F453621

General Info

Members Datasets Scaffolds Average Seq Length
488 255 487 236

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10006285|Ga0265326_100062852
Length 265
Sequence MRGGEGVAMLPLVDLLTGCQGTGILLPIMRPDGRRPDELRAIRITPDCNRYAEGSALVEFGETKVICTATVENKVPPFLAGQGKGWVTAEYAMLPRSTHTRSGRNPGGRGQEIQRLIGRALRAAVRTAHMGERQLTVDCDVIQADGGTRTAAITGGWVALALALRRLVKSEKLAHDPLRRAVAALSVGLVSGEPRLDLAYEEDSAADVDFNFVMTDAGQFIEIQGTAEGEPFSADDYAKLVALASVGAKQLFALQQKALQAAKLP

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
224 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
242 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
251 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 0
Rhizoplane 3.69
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10025820 3300003323 Bacteria 2296
2 rootH1_10075755 3300003323 Bacteria 3149
3 Ga0070676_10004668 3300005328 Bacteria 7240
4 Ga0070683_100036195 3300005329 Bacteria 4515
5 Ga0070683_100051796 3300005329 Bacteria 3802
6 Ga0070683_100066433 3300005329 Bacteria 3359
7 Ga0070683_100464787 3300005329 Bacteria 1208
8 Ga0070690_100001477 3300005330 Bacteria 12294
9 Ga0070690_100031062 3300005330 Bacteria 3324
10 Ga0068869_100048363 3300005334 Bacteria 3075
11 Ga0068869_100069563 3300005334 Bacteria 2603
12 Ga0070666_10061823 3300005335 Bacteria 2536
13 Ga0070666_10063442 3300005335 Bacteria 2504
14 Ga0070680_100245441 3300005336 Bacteria 1514
15 Ga0070660_100226979 3300005339 Bacteria 1519
16 Ga0070689_100050455 3300005340 Bacteria 3215
17 Ga0070689_100070432 3300005340 Bacteria 2730
18 Ga0070689_100074759 3300005340 Bacteria 2651
19 Ga0070687_100028466 3300005343 Bacteria 2711
20 Ga0070687_100070819 3300005343 Bacteria 1872
21 Ga0070687_100095303 3300005343 Bacteria 1654
22 Ga0070692_10163335 3300005345 Bacteria 1278
23 Ga0070668_100041969 3300005347 Bacteria 3505
24 Ga0070669_100008655 3300005353 Bacteria 7261
25 Ga0070675_100080824 3300005354 Bacteria 2710
26 Ga0070674_100010856 3300005356 Bacteria 5524
27 Ga0070673_100012835 3300005364 Bacteria 5767
28 Ga0070673_100056597 3300005364 Bacteria 3095
29 Ga0070688_100027164 3300005365 Bacteria 3407
30 Ga0070688_100052489 3300005365 Bacteria 2547
31 Ga0070688_100082053 3300005365 Bacteria 2089
32 Ga0070688_100089134 3300005365 Bacteria 2012
33 Ga0070688_100289025 3300005365 Bacteria 1181
34 Ga0070659_100030758 3300005366 Bacteria 4155
35 Ga0070667_100113928 3300005367 Bacteria 2347
36 Ga0070667_100133589 3300005367 Bacteria 2168
37 Ga0070701_10271444 3300005438 Bacteria 1032
38 Ga0070711_100348720 3300005439 Bacteria 1190
39 Ga0070705_100422464 3300005440 Bacteria 993
40 Ga0070694_100119947 3300005444 Bacteria 1886
41 Ga0070678_100023296 3300005456 Bacteria 4124
42 Ga0070678_100618337 3300005456 Bacteria 969
43 Ga0068867_100177916 3300005459 Bacteria 1689
44 Ga0070685_10026282 3300005466 Bacteria 3208
45 Ga0070685_10202666 3300005466 Bacteria 1291
46 Ga0070706_100012807 3300005467 Bacteria 7763
47 Ga0070698_100000144 3300005471 Bacteria 64348
48 Ga0070679_100002895 3300005530 Bacteria 15590
49 Ga0070679_100009198 3300005530 Bacteria 9333
50 Ga0070679_100015171 3300005530 Bacteria 7404
51 Ga0070679_100052079 3300005530 Bacteria 4078
52 Ga0070679_100189877 3300005530 Bacteria 2024
53 Ga0070679_100211219 3300005530 Bacteria 1904
54 Ga0070679_100292356 3300005530 Bacteria 1580
55 Ga0070679_100314037 3300005530 Bacteria 1517
56 Ga0070679_100367565 3300005530 Bacteria 1385
57 Ga0070684_100001991 3300005535 Bacteria 15026
58 Ga0070684_100039273 3300005535 Bacteria 4070
59 Ga0070684_100081966 3300005535 Bacteria 2855
60 Ga0070684_100164171 3300005535 Bacteria 2016
61 Ga0070672_100015262 3300005543 Bacteria 5463
62 Ga0070686_100003953 3300005544 Bacteria 8151
63 Ga0070695_100772026 3300005545 Bacteria 768
64 Ga0070704_100083079 3300005549 Bacteria 2364
65 Ga0068855_100067635 3300005563 Bacteria 4160
66 Ga0068855_100105297 3300005563 Bacteria 3243
67 Ga0068857_100118924 3300005577 Bacteria 2378
68 Ga0068856_100125716 3300005614 Bacteria 2567
69 Ga0070702_100234540 3300005615 Bacteria 1235
70 Ga0068859_100627192 3300005617 Bacteria 1167
71 Ga0068864_100272615 3300005618 Bacteria 1577
72 Ga0068866_10008982 3300005718 Bacteria 4233
73 Ga0068861_100027708 3300005719 Bacteria 4130
74 Ga0068870_10274930 3300005840 Bacteria 1054
75 Ga0068863_100010122 3300005841 Bacteria 9169
