Ga0207643_10000213 3300025908 Bacteria 40654
247 Ga0207643_10015159 3300025908 Bacteria 4193
248 Ga0207705_10011305 3300025909 Bacteria 6467
249 Ga0207705_10021429 3300025909 Bacteria 4612
250 Ga0207705_10085049 3300025909 Bacteria 2310
251 Ga0207654_10000005 3300025911 Bacteria 869492
252 Ga0207654_10037306 3300025911 Unclassified 2720
253 Ga0207707_10049789 3300025912 Bacteria 3650
254 Ga0207707_10352783 3300025912 Bacteria 1267
255 Ga0207695_10174819 3300025913 Bacteria 2070
256 Ga0207695_10211965 3300025913 Bacteria 1847
257 Ga0207671_10006642 3300025914 Bacteria 10253
258 Ga0207671_10013189 3300025914 Bacteria 6596
259 Ga0207693_10003832 3300025915 Bacteria 12808
260 Ga0207693_10009444 3300025915 Bacteria 7949
261 Ga0207660_10152722 3300025917 Unclassified 1775
262 Ga0207662_10000939 3300025918 Bacteria 13531
263 Ga0207657_10002394 3300025919 Bacteria 20283
264 Ga0207657_10009248 3300025919 Bacteria 9928
265 Ga0207657_10033705 3300025919 Bacteria 4614
266 Ga0207657_10160378 3300025919 Bacteria 1827
267 Ga0207657_10179843 3300025919 Bacteria 1710
268 Ga0207649_10026102 3300025920 Bacteria 3414
269 Ga0207649_10039821 3300025920 Unclassified 2852
270 Ga0207652_10000013 3300025921 Bacteria 222247
271 Ga0207652_10005333 3300025921 Bacteria 10424
272 Ga0207650_10000024 3300025925 Bacteria 299184
273 Ga0207650_10087909 3300025925 Bacteria 2369
274 Ga0207659_10076974 3300025926 Bacteria 2454
275 Ga0207687_10024580 3300025927 Bacteria 4026
276 Ga0207687_10025549 3300025927 Unclassified 3953
277 Ga0207700_10223969 3300025928 Bacteria 1596
278 Ga0207664_10076092 3300025929 Unclassified 2716
279 Ga0207664_10133303 3300025929 Unclassified 2094
280 Ga0207690_10008571 3300025932 Bacteria 6069
281 Ga0207690_10012867 3300025932 Bacteria 5014
282 Ga0207706_10000627 3300025933 Bacteria 37490
283 Ga0207706_10000973 3300025933 Bacteria 29233
284 Ga0207670_10000549 3300025936 Bacteria 20734
285 Ga0207670_10009243 3300025936 Bacteria 5612
286 Ga0207704_10020156 3300025938 Bacteria 3520
287 Ga0207665_10000591 3300025939 Bacteria 24420
288 Ga0207665_10063035 3300025939 Bacteria 2517
289 Ga0207691_10000102 3300025940 Bacteria 75317
290 Ga0207691_10000156 3300025940 Bacteria 63522
291 Ga0207711_10007947 3300025941 Bacteria 8872
292 Ga0207711_10042258 3300025941 Bacteria 3884
293 Ga0207711_10072213 3300025941 Bacteria 2997
294 Ga0207689_10000216 3300025942 Bacteria 51024
295 Ga0207661_10007375 3300025944 Bacteria 7824
296 Ga0207679_10000055 3300025945 Bacteria 108728
297 Ga0207679_10061007 3300025945 Unclassified 2805
298 Ga0207667_10000451 3300025949 Bacteria 55109
299 Ga0207667_10018636 3300025949 Bacteria 7780
300 Ga0207651_10008224 3300025960 Bacteria 5622
301 Ga0207651_10308535 3300025960 Bacteria 1318
302 Ga0207712_10000015 3300025961 Bacteria 346689
303 Ga0207640_10009046 3300025981 Bacteria 5558
304 Ga0207658_10025701 3300025986 Bacteria 4123
305 Ga0207658_10100900 3300025986 Unclassified 2260
306 Ga0207677_10000081 3300026023 Bacteria 78954
307 Ga0207677_10072180 3300026023 Bacteria 2439
308 Ga0207703_10000215 3300026035 Bacteria 67474