76 Ga0068863_100015699 3300005841 Bacteria 7271
77 Ga0068863_100297701 3300005841 Bacteria 1565
78 Ga0068863_100432744 3300005841 Bacteria 1290
79 Ga0068858_100034376 3300005842 Bacteria 4701
80 Ga0068862_100008469 3300005844 Bacteria 8505
81 Ga0097621_100288595 3300006237 Bacteria 1446
82 Ga0075428_100618915 3300006844 Bacteria 1156
83 Ga0075430_100536250 3300006846 Bacteria 965
84 Ga0075434_100881464 3300006871 Bacteria 910
85 Ga0075429_100052297 3300006880 Bacteria 3554
86 Ga0075429_100094918 3300006880 Bacteria 2601
87 Ga0075429_100147562 3300006880 Bacteria 2059
88 Ga0068865_100096241 3300006881 Bacteria 2158
89 Ga0068865_100214092 3300006881 Bacteria 1503
90 Ga0097620_100627201 3300006931 Bacteria 1167
91 Ga0075435_100329425 3300007076 Bacteria 1307
92 Ga0105240_10001486 3300009093 Bacteria 39891
93 Ga0105240_10602786 3300009093 Bacteria 1209
94 Ga0111539_10043060 3300009094 Bacteria 5416
95 Ga0111539_10104133 3300009094 Bacteria 3330
96 Ga0105245_10000109 3300009098 Bacteria 79725
97 Ga0105243_10049514 3300009148 Bacteria 3315
98 Ga0105243_10149997 3300009148 Bacteria 1999
99 Ga0105242_10097405 3300009176 Bacteria 2487
100 Ga0105248_11079515 3300009177 Bacteria 907
101 Ga0105237_10000115 3300009545 Bacteria 112419
102 Ga0105237_10046527 3300009545 Bacteria 4364
103 Ga0105238_10006789 3300009551 Bacteria 11430
104 Ga0105238_10617950 3300009551 Bacteria 1092
105 Ga0105249_10068884 3300009553 Bacteria 3264
106 Ga0105249_10401187 3300009553 Bacteria 1402
107 Ga0157369_10249898 3300013105 Bacteria 1851
108 Ga0157374_10002646 3300013296 Bacteria 15081
109 Ga0157374_10541162 3300013296 Bacteria 1172
110 Ga0157378_10509428 3300013297 Bacteria 1203
111 Ga0157378_10563574 3300013297 Bacteria 1146
112 Ga0163163_10042319 3300014325 Bacteria 4461
113 Ga0157376_10206941 3300014969 Bacteria 1809
114 Ga0213876_10050627 3300021384 Bacteria 2195
115 Ga0224712_10049172 3300022467 Bacteria 1631
116 Ga0207697_10058353 3300025315 Bacteria 1603
117 Ga0207680_10055877 3300025903 Bacteria 2381
118 Ga0207680_10237142 3300025903 Bacteria 1256
119 Ga0207645_10003813 3300025907 Bacteria 11294
120 Ga0207705_10037466 3300025909 Bacteria 3470
121 Ga0207684_10012901 3300025910 Bacteria 7237
122 Ga0207707_10011043 3300025912 Bacteria 7859
123 Ga0207707_10020022 3300025912 Bacteria 5837
124 Ga0207707_10190338 3300025912 Bacteria 1790
125 Ga0207695_10016341 3300025913 Bacteria 8685
126 Ga0207671_10000335 3300025914 Bacteria 69222
127 Ga0207671_10262577 3300025914 Bacteria 1359
128 Ga0207693_10361401 3300025915 Bacteria 1136
129 Ga0207660_10141365 3300025917 Bacteria 1840
130 Ga0207660_10249195 3300025917 Bacteria 1401
131 Ga0207662_10011136 3300025918 Bacteria 4977
132 Ga0207662_10056880 3300025918 Bacteria 2337
133 Ga0207662_10223276 3300025918 Bacteria 1228
134 Ga0207662_10243282 3300025918 Bacteria 1178
135 Ga0207652_10002591 3300025921 Bacteria 15165
136 Ga0207652_10002880 3300025921 Bacteria 14391
137 Ga0207652_10012196 3300025921 Bacteria 6945
138 Ga0207652_10042840 3300025921 Bacteria 3854
139 Ga0207652_10174508 3300025921 Bacteria 1930
140 Ga0207652_10184194 3300025921 Bacteria 1877
141 Ga0207681_10001273 3300025923 Bacteria 16279
142 Ga0207694_10605837 3300025924 Bacteria 921
143 Ga0207650_10204581 3300025925 Bacteria 1583
144 Ga0207659_10072931 3300025926 Bacteria 2512
145 Ga0207687_10000200 3300025927 Bacteria 40532
146 Ga0207687_10049756 3300025927 Bacteria 2915
147 Ga0207700_10543644 3300025928 Bacteria 1030
148 Ga0207690_10120669 3300025932 Bacteria 1904
149 Ga0207709_10027014 3300025935 Bacteria 3302
150 Ga0207670_10025785 3300025936 Bacteria 3695
151 Ga0207670_10066349 3300025936 Bacteria 2479
152 Ga0207670_10096542 3300025936 Bacteria 2102
153 Ga0207669_10000958 3300025937 Bacteria 12241
154 Ga0207704_10165798 3300025938 Bacteria 1578
155 Ga0207691_10019235 3300025940 Bacteria 6464
156 Ga0207691_10035195 3300025940 Bacteria 4652
157 Ga0207691_10044092 3300025940 Bacteria 4107
158 Ga0207689_10027979 3300025942 Bacteria 4716
159 Ga0207689_10040320 3300025942 Bacteria 3866
160 Ga0207661_10046733 3300025944 Bacteria 3432
161 Ga0207661_10106562 3300025944 Bacteria 2363
162 Ga0207661_10424910 3300025944 Bacteria 1207
163 Ga0207661_10540108 3300025944 Bacteria 1067
164 Ga0207667_10208651 3300025949 Bacteria 2003