309 Ga0207703_10014734 3300026035 Bacteria 6103
310 Ga0207703_10206332 3300026035 Unclassified 1749
311 Ga0207678_10000335 3300026067 Bacteria 42295
312 Ga0207702_10027008 3300026078 Bacteria 4767
313 Ga0207702_10057624 3300026078 Bacteria 3303
314 Ga0207641_10000030 3300026088 Bacteria 224468
315 Ga0207641_10061801 3300026088 Bacteria 3195
316 Ga0207648_10000031 3300026089 Bacteria 129124
317 Ga0207648_10076852 3300026089 Bacteria 2911
318 Ga0207676_10000007 3300026095 Bacteria 591074
319 Ga0207676_10060484 3300026095 Unclassified 2997
320 Ga0207674_10000618 3300026116 Bacteria 46623
321 Ga0207674_10021968 3300026116 Bacteria 6861
322 Ga0207675_100026830 3300026118 Bacteria 5361
323 Ga0207675_100050664 3300026118 Unclassified 3874
324 Ga0207683_10011306 3300026121 Bacteria 7613
325 Ga0207698_10085842 3300026142 Bacteria 2557
326 Ga0209281_1000027 3300027111 Bacteria 463409
327 Ga0268266_10010324 3300028379 Bacteria 8169
328 Ga0268266_10024343 3300028379 Bacteria 5150
329 Ga0268265_10000168 3300028380 Bacteria 79798
330 Ga0268265_10095044 3300028380 Bacteria 2392
331 Ga0268265_10099499 3300028380 Unclassified 2345
332 Ga0268265_10102118 3300028380 Bacteria 2318
333 Ga0268264_10013788 3300028381 Bacteria 6647
334 Ga0268264_10018383 3300028381 Bacteria 5715
335 Ga0268264_10040561 3300028381 Bacteria 3847
336 Ga0265323_10000351 3300028653 Bacteria 26431
337 Ga0265327_10004335 3300031251 Bacteria 12647
338 Ga0265316_10000666 3300031344 Bacteria 38307
339 Ga0307513_10031734 3300031456 Bacteria 5977
340 Ga0307408_100000083 3300031548 Bacteria 105013
341 Ga0307408_100166325 3300031548 Bacteria 1757
342 Ga0265314_10003513 3300031711 Bacteria 15123
343 Ga0316576_10050101 3300031727 Bacteria 3036
344 Ga0316576_10080771 3300031727 Bacteria 2412
345 Ga0307405_10021596 3300031731 Bacteria 3621
346 Ga0307405_10033189 3300031731 Unclassified 3059
347 Ga0307413_10000062 3300031824 Bacteria 27702
348 Ga0307406_10009062 3300031901 Bacteria 5566
349 Ga0307409_100427980 3300031995 Bacteria 1271
350 Ga0307416_100349197 3300032002 Bacteria 1496
351 Ga0307414_10000850 3300032004 Bacteria 15601
352 Ga0307414_10004528 3300032004 Bacteria 7560
353 Ga0307414_10004533 3300032004 Bacteria 7552
354 Ga0307415_100006871 3300032126 Bacteria 6178
355 Ga0373939_0021477 3300035114 Unclassified 1768
356 Ga0373942_0010876 3300035207 Unclassified 2148
357 Ga0395899_0016403 3300037312 Bacteria 5646
358 Ga0395899_0058913 3300037312 Bacteria 2831
359 Ga0395899_0064838 3300037312 Bacteria 2685
360 Ga0395900_0001378 3300037418 Bacteria 29221
361 Ga0395900_0115069 3300037418 Bacteria 2760
362 Ga0395900_0181800 3300037418 Bacteria 2136
363 Ga0395898_0001155 3300037466 Bacteria 40306
364 Ga0395898_0030032 3300037466 Bacteria 5441
365 Ga0395898_0184022 3300037466 Unclassified 1996
366 Ga0395905_0000114 3300037471 Bacteria 134334
367 Ga0395905_0101252 3300037471 Bacteria 2705
368 Ga0395901_0009161 3300038443 Bacteria 10027
369 Ga0395901_0077136 3300038443 Bacteria 3478
370 Ga0237819_00100 3300038705 Bacteria 31535
371 Ga0400483_029554 3300039062 Bacteria 21958
372 Ga0436361_0913525 3300039447 Bacteria 2669
373 Ga0436363_0535294 3300039450 Bacteria 1914
374 Ga0451807_0490963 3300041486 Bacteria 2665
375 Ga0451577_0001788 3300042876 Bacteria 27572
376 Ga0451577_0058104 3300042876 Bacteria 3448
377 Ga0466982_0073049 3300044672 Bacteria 2120
378 Ga0453684_0000880 3300044712 Bacteria 100396
379 Ga0453684_0002542 3300044712 Bacteria 43901
380 Ga0451576_0004908 3300045051 Bacteria 17065
381 Ga0451576_0348168 3300045051 Bacteria 1551
382 Ga0495592_0028628 3300046454 Bacteria 4218
383 Ga0495603_0049874 3300046455 Bacteria 2491
384 Ga0495629_0054535 3300046459 Bacteria 2796
385 Ga0495629_0166649 3300046459 Bacteria 1530
386 Ga0495638_0000026 3300046460 Bacteria 347061
387 Ga0495641_0003013 3300046461 Bacteria 12908
388 Ga0495580_0021054 3300046472 Bacteria 4816
389 Ga0495580_0053921 3300046472 Bacteria 2837
390 Ga0495662_0033212 3300046476 Bacteria 2494
391 Ga0495662_0100046 3300046476 Bacteria 1418
392 Ga0495594_0023777 3300046499 Bacteria 3286
393 Ga0495596_0025610 3300046500 Bacteria 2384
394 Ga0495616_0042211 3300046513 Bacteria 2323
395 Ga0495618_0122860 3300046514 Bacteria 1662
396 Ga0495644_0010130 3300046523 Bacteria 3632
397 Ga0495652_0036508 3300046529 Bacteria 4272
398 Ga0495654_0000435 3300046530 Bacteria 35463
399 Ga0495597_0005777 3300046542 Bacteria 6493
400 Ga0495668_0022955 3300046616 Bacteria 3562
401 Ga0495634_0171629 3300046642 Bacteria 1362
402 Ga0495635_0103402 3300046663 Unclassified 1946
403 Ga0495669_0027522 3300046684 Bacteria 2487
404 Ga0495613_0104438 3300046689 Bacteria 2045
405 Ga0495589_0000004 3300046794 Bacteria 439891
406 Ga0495581_0153558 3300047315 Bacteria 1345
407 Ga0496100_0091132 3300048903 Bacteria 2080
408 Ga0496101_0111805 3300048904 Unclassified 2057
409 Ga0496102_0046777 3300048905 Bacteria 3930
410 Ga0496102_0107984 3300048905 Bacteria 2592
411 Ga0496103_0058749 3300048906 Unclassified 2389
412 Ga0496108_0002457 3300048911 Bacteria 14826
413 Ga0496109_0002648 3300048912 Bacteria 15012
414 Ga0496110_0005493 3300048913 Bacteria 9944
415 Ga0496111_0059783 3300048914 Bacteria 2762
416 Ga0496112_0000077 3300048915 Bacteria 64994
417 Ga0496112_0004670 3300048915 Bacteria 11645
418 Ga0496112_0126007 3300048915 Unclassified 2532
419 Ga0496112_0162093 3300048915 Unclassified 2203
420 Ga0496114_0007055 3300048917 Bacteria 8866
421 Ga0496114_0202696 3300048917 Unclassified 1738
422 Ga0501031_0001842 3300049568 Bacteria 13335
423 Ga0501031_0010692 3300049568 Bacteria 5979
424 Ga0501032_0012461 3300049569 Bacteria 6076
425 Ga0501032_0016965 3300049569 Bacteria 5117
426 Ga0501033_0000273 3300049570 Bacteria 49935
427 Ga0501034_0001718 3300049571 Bacteria 28189
428 Ga0501034_0052283 3300049571 Unclassified 4116
429 Ga0501034_0199567 3300049571 Bacteria 1959
430 Ga0501036_0006531 3300049572 Bacteria 9474
431 Ga0501036_0024974 3300049572 Bacteria 5040
432 Ga0501036_0370832 3300049572 Bacteria 1195
433 Ga0501037_0003592 3300049573 Bacteria 11255
434 Ga0501038_0005185 3300049574 Bacteria 12122
435 Ga0501038_0060150 3300049574 Bacteria 3252
436 Ga0501039_0016197 3300049575 Bacteria 5711
437 Ga0501040_0016932 3300049576 Bacteria 4832