165 Ga0207651_10035716 3300025960 Bacteria 3236
166 Ga0207651_10036375 3300025960 Bacteria 3213
167 Ga0207651_10059968 3300025960 Bacteria 2638
168 Ga0207712_10024586 3300025961 Bacteria 3992
169 Ga0207677_10087900 3300026023 Bacteria 2252
170 Ga0207708_10008699 3300026075 Bacteria 7515
171 Ga0207702_10001021 3300026078 Bacteria 28735
172 Ga0207702_10012515 3300026078 Bacteria 7056
173 Ga0207641_10015629 3300026088 Bacteria 6220
174 Ga0207641_10061137 3300026088 Bacteria 3212
175 Ga0207641_10259602 3300026088 Bacteria 1626
176 Ga0207648_10010133 3300026089 Bacteria 8961
177 Ga0207676_10215386 3300026095 Bacteria 1707
178 Ga0207676_10252473 3300026095 Bacteria 1588
179 Ga0207674_10055869 3300026116 Bacteria 4011
180 Ga0207674_10134575 3300026116 Bacteria 2434
181 Ga0207674_10162463 3300026116 Bacteria 2188
182 Ga0207675_100026721 3300026118 Bacteria 5372
183 Ga0207675_100064816 3300026118 Bacteria 3415
184 Ga0207683_10010642 3300026121 Bacteria 7844
185 Ga0207683_10158806 3300026121 Bacteria 2043
186 Ga0268266_10000954 3300028379 Bacteria 36886
187 Ga0268264_10153244 3300028381 Bacteria 2069
188 Ga0265337_1006140 3300028556 Bacteria 4672
189 Ga0265326_10006285 3300028558 Bacteria 3703
190 Ga0265326_10020926 3300028558 Bacteria 1875
191 Ga0265326_10038909 3300028558 Bacteria 1351
192 Ga0265319_1008826 3300028563 Bacteria 4370
193 Ga0265319_1020062 3300028563 Bacteria 2485
194 Ga0265334_10038483 3300028573 Bacteria 1881
195 Ga0265318_10001419 3300028577 Bacteria 14168
196 Ga0265323_10000309 3300028653 Bacteria 28106
197 Ga0265323_10000856 3300028653 Bacteria 16193
198 Ga0265323_10002119 3300028653 Bacteria 9252
199 Ga0265323_10011886 3300028653 Bacteria 3500
200 Ga0265323_10024683 3300028653 Bacteria 2283
201 Ga0265323_10032084 3300028653 Bacteria 1950
202 Ga0265323_10044594 3300028653 Bacteria 1596
203 Ga0265322_10000306 3300028654 Bacteria 20716
204 Ga0265322_10011846 3300028654 Bacteria 2522
205 Ga0265322_10042636 3300028654 Bacteria 1292
206 Ga0265336_10026341 3300028666 Bacteria 1827
207 Ga0265336_10076622 3300028666 Bacteria 999
208 Ga0307517_10170041 3300028786 Bacteria 1435
209 Ga0307515_10007588 3300028794 Bacteria 21416
210 Ga0265338_10000365 3300028800 Bacteria 81425
211 Ga0265338_10003344 3300028800 Bacteria 22669
212 Ga0265338_10019190 3300028800 Bacteria 7276
213 Ga0265338_10027120 3300028800 Bacteria 5755
214 Ga0265338_10050852 3300028800 Bacteria 3740
215 Ga0265338_10074368 3300028800 Bacteria 2890
216 Ga0265338_10084297 3300028800 Bacteria 2654
217 Ga0265338_10095923 3300028800 Bacteria 2435
218 Ga0265324_10000399 3300029957 Bacteria 31271
219 Ga0265324_10011568 3300029957 Bacteria 3360
220 Ga0265324_10055559 3300029957 Bacteria 1357
221 Ga0265330_10000007 3300031235 Bacteria 208811
222 Ga0265330_10000497 3300031235 Bacteria 26301
223 Ga0265330_10001390 3300031235 Bacteria 14143
224 Ga0265330_10003461 3300031235 Bacteria 8242
225 Ga0265330_10006976 3300031235 Bacteria 5546
226 Ga0265330_10011634 3300031235 Bacteria 4123
227 Ga0265330_10012158 3300031235 Bacteria 4028
228 Ga0265330_10015498 3300031235 Bacteria 3525
229 Ga0265330_10018337 3300031235 Bacteria 3214
230 Ga0265330_10038306 3300031235 Bacteria 2131
231 Ga0265332_10000296 3300031238 Bacteria 38979
232 Ga0265332_10001712 3300031238 Bacteria 11954
233 Ga0265332_10007929 3300031238 Bacteria 4784
234 Ga0265332_10029024 3300031238 Bacteria 2420
235 Ga0265332_10038003 3300031238 Bacteria 2087
236 Ga0265332_10040523 3300031238 Bacteria 2017
237 Ga0265328_10000296 3300031239 Bacteria 23193
238 Ga0265328_10001755 3300031239 Bacteria 9916
239 Ga0265320_10000041 3300031240 Bacteria 129936
240 Ga0265320_10001464 3300031240 Bacteria 17242
241 Ga0265320_10009297 3300031240 Bacteria 5937
242 Ga0265320_10023579 3300031240 Bacteria 3272
243 Ga0265325_10005683 3300031241 Bacteria 7665
244 Ga0265325_10166197 3300031241 Bacteria 1035
245 Ga0265329_10000051 3300031242 Bacteria 50997
246 Ga0265329_10000426 3300031242 Bacteria 22256
247 Ga0265329_10008436 3300031242 Bacteria 3908
248 Ga0265329_10031425 3300031242 Bacteria 1724
249 Ga0265340_10001095 3300031247 Bacteria 15445
250 Ga0265340_10125103 3300031247 Bacteria 1181
251 Ga0265339_10000022 3300031249 Bacteria 171562
252 Ga0265339_10037532 3300031249 Bacteria 2707
253 Ga0265339_10042370 3300031249 Bacteria 2520