438 Ga0501043_0003204 3300049579 Bacteria 13536
439 Ga0501070_0261707 3300049586 Bacteria 1414
440 Ga0501071_0028345 3300049587 Bacteria 3946
441 Ga0501072_0025651 3300049588 Bacteria 4592
442 Ga0501074_0069170 3300049590 Unclassified 2539
443 Ga0501074_0089892 3300049590 Bacteria 2199
444 Ga0501223_008215 3300049663 Bacteria 2128
445 Ga0501242_000484 3300049674 Bacteria 3500
446 Ga0501247_003964 3300049677 Bacteria 1605
447 Ga0501257_005741 3300049686 Bacteria 2743
448 Ga0501079_0016846 3300049741 Bacteria 5580
449 Ga0501083_0014878 3300049744 Bacteria 5441
450 Ga0501264_000946 3300049761 Bacteria 3609
451 Ga0501035_0016607 3300049822 Bacteria 6786
452 Ga0501044_0001358 3300049823 Bacteria 28701
453 Ga0501045_0000768 3300049824 Bacteria 20597
454 Ga0501045_0054456 3300049824 Bacteria 2924
455 nmdc:mga0qj67_118346_c1 3300050509 Bacteria 2142
456 nmdc:mga08y16_22245_c1 3300050511 Bacteria 6690
457 nmdc:mga0rr50_67449_c1 3300050513 Unclassified 2717
458 Ga0495601_0153423 3300053077 Unclassified 1504
459 Ga0495619_0048549 3300053085 Unclassified 2797
460 Ga0500647_0006506 3300053091 Bacteria 4946
461 Ga0500651_0004436 3300053093 Bacteria 7858
462 Ga0500618_003126 3300053125 Bacteria 5828
463 Ga0500642_0029365 3300053130 Bacteria 2278
464 Ga0500655_000049 3300053133 Bacteria 32525
465 Ga0500577_0006273 3300053142 Bacteria 3267
466 Ga0500590_000095 3300053148 Bacteria 23020
467 Ga0500604_0002238 3300053151 Bacteria 5296
468 Ga0500616_0000043 3300053153 Bacteria 342930
469 Ga0500622_0000014 3300053156 Bacteria 368189
470 Ga0500622_0000020 3300053156 Bacteria 271239
471 Ga0500622_0002897 3300053156 Bacteria 11966
472 Ga0500636_0033666 3300053177 Bacteria 3033
473 Ga0500570_000154 3300053724 Bacteria 21218
474 Ga0501082_0020656 3300060353 Bacteria 5677
475 Ga0530510_0055514 3300061734 Bacteria 2861
476 2508851947 2508501071 Bacteria 5454741
477 2522552454 2522125168 Bacteria 7376607
478 2585263414 2582581305 Bacteria 4895574
479 2585301059 2582581312 Bacteria 7308206
480 2705992759 2703719227 Bacteria 5631989
481 2739159096 2738541358 Bacteria 5932299
482 2739211755 2738543006 Bacteria 5904091
483 2807178238 2806310673 Bacteria 4801221
484 2808867974 2808606364 Bacteria 4465927
485 2808873241 2808606365 Bacteria 4301966
486 2846544015 2846540461 Bacteria 5471451
487 2884635109 2884634485 Bacteria 3928637
488 2888374258 2888373701 Bacteria 5098052
489 2890807692 2890804823 Bacteria 3717572
490 2911139561 2911138879 Bacteria 5811561
491 2919695262 2919692658 Bacteria 5943958
492 2965762115 2965761152 Bacteria 5806513
493 2979084559 2979083700 Bacteria 5894929
494 8004595488 8004592986 Bacteria 5122074
495 8022797925 8022792930 Bacteria 5693794
496 8057583646 8057582654 Bacteria 5218944
497 rootL2_10206705
498 JGI24034J26672_10007973
499 JGI24751J29686_10002332
500 JGI25159J45721_1004222
501 JGI25151J46595_10003016
502 JGI25151J46595_10004318
503 JGI25151J46595_10011248
504 JGI25151J46595_10014437
505 rootH1_10007115
506 rootH1_10094622
507 rootH1_10132167
508 rootH2_10008034
509 rootH2_10150236
510 rootH2_10246330
511 rootL2_10051710
512 rootL2_10078336
513 rootL2_10201280
514 rootH1_10006386
515 rootH1_10018051
516 rootH1_10146650
517 rootH1_10162782
518 rootH1_10276915
519 Ga0065165_1000097
520 Ga0065165_1001998
521 Ga0065707_10133364
522 Ga0070658_10030087
523 Ga0070658_10107752
524 Ga0070676_10027475
525 Ga0070683_100001837
526 Ga0070683_100088123
527 Ga0070690_100076594
528 Ga0070670_100072592
529 Ga0070677_10021775
530 Ga0068869_100016354
531 Ga0070680_100035203
532 Ga0070682_100000015
533 Ga0070682_100022008
534 Ga0070682_100176855
535 Ga0068868_100000330
536 Ga0068868_100007006
537 Ga0070689_100005453
538 Ga0070689_100016849
539 Ga0070689_100032599
540 Ga0070691_10024827
541 Ga0070687_100039935
542 Ga0070661_100036447
543 Ga0070661_100067746
544 Ga0070668_100025628
545 Ga0070668_100157127
546 Ga0070669_100014736
547 Ga0070674_100004190
548 Ga0070673_100014062
549 Ga0070688_100010846
550 Ga0070688_100130577
551 Ga0070659_100023009
552 Ga0070709_10224479
553 Ga0070713_100063508
554 Ga0070713_100063863
555 Ga0070710_10045188
556 Ga0070708_100005060
557 Ga0070663_100029978
558 Ga0070662_100009974
559 Ga0070662_100040758
560 Ga0070681_10058585
561 Ga0070681_10104198
562 Ga0068867_100001402
563 Ga0068867_100082423
564 Ga0070685_10025170
565 Ga0070706_100008950
566 Ga0070699_100131604
567 Ga0070679_100000065
568 Ga0070684_100045893
569 Ga0070684_100089897
570 Ga0070697_100000113
571 Ga0070697_100004177
572 Ga0068853_100057829
573 Ga0070672_100000054
574 Ga0070686_100005248
575 Ga0070686_100028875
576 Ga0070665_100021889
577 Ga0068855_100005888
578 Ga0068855_100059915
579 Ga0068855_100172156
580 Ga0070664_100267448
581 Ga0068857_100036995
582 Ga0068854_100003678
583 Ga0068856_100006747
584 Ga0068856_100016946
585 Ga0068856_100100222
586 Ga0070702_100001719
587 Ga0068852_100021068
588 Ga0068852_100182898
589 Ga0068859_100008352
590 Ga0068859_100052581
591 Ga0068859_100062855
592 Ga0068864_100000009
593 Ga0068864_100232675
594 Ga0068866_10010337
595 Ga0068861_100043394
596 Ga0068861_100071565
597 Ga0068851_10007616
598 Ga0068851_10008543
599 Ga0068870_10011889
600 Ga0068863_100014986
601 Ga0068863_100080718
602 Ga0068858_100001232
603 Ga0068858_100002477
604 Ga0068858_100025917
605 Ga0068858_100213021
606 Ga0068860_100000848
607 Ga0068862_100000148
608 Ga0068862_100093814
609 Ga0070716_100000912
610 Ga0070712_100005292
611 Ga0070712_100034250
612 Ga0097621_100034508
613 Ga0097621_100084214
614 Ga0068871_100099674
615 Ga0075428_100037840
616 Ga0075430_100053846
617 Ga0075430_100095755
618 Ga0075430_100097026
619 Ga0075430_100166941
620 Ga0075434_100204628
621 Ga0068865_100006725
622 Ga0097620_100008352
623 Ga0097620_100052584
624 Ga0097620_100062848
625 Ga0079104_1003094
626 Ga0105251_10000369
627 Ga0105244_10017653
628 Ga0105250_10003339
629 Ga0105250_10006138
630 Ga0105250_10025411
631 Ga0105240_10278809
632 Ga0105240_10326941
633 Ga0111539_10042931
634 Ga0111539_10081170
635 Ga0105245_10000214
636 Ga0105245_10004000
637 Ga0105245_10049941
638 Ga0105245_10069364
639 Ga0105247_10002248
640 Ga0105247_10015066
641 Ga0114129_10402016
642 Ga0105243_10047572
643 Ga0105241_10000002
644 Ga0105241_10047249