254 Ga0265339_10083737 3300031249 Bacteria 1682
255 Ga0265339_10199739 3300031249 Bacteria 987
256 Ga0265331_10000031 3300031250 Bacteria 213762
257 Ga0265331_10003525 3300031250 Bacteria 10054
258 Ga0265331_10005121 3300031250 Bacteria 7988
259 Ga0265331_10013904 3300031250 Bacteria 4305
260 Ga0265316_10000322 3300031344 Bacteria 53085
261 Ga0265316_10002089 3300031344 Bacteria 21002
262 Ga0265316_10002141 3300031344 Bacteria 20765
263 Ga0265316_10002313 3300031344 Bacteria 19915
264 Ga0265316_10013418 3300031344 Bacteria 7281
265 Ga0265316_10013973 3300031344 Bacteria 7100
266 Ga0265316_10014565 3300031344 Bacteria 6913
267 Ga0265316_10014576 3300031344 Bacteria 6912
268 Ga0265316_10018583 3300031344 Bacteria 5971
269 Ga0265316_10021198 3300031344 Bacteria 5511
270 Ga0265316_10290905 3300031344 Bacteria 1192
271 Ga0307513_10030051 3300031456 Bacteria 6178
272 Ga0307509_10000069 3300031507 Bacteria 141246
273 Ga0307509_10004839 3300031507 Bacteria 19133
274 Ga0307509_10079246 3300031507 Bacteria 3401
275 Ga0307509_10196251 3300031507 Bacteria 1862
276 Ga0265313_10001453 3300031595 Bacteria 22105
277 Ga0265313_10025362 3300031595 Bacteria 3143
278 Ga0265313_10057987 3300031595 Bacteria 1826
279 Ga0265313_10163159 3300031595 Bacteria 945
280 Ga0307508_10015293 3300031616 Bacteria 6992
281 Ga0265314_10000007 3300031711 Bacteria 491737
282 Ga0265314_10000021 3300031711 Bacteria 298390
283 Ga0265314_10002137 3300031711 Bacteria 20719
284 Ga0265314_10002626 3300031711 Bacteria 18133
285 Ga0265314_10013100 3300031711 Bacteria 6719
286 Ga0265314_10025635 3300031711 Bacteria 4443
287 Ga0265314_10062580 3300031711 Bacteria 2529
288 Ga0265342_10000326 3300031712 Bacteria 53802
289 Ga0265342_10000767 3300031712 Bacteria 32719
290 Ga0265342_10000775 3300031712 Bacteria 32449
291 Ga0265342_10001432 3300031712 Bacteria 22243
292 Ga0265342_10001955 3300031712 Bacteria 18430
293 Ga0265342_10002010 3300031712 Bacteria 18094
294 Ga0265342_10003656 3300031712 Bacteria 12501
295 Ga0265342_10037841 3300031712 Bacteria 2940
296 Ga0265342_10060436 3300031712 Bacteria 2234
297 Ga0265342_10133516 3300031712 Bacteria 1389
298 Ga0265342_10212156 3300031712 Bacteria 1046
299 Ga0316576_10031260 3300031727 Bacteria 3777
300 Ga0307516_10035646 3300031730 Bacteria 4988
301 Ga0307406_10082089 3300031901 Bacteria 2146
302 Ga0373950_0000004 3300034818 Bacteria 527382
303 Ga0373950_0000081 3300034818 Bacteria 32543
304 Ga0373934_0076101 3300035086 Bacteria 1346
305 Ga0373949_0000056 3300035090 Bacteria 42956
306 Ga0373936_0000042 3300035113 Bacteria 94182
307 Ga0373941_0201442 3300035115 Bacteria 757
308 Ga0373954_0061502 3300035118 Bacteria 1772
309 Ga0373956_0008746 3300035119 Bacteria 4102
310 Ga0373956_0054755 3300035119 Bacteria 1798
311 Ga0373956_0072468 3300035119 Bacteria 1573
312 Ga0373956_0269382 3300035119 Bacteria 810
313 Ga0373957_0008584 3300035120 Bacteria 3317
314 Ga0373957_0187319 3300035120 Bacteria 859
315 Ga0373943_0019089 3300035170 Bacteria 3152
316 Ga0373946_0077446 3300035171 Bacteria 1449
317 Ga0373955_0002906 3300035172 Bacteria 7519
318 Ga0373955_0008137 3300035172 Bacteria 4853
319 Ga0373955_0228959 3300035172 Bacteria 1111
320 Ga0373961_0000066 3300035241 Bacteria 57564
321 Ga0373935_0304139 3300035692 Bacteria 1128
322 Ga0373927_0096474 3300035695 Bacteria 1922
323 Ga0373933_0004826 3300035724 Bacteria 7367
324 Ga0373933_0010285 3300035724 Bacteria 5126
325 Ga0373933_0038590 3300035724 Bacteria 2807
326 Ga0373937_0003345 3300036401 Bacteria 13459
327 Ga0373937_0011770 3300036401 Bacteria 7675
328 Ga0373937_0019601 3300036401 Bacteria 6054
329 Ga0373937_0155991 3300036401 Bacteria 2139
330 Ga0373937_0215765 3300036401 Bacteria 1806
331 Ga0373925_0072007 3300037068 Bacteria 2615
332 Ga0373925_0204994 3300037068 Bacteria 1569
333 Ga0395899_0028166 3300037312 Bacteria 4230
334 Ga0395900_0031896 3300037418 Bacteria 5416
335 Ga0395898_0070182 3300037466 Bacteria 3388
336 Ga0395905_0123093 3300037471 Bacteria 2439
337 Ga0395905_0142315 3300037471 Bacteria 2256
338 Ga0395901_0020968 3300038443 Bacteria 6694
339 Ga0436365_1092473 3300039437 Bacteria 2177
340 Ga0436365_1868030 3300039437 Bacteria 4108
341 Ga0436361_0092287 3300039447 Bacteria 12403
342 Ga0451577_0019679 3300042876 Bacteria 6205
343 Ga0451577_0077231 3300042876 Bacteria 2969
344 Ga0466972_0127301 3300044658 Bacteria 1200
345 Ga0453683_0249532 3300044673 Bacteria 1131
346 Ga0466961_0178397 3300044693 Bacteria 1320
347 Ga0453684_0000001 3300044712 Bacteria 2623166
348 Ga0453684_0000207 3300044712 Bacteria 256144
349 Ga0453684_0005977 3300044712 Bacteria 23593
350 Ga0453684_0066776 3300044712 Bacteria 4578
351 Ga0453684_0156223 3300044712 Bacteria 2704
352 Ga0453684_0236755 3300044712 Bacteria 2104
353 Ga0453684_0398683 3300044712 Bacteria 1541
354 Ga0453684_0517002 3300044712 Bacteria 1320
355 Ga0466971_0033067 3300044719 Bacteria 2318
356 Ga0466970_0119378 3300044765 Bacteria 1444
357 Ga0451576_0009466 3300045051 Bacteria 11293
358 Ga0451576_0030211 3300045051 Bacteria 5795
359 Ga0451576_0142071 3300045051 Bacteria 2503
360 Ga0451576_0184109 3300045051 Bacteria 2181
361 Ga0466967_0009904 3300045976 Bacteria 7111
362 Ga0466967_0350881 3300045976 Bacteria 1428
363 Ga0466967_0620802 3300045976 Bacteria 1068
364 Ga0495651_0069629 3300046462 Bacteria 2679
365 Ga0495664_0053560 3300046477 Bacteria 2399
366 Ga0495607_0006472 3300046501 Bacteria 8241
367 Ga0495628_0014918 3300046516 Bacteria 6499
368 Ga0495628_0144207 3300046516 Bacteria 1816
369 Ga0495630_0017876 3300046517 Bacteria 5201
370 Ga0495666_0181865 3300046526 Bacteria 971
371 Ga0495652_0486706 3300046529 Bacteria 858
372 Ga0495586_0135066 3300046535 Bacteria 1382
373 Ga0495622_0073664 3300046557 Bacteria 1575
374 Ga0495622_0205242 3300046557 Bacteria 877
375 Ga0495634_0002690 3300046642 Bacteria 14611
376 Ga0495599_0200157 3300046678 Bacteria 1227
377 Ga0495646_0066029 3300046680 Bacteria 2141
378 Ga0495624_0211569 3300046690 Bacteria 1176
379 Ga0495649_0203207 3300046694 Bacteria 1028
380 Ga0495674_0018164 3300047319 Bacteria 6546
381 Ga0495674_0019183 3300047319 Bacteria 6353
382 Ga0495680_0146138 3300047322 Bacteria 1727
383 Ga0495675_0247358 3300047444 Bacteria 1072
384 Ga0495684_0076848 3300047471 Bacteria 2536
385 Ga0495684_0339992 3300047471 Bacteria 1068
386 Ga0495686_0017588 3300047472 Bacteria 4811
387 Ga0495686_0063522 3300047472 Bacteria 2288
388 Ga0495602_0123906 3300048088 Bacteria 2074
389 Ga0495602_0284295 3300048088 Bacteria 1217
390 Ga0496100_0017774 3300048903 Bacteria 4206
391 Ga0496101_0075635 3300048904 Bacteria 2479
392 Ga0496101_0318084 3300048904 Bacteria 1221
393 Ga0496104_0597061 3300048907 Bacteria 1014
394 Ga0496107_0234445 3300048910 Bacteria 1366
395 Ga0496108_0019626 3300048911 Bacteria 5553
396 Ga0496108_0217729 3300048911 Bacteria 1659
397 Ga0496109_0114651 3300048912 Bacteria 2507
398 Ga0496112_0045530 3300048915 Bacteria 4301
399 Ga0496112_0675125 3300048915 Bacteria 962
400 Ga0496114_0002135 3300048917 Bacteria 15030
401 Ga0496114_0004055 3300048917 Bacteria 11312
402 Ga0496114_0010276 3300048917 Bacteria 7448
403 Ga0496114_0025451 3300048917 Bacteria 4838
404 Ga0496115_0040048 3300048918 Bacteria 3724
405 Ga0496115_0145915 3300048918 Bacteria 1953
406 Ga0496115_0229524 3300048918 Bacteria 1531
407 Ga0496115_0667309 3300048918 Bacteria 820
408 Ga0501033_0002913 3300049570 Bacteria 14316
409 Ga0501034_0000009 3300049571 Bacteria 336590
410 Ga0501036_0012881 3300049572 Bacteria 6943
411 Ga0501036_0085235 3300049572 Bacteria 2670
412 Ga0501037_0023526 3300049573 Bacteria 4556
413 Ga0501038_0054779 3300049574 Bacteria 3429
414 Ga0501038_0112923 3300049574 Bacteria 2249
415 Ga0501043_0000619 3300049579 Bacteria 31331
416 Ga0501043_0581431 3300049579 Bacteria 829
417 Ga0501046_0000219 3300049580 Bacteria 59638
418 Ga0501046_0024137 3300049580 Bacteria 4993
419 Ga0501047_0000006 3300049581 Bacteria 455727
420 Ga0501047_0009416 3300049581 Bacteria 9228
421 Ga0501047_0064204 3300049581 Bacteria 3541
422 Ga0501047_0342859 3300049581 Bacteria 1331
423 Ga0501048_0001853 3300049582 Bacteria 16046
424 Ga0501048_0494167 3300049582 Bacteria 877
425 Ga0501067_0000571 3300049583 Bacteria 19941
426 Ga0501067_0027189 3300049583 Bacteria 3169
427 Ga0501067_0153225 3300049583 Bacteria 1284
428 Ga0501068_0000309 3300049584 Bacteria 24458
429 Ga0501069_0110142 3300049585 Bacteria 1567
430 Ga0501070_0001307 3300049586 Bacteria 22334
431 Ga0501070_0026399 3300049586 Bacteria 4871
432 Ga0501070_0032666 3300049586 Bacteria 4356
433 Ga0501072_0000484 3300049588 Bacteria 28573
434 Ga0501073_0000104 3300049589 Bacteria 53927