645 Ga0105241_10077331
646 Ga0105241_10107187
647 Ga0105248_10011213
648 Ga0105248_10062351
649 Ga0105248_10393920
650 Ga0105237_10001614
651 Ga0105237_10025570
652 Ga0105237_10137013
653 Ga0105238_10067093
654 Ga0105249_10000056
655 Ga0105249_10007206
656 Ga0105249_10066163
657 Ga0105239_10000255
658 Ga0105239_10002398
659 Ga0105239_10234898
660 Ga0105246_10004262
661 Ga0105246_10037345
662 Ga0157373_10000767
663 Ga0157373_10003026
664 Ga0157373_10008361
665 Ga0157373_10098498
666 Ga0157373_10178838
667 Ga0157371_10000322
668 Ga0157371_10004323
669 Ga0157371_10005553
670 Ga0157371_10005951
671 Ga0157371_10012160
672 Ga0157371_10022417
673 Ga0157371_10037703
674 Ga0157371_10050447
675 Ga0157371_10157206
676 Ga0157370_10000478
677 Ga0157370_10004630
678 Ga0157370_10029904
679 Ga0157370_10118197
680 Ga0157370_10199846
681 Ga0157370_10299423
682 Ga0157369_10014417
683 Ga0157374_10003226
684 Ga0157374_10055049
685 Ga0157374_10120871
686 Ga0157378_10022944
687 Ga0157378_10061224
688 Ga0157378_10078815
689 Ga0163162_10047515
690 Ga0163162_10260640
691 Ga0157372_10005349
692 Ga0157372_10026752
693 Ga0157372_10027679
694 Ga0157372_10050597
695 Ga0157372_10057716
696 Ga0157372_10106218
697 Ga0157372_10181675
698 Ga0157372_10220591
699 Ga0157372_10234277
700 Ga0157375_10000011
701 Ga0157375_10001967
702 Ga0157375_10016697
703 Ga0157375_10031785
704 Ga0163163_10036173
705 Ga0157380_10000013
706 Ga0157380_10000314
707 Ga0157380_10310077
708 Ga0182008_10009798
709 Ga0157377_10000759
710 Ga0157379_10025145
711 Ga0157379_10121441
712 Ga0157379_10228513
713 Ga0157376_10071422
714 Ga0182007_10028127
715 Ga0163161_10001441
716 Ga0209130_1000445
717 Ga0209676_1000191
718 Ga0209025_1001278
719 Ga0209025_1004197
720 Ga0209025_1004815
721 Ga0209025_1004906
722 Ga0209025_1006149
723 Ga0209025_1007773
724 Ga0209025_1015803
725 Ga0209025_1021738
726 Ga0209050_1005029
727 Ga0207656_10068278
728 Ga0207696_1004455
729 Ga0207696_1004802
730 Ga0207655_1008326
731 Ga0207713_1000433
732 Ga0207692_10027931
733 Ga0207692_10043531
734 Ga0207642_10088046
735 Ga0207647_10039151
736 Ga0207647_10061390
737 Ga0207699_10045726
738 Ga0207699_10052872
739 Ga0207645_10000019
740 Ga0207643_10000213
741 Ga0207643_10015159
742 Ga0207705_10011305
743 Ga0207705_10021429
744 Ga0207705_10085049
745 Ga0207654_10000005
746 Ga0207654_10037306
747 Ga0207707_10049789
748 Ga0207707_10352783
749 Ga0207695_10174819
750 Ga0207695_10211965
751 Ga0207671_10006642
752 Ga0207671_10013189
753 Ga0207693_10003832
754 Ga0207693_10009444
755 Ga0207660_10152722
756 Ga0207662_10000939
757 Ga0207657_10002394
758 Ga0207657_10009248
759 Ga0207657_10033705
760 Ga0207657_10160378
761 Ga0207657_10179843
762 Ga0207649_10026102
763 Ga0207649_10039821
764 Ga0207652_10000013
765 Ga0207652_10005333
766 Ga0207650_10000024
767 Ga0207650_10087909
768 Ga0207659_10076974
769 Ga0207687_10024580
770 Ga0207687_10025549
771 Ga0207700_10223969
772 Ga0207664_10076092
773 Ga0207664_10133303
774 Ga0207690_10008571
775 Ga0207690_10012867
776 Ga0207706_10000627
777 Ga0207706_10000973
778 Ga0207670_10000549
779 Ga0207670_10009243
780 Ga0207704_10020156
781 Ga0207665_10000591
782 Ga0207665_10063035
783 Ga0207691_10000102
784 Ga0207691_10000156
785 Ga0207711_10007947
786 Ga0207711_10042258
787 Ga0207711_10072213
788 Ga0207689_10000216
789 Ga0207661_10007375
790 Ga0207679_10000055
791 Ga0207679_10061007
792 Ga0207667_10000451
793 Ga0207667_10018636
794 Ga0207651_10008224
795 Ga0207651_10308535
796 Ga0207712_10000015
797 Ga0207640_10009046
798 Ga0207658_10025701
799 Ga0207658_10100900
800 Ga0207677_10000081
801 Ga0207677_10072180
802 Ga0207703_10000215
803 Ga0207703_10014734
804 Ga0207703_10206332
805 Ga0207678_10000335
806 Ga0207702_10027008
807 Ga0207702_10057624
808 Ga0207641_10000030
809 Ga0207641_10061801
810 Ga0207648_10000031
811 Ga0207648_10076852
812 Ga0207676_10000007
813 Ga0207676_10060484
814 Ga0207674_10000618
815 Ga0207674_10021968
816 Ga0207675_100026830
817 Ga0207675_100050664
818 Ga0207683_10011306
819 Ga0207698_10085842
820 Ga0209281_1000027
821 Ga0268266_10010324
822 Ga0268266_10024343
823 Ga0268265_10000168
824 Ga0268265_10095044
825 Ga0268265_10099499
826 Ga0268265_10102118
827 Ga0268264_10013788
828 Ga0268264_10018383
829 Ga0268264_10040561
830 Ga0265323_10000351
831 Ga0265327_10004335
832 Ga0265316_10000666
833 Ga0307513_10031734
834 Ga0307408_100000083
835 Ga0307408_100166325
836 Ga0265314_10003513
837 Ga0316576_10050101
838 Ga0316576_10080771
839 Ga0307405_10021596
840 Ga0307405_10033189
841 Ga0307413_10000062
842 Ga0307406_10009062
843 Ga0307409_100427980
844 Ga0307416_100349197
845 Ga0307414_10000850
846 Ga0307414_10004528
847 Ga0307414_10004533
848 Ga0307415_100006871
849 Ga0373939_0021477
850 Ga0373942_0010876
851 Ga0395899_0016403
852 Ga0395899_0058913
853 Ga0395899_0064838
854 Ga0395900_0001378
855 Ga0395900_0115069
856 Ga0395900_0181800
857 Ga0395898_0001155
858 Ga0395898_0030032
859 Ga0395898_0184022
860 Ga0395905_0000114
861 Ga0395905_0101252
862 Ga0395901_0009161
863 Ga0395901_0077136
864 Ga0237819_00100
865 Ga0400483_029554
866 Ga0436361_0913525
867 Ga0436363_0535294
868 Ga0451807_0490963
869 Ga0451577_0001788
870 Ga0451577_0058104
871 Ga0466982_0073049
872 Ga0453684_0000880
873 Ga0453684_0002542
874 Ga0451576_0004908
875 Ga0451576_0348168
876 Ga0495592_0028628
877 Ga0495603_0049874
878 Ga0495629_0054535
879 Ga0495629_0166649
880 Ga0495638_0000026
881 Ga0495641_0003013
882 Ga0495580_0021054
883 Ga0495580_0053921
884 Ga0495662_0033212
885 Ga0495662_0100046
886 Ga0495594_0023777
887 Ga0495596_0025610
888 Ga0495616_0042211
889 Ga0495618_0122860
890 Ga0495644_0010130
891 Ga0495652_0036508
892 Ga0495654_0000435
893 Ga0495597_0005777
894 Ga0495668_0022955
895 Ga0495634_0171629
896 Ga0495635_0103402
897 Ga0495669_0027522
898 Ga0495613_0104438
899 Ga0495589_0000004
900 Ga0495581_0153558
901 Ga0496100_0091132
902 Ga0496101_0111805
903 Ga0496102_0046777
904 Ga0496102_0107984
905 Ga0496103_0058749
906 Ga0496108_0002457
907 Ga0496109_0002648
908 Ga0496110_0005493
909 Ga0496111_0059783
910 Ga0496112_0000077
911 Ga0496112_0004670
912 Ga0496112_0126007
913 Ga0496112_0162093
914 Ga0496114_0007055
915 Ga0496114_0202696
916 Ga0501031_0001842
917 Ga0501031_0010692