435 Ga0501073_0005718 3300049589 Bacteria 9302
436 Ga0501073_0007032 3300049589 Bacteria 8383
437 Ga0501073_0024221 3300049589 Bacteria 4358
438 Ga0501074_0000426 3300049590 Bacteria 25176
439 Ga0501074_0161063 3300049590 Bacteria 1603
440 Ga0501077_0210129 3300049593 Bacteria 1237
441 Ga0501216_001090 3300049660 Bacteria 3539
442 Ga0501227_000190 3300049665 Bacteria 12175
443 Ga0501230_018118 3300049667 Bacteria 1199
444 Ga0501225_0019229 3300049705 Bacteria 1891
445 Ga0501079_0000007 3300049741 Bacteria 76508
446 Ga0501080_0000465 3300049742 Bacteria 31424
447 Ga0501080_0256942 3300049742 Bacteria 1592
448 Ga0501081_0208353 3300049743 Bacteria 1419
449 Ga0501083_0000156 3300049744 Bacteria 45386
450 Ga0501083_0001072 3300049744 Bacteria 18258
451 Ga0501083_0242506 3300049744 Bacteria 1173
452 Ga0501035_0224935 3300049822 Bacteria 1601
453 Ga0501044_0009718 3300049823 Bacteria 10463
454 Ga0501044_0130945 3300049823 Bacteria 2502
455 Ga0501044_0293085 3300049823 Bacteria 1558
456 nmdc:mga09592_76988_c1 3300050508 Bacteria 2837
457 nmdc:mga09592_8432_c1 3300050508 Bacteria 8379
458 nmdc:mga0qj67_479498_c1 3300050509 Bacteria 1001
459 nmdc:mga08y16_75053_c1 3300050511 Bacteria 3525
460 nmdc:mga08y16_98172_c1 3300050511 Bacteria 3050
461 nmdc:mga0rr50_25417_c1 3300050513 Bacteria 4116
462 Ga0495601_0217606 3300053077 Bacteria 1247
463 Ga0500635_0026635 3300053080 Bacteria 1831
464 Ga0495619_0166203 3300053085 Bacteria 1525
465 Ga0500578_0082463 3300053086 Bacteria 2044
466 Ga0500578_0179326 3300053086 Bacteria 1306
467 Ga0500566_0001520 3300053094 Bacteria 13619
468 Ga0500566_0010357 3300053094 Bacteria 5498
469 Ga0500566_0044344 3300053094 Bacteria 2562
470 Ga0500640_000132 3300053095 Bacteria 14428
471 Ga0500554_000048 3300053102 Bacteria 21032
472 Ga0500572_001013 3300053111 Bacteria 8471
473 Ga0500595_000261 3300053119 Bacteria 34894
474 Ga0500597_040053 3300053120 Bacteria 1967
475 Ga0500614_000201 3300053123 Bacteria 15680
476 Ga0500614_002218 3300053123 Bacteria 4396
477 Ga0500642_0179281 3300053130 Bacteria 990
478 Ga0500559_0054190 3300053136 Bacteria 1776
479 Ga0500568_0023365 3300053139 Bacteria 2630
480 Ga0500603_003644 3300053150 Bacteria 3298
481 Ga0500630_098248 3300053159 Bacteria 1339
482 Ga0500638_061737 3300053162 Bacteria 1800
483 Ga0500636_0106697 3300053177 Bacteria 1587
484 Ga0501084_0000019 3300054114 Bacteria 146907
485 Ga0501084_0455983 3300054114 Bacteria 1081
486 Ga0501082_0000310 3300060353 Bacteria 43373
487 Ga0501082_0010831 3300060353 Bacteria 7853

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0178397 Ga0466961_0178397_24_653 209
2 3300025924 Ga0207694_10605837 Ga0207694_106058371 212
3 3300006871 Ga0075434_100881464 Ga0075434_1008814641 214
4 3300028800 Ga0265338_10019190 Ga0265338_100191902 214
5 3300031247 Ga0265340_10125103 Ga0265340_101251031 218
6 3300031249 Ga0265339_10083737 Ga0265339_100837372 218
7 3300031344 Ga0265316_10290905 Ga0265316_102909052 218
8 3300053094 Ga0500566_0001520 Ga0500566_0001520_1064_1765 218
9 3300053095 Ga0500640_000132 Ga0500640_000132_4649_5350 218
10 3300053102 Ga0500554_000048 Ga0500554_000048_19952_20653 218
11 3300053111 Ga0500572_001013 Ga0500572_001013_718_1419 218
12 3300053119 Ga0500595_000261 Ga0500595_000261_12673_13374 218
13 3300053123 Ga0500614_000201 Ga0500614_000201_13795_14496 218
14 3300053136 Ga0500559_0054190 Ga0500559_0054190_333_1034 218
15 3300009551 Ga0105238_10006789 Ga0105238_1000678911 219
16 3300013105 Ga0157369_10249898 Ga0157369_102498982 220
17 3300046557 Ga0495622_0073664 Ga0495622_0073664_42_743 221
18 3300053120 Ga0500597_040053 Ga0500597_040053_703_1404 221
19 3300053123 Ga0500614_002218 Ga0500614_002218_2824_3525 221
20 3300053162 Ga0500638_061737 Ga0500638_061737_748_1449 221
21 3300005345 Ga0070692_10163335 Ga0070692_101633352 222
22 3300005466 Ga0070685_10202666 Ga0070685_102026662 222
23 3300022467 Ga0224712_10049172 Ga0224712_100491722 222
24 3300044712 Ga0453684_0005977 Ga0453684_0005977_15855_16529 223
25 3300053086 Ga0500578_0082463 Ga0500578_0082463_762_1475 224
26 3300028556 Ga0265337_1006140 Ga0265337_10061403 225
27 3300028558 Ga0265326_10020926 Ga0265326_100209262 225
28 3300031235 Ga0265330_10006976 Ga0265330_100069765 225
29 3300031238 Ga0265332_10029024 Ga0265332_100290242 225
30 3300031241 Ga0265325_10005683 Ga0265325_100056836 225