918 Ga0501032_0012461
919 Ga0501032_0016965
920 Ga0501033_0000273
921 Ga0501034_0001718
922 Ga0501034_0052283
923 Ga0501034_0199567
924 Ga0501036_0006531
925 Ga0501036_0024974
926 Ga0501036_0370832
927 Ga0501037_0003592
928 Ga0501038_0005185
929 Ga0501038_0060150
930 Ga0501039_0016197
931 Ga0501040_0016932
932 Ga0501043_0003204
933 Ga0501070_0261707
934 Ga0501071_0028345
935 Ga0501072_0025651
936 Ga0501074_0069170
937 Ga0501074_0089892
938 Ga0501223_008215
939 Ga0501242_000484
940 Ga0501247_003964
941 Ga0501257_005741
942 Ga0501079_0016846
943 Ga0501083_0014878
944 Ga0501264_000946
945 Ga0501035_0016607
946 Ga0501044_0001358
947 Ga0501045_0000768
948 Ga0501045_0054456
949 nmdc:mga0qj67_118346_c1
950 nmdc:mga08y16_22245_c1
951 nmdc:mga0rr50_67449_c1
952 Ga0495601_0153423
953 Ga0495619_0048549
954 Ga0500647_0006506
955 Ga0500651_0004436
956 Ga0500618_003126
957 Ga0500642_0029365
958 Ga0500655_000049
959 Ga0500577_0006273
960 Ga0500590_000095
961 Ga0500604_0002238
962 Ga0500616_0000043
963 Ga0500622_0000014
964 Ga0500622_0000020
965 Ga0500622_0002897
966 Ga0500636_0033666
967 Ga0500570_000154
968 Ga0501082_0020656
969 Ga0530510_0055514
970 2508851947
971 2522552454
972 2585263414
973 2585301059
974 2705992759
975 2739159096
976 2739211755
977 2807178238
978 2808867974
979 2808873241
980 2846544015
981 2884635109
982 2888374258
983 2890807692
984 2911139561
985 2919695262
986 2965762115
987 2979084559
988 8004595488
989 8022797925
990 8057583646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

34

75

0.87

PF01266

DAO

FAD dependent oxidoreductase

34

423

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w7f-assembly1.cif.gz_B structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.977 5 400
8w78-assembly1.cif.gz_B structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate 0.9719 5 400
8w7f-assembly1.cif.gz_C structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.9712 5 400
8w7f-assembly1.cif.gz_A structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.9696 6 400
8w75-assembly1.cif.gz_B structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase 0.9689 6 399
ID Description Score Start End Superfamily
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.976 9 264 3.50.50.60
af_Q9VJ28_45_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9729 9 214 3.50.50.60
af_Q9H9P8_51_315_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9668 9 258 3.50.50.60
af_D3ZVS2_51_277_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9622 9 218 3.50.50.60
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9612 9 264 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A355B5L0-F1-model_v4 L-2-hydroxyglutarate oxidase 0.9885 45 401 GO:0005737
GO:0047545
AF-A0A6N8G019-F1-model_v4 Hydroxyglutarate oxidase 0.9872 6 392 GO:0005737
GO:0047545
AF-A0A2D5N7N3-F1-model_v4 L-2-hydroxyglutarate oxidase 0.9867 4 394 GO:0005737
GO:0016020
GO:0047545
AF-A0A4Q6EA30-F1-model_v4 L-2-hydroxyglutarate oxidase 0.9867 37 399 GO:0005737
GO:0047545
AF-A0A2E5KJ30-F1-model_v4 L-2-hydroxyglutarate oxidase 0.9865 6 400 GO:0005737
GO:0047545

Map