31 3300031242 Ga0265329_10031425 Ga0265329_100314252 225
32 3300031247 Ga0265340_10001095 Ga0265340_1000109512 225
33 3300031250 Ga0265331_10013904 Ga0265331_100139046 225
34 3300031344 Ga0265316_10014576 Ga0265316_100145762 225
35 3300031711 Ga0265314_10000007 Ga0265314_10000007308 225
36 3300031712 Ga0265342_10000775 Ga0265342_1000077527 225
37 3300049570 Ga0501033_0002913 Ga0501033_0002913_9808_10560 227
38 3300049573 Ga0501037_0023526 Ga0501037_0023526_1235_1987 227
39 3300049574 Ga0501038_0054779 Ga0501038_0054779_2579_3331 227
40 3300049579 Ga0501043_0581431 Ga0501043_0581431_40_729 227
41 3300049580 Ga0501046_0024137 Ga0501046_0024137_1703_2455 227
42 3300049581 Ga0501047_0064204 Ga0501047_0064204_2339_3091 227
43 3300049582 Ga0501048_0494167 Ga0501048_0494167_37_789 227
44 3300049823 Ga0501044_0130945 Ga0501044_0130945_399_1151 227
45 3300048918 Ga0496115_0229524 Ga0496115_0229524_803_1513 228
46 3300013296 Ga0157374_10541162 Ga0157374_105411622 229
47 3300045976 Ga0466967_0350881 Ga0466967_0350881_615_1325 229
48 3300048907 Ga0496104_0597061 Ga0496104_0597061_98_808 229
49 3300048917 Ga0496114_0010276 Ga0496114_0010276_2063_2773 229
50 3300048918 Ga0496115_0667309 Ga0496115_0667309_59_769 229
51 3300005366 Ga0070659_100030758 Ga0070659_1000307583 230
52 3300005530 Ga0070679_100052079 Ga0070679_1000520793 230
53 3300005563 Ga0068855_100105297 Ga0068855_1001052974 230
54 3300005577 Ga0068857_100118924 Ga0068857_1001189243 230
55 3300009093 Ga0105240_10001486 Ga0105240_1000148627 230
56 3300009545 Ga0105237_10000115 Ga0105237_1000011534 230
57 3300025909 Ga0207705_10037466 Ga0207705_100374665 230
58 3300025913 Ga0207695_10016341 Ga0207695_100163417 230
59 3300025914 Ga0207671_10000335 Ga0207671_1000033516 230
60 3300025921 Ga0207652_10002880 Ga0207652_100028807 230
61 3300025932 Ga0207690_10120669 Ga0207690_101206692 230
62 3300026116 Ga0207674_10134575 Ga0207674_101345753 230
63 3300035115 Ga0373941_0201442 Ga0373941_0201442_27_722 230
64 3300046477 Ga0495664_0053560 Ga0495664_0053560_209_994 230
65 3300046516 Ga0495628_0144207 Ga0495628_0144207_698_1483 230
66 3300046526 Ga0495666_0181865 Ga0495666_0181865_35_820 230
67 3300046678 Ga0495599_0200157 Ga0495599_0200157_107_892 230
68 3300046680 Ga0495646_0066029 Ga0495646_0066029_1117_1902 230
69 3300046690 Ga0495624_0211569 Ga0495624_0211569_114_899 230
70 3300047319 Ga0495674_0019183 Ga0495674_0019183_563_1348 230
71 3300047444 Ga0495675_0247358 Ga0495675_0247358_251_1036 230
72 3300047471 Ga0495684_0076848 Ga0495684_0076848_1727_2512 230
73 3300048088 Ga0495602_0284295 Ga0495602_0284295_275_1060 230
74 3300005329 Ga0070683_100051796 Ga0070683_1000517963 231
75 3300005330 Ga0070690_100031062 Ga0070690_1000310622 231
76 3300005334 Ga0068869_100048363 Ga0068869_1000483632 231
77 3300005334 Ga0068869_100069563 Ga0068869_1000695634 231
78 3300005336 Ga0070680_100245441 Ga0070680_1002454412 231
79 3300005340 Ga0070689_100050455 Ga0070689_1000504552 231
80 3300005365 Ga0070688_100052489 Ga0070688_1000524892 231
81 3300005365 Ga0070688_100289025 Ga0070688_1002890252 231
82 3300005438 Ga0070701_10271444 Ga0070701_102714442 231
83 3300005456 Ga0070678_100023296 Ga0070678_1000232963 231
84 3300005530 Ga0070679_100015171 Ga0070679_1000151714 231
85 3300005530 Ga0070679_100189877 Ga0070679_1001898772 231
86 3300005530 Ga0070679_100314037 Ga0070679_1003140372 231
87 3300005535 Ga0070684_100039273 Ga0070684_1000392733 231
88 3300005545 Ga0070695_100772026 Ga0070695_1007720261 231
89 3300005614 Ga0068856_100125716 Ga0068856_1001257163 231
90 3300005840 Ga0068870_10274930 Ga0068870_102749302 231
91 3300005841 Ga0068863_100010122 Ga0068863_1000101226 231
92 3300005841 Ga0068863_100297701 Ga0068863_1002977012 231
93 3300009098 Ga0105245_10000109 Ga0105245_1000010971 231
94 3300009148 Ga0105243_10049514 Ga0105243_100495142 231
95 3300009177 Ga0105248_11079515 Ga0105248_110795152 231
96 3300009551 Ga0105238_10617950 Ga0105238_106179502 231
97 3300009553 Ga0105249_10401187 Ga0105249_104011872 231
98 3300013296 Ga0157374_10002646 Ga0157374_100026465 231
99 3300013297 Ga0157378_10563574 Ga0157378_105635741 231
100 3300021384 Ga0213876_10050627 Ga0213876_100506273 231
101 3300025917 Ga0207660_10249195 Ga0207660_102491952 231
102 3300025921 Ga0207652_10042840 Ga0207652_100428407 231
103 3300025921 Ga0207652_10174508 Ga0207652_101745082 231
104 3300025927 Ga0207687_10000200 Ga0207687_100002008 231
105 3300025927 Ga0207687_10049756 Ga0207687_100497563 231
106 3300025935 Ga0207709_10027014 Ga0207709_100270143 231
107 3300025942 Ga0207689_10027979 Ga0207689_100279792 231
108 3300025942 Ga0207689_10040320 Ga0207689_100403205 231
109 3300025944 Ga0207661_10106562 Ga0207661_101065622 231
110 3300025961 Ga0207712_10024586 Ga0207712_100245864 231
111 3300026078 Ga0207702_10012515 Ga0207702_100125157 231
112 3300026088 Ga0207641_10015629 Ga0207641_100156292 231
113 3300026088 Ga0207641_10259602 Ga0207641_102596022 231
114 3300026095 Ga0207676_10252473 Ga0207676_102524732 231
115 3300026118 Ga0207675_100064816 Ga0207675_1000648162 231
116 3300026121 Ga0207683_10010642 Ga0207683_100106428 231
117 3300028786 Ga0307517_10170041 Ga0307517_101700411 231
118 3300028794 Ga0307515_10007588 Ga0307515_100075882 231
119 3300031238 Ga0265332_10007929 Ga0265332_100079294 231
120 3300031507 Ga0307509_10000069 Ga0307509_10000069129 231
121 3300031507 Ga0307509_10004839 Ga0307509_100048397 231
122 3300031507 Ga0307509_10079246 Ga0307509_100792462 231
123 3300031507 Ga0307509_10196251 Ga0307509_101962512 231
124 3300031616 Ga0307508_10015293 Ga0307508_100152933 231
125 3300031730 Ga0307516_10035646 Ga0307516_100356462 231
126 3300031901 Ga0307406_10082089 Ga0307406_100820892 231
127 3300035090 Ga0373949_0000056 Ga0373949_0000056_40860_41561 231
128 3300035119 Ga0373956_0054755 Ga0373956_0054755_546_1247 231
129 3300035241 Ga0373961_0000066 Ga0373961_0000066_43541_44242 231
130 3300037312 Ga0395899_0028166 Ga0395899_0028166_825_1526 231
131 3300037418 Ga0395900_0031896 Ga0395900_0031896_1744_2445 231
132 3300037466 Ga0395898_0070182 Ga0395898_0070182_1519_2220 231
133 3300037471 Ga0395905_0123093 Ga0395905_0123093_1607_2308 231
134 3300037471 Ga0395905_0142315 Ga0395905_0142315_1236_1937 231
135 3300038443 Ga0395901_0020968 Ga0395901_0020968_5038_5739 231
136 3300039437 Ga0436365_1092473 Ga0436365_1092473_222_923 231
137 3300039437 Ga0436365_1868030 Ga0436365_1868030_2710_3411 231
138 3300045976 Ga0466967_0620802 Ga0466967_0620802_186_887 231
139 3300046694 Ga0495649_0203207 Ga0495649_0203207_144_845 231
140 3300048915 Ga0496112_0675125 Ga0496112_0675125_201_902 231
141 3300049581 Ga0501047_0009416 Ga0501047_0009416_2128_2829 231
142 3300049581 Ga0501047_0342859 Ga0501047_0342859_536_1237 231
143 3300049586 Ga0501070_0032666 Ga0501070_0032666_1258_1959 231
144 3300049593 Ga0501077_0210129 Ga0501077_0210129_327_1025 231
145 3300049822 Ga0501035_0224935 Ga0501035_0224935_350_1051 231
146 3300049823 Ga0501044_0009718 Ga0501044_0009718_5288_5989 231
147 3300049823 Ga0501044_0293085 Ga0501044_0293085_147_848 231
148 3300053080 Ga0500635_0026635 Ga0500635_0026635_943_1644 231
149 3300053086 Ga0500578_0179326 Ga0500578_0179326_165_866 231
150 3300053094 Ga0500566_0010357 Ga0500566_0010357_2508_3209 231
151 3300053094 Ga0500566_0044344 Ga0500566_0044344_1484_2185 231
152 3300053130 Ga0500642_0179281 Ga0500642_0179281_155_856 231
153 3300053139 Ga0500568_0023365 Ga0500568_0023365_1283_1984 231
154 3300053150 Ga0500603_003644 Ga0500603_003644_194_895 231
155 3300053159 Ga0500630_098248 Ga0500630_098248_375_1076 231
156 3300053177 Ga0500636_0106697 Ga0500636_0106697_314_1015 231
157 3300005467 Ga0070706_100012807 Ga0070706_1000128076 232
158 3300005471 Ga0070698_100000144 Ga0070698_1000001442 232
159 3300006844 Ga0075428_100618915 Ga0075428_1006189152 232
160 3300006880 Ga0075429_100147562 Ga0075429_1001475622 232
161 3300007076 Ga0075435_100329425 Ga0075435_1003294252 232
162 3300025910 Ga0207684_10012901 Ga0207684_100129014 232
163 3300025936 Ga0207670_10066349 Ga0207670_100663493 232
164 3300028800 Ga0265338_10027120 Ga0265338_100271202 232
165 3300044712 Ga0453684_0517002 Ga0453684_0517002_78_782 232
166 3300049660 Ga0501216_001090 Ga0501216_001090_1643_2347 232
167 3300049665 Ga0501227_000190 Ga0501227_000190_10684_11388 232
168 3300049667 Ga0501230_018118 Ga0501230_018118_55_759 232
169 3300049705 Ga0501225_0019229 Ga0501225_0019229_374_1078 232
170 3300050513 nmdc:mga0rr50_25417_c1 nmdc:mga0rr50_25417_c1_2939_3643 232
171 3300054114 Ga0501084_0455983 Ga0501084_0455983_255_959 232
172 3300006880 Ga0075429_100052297 Ga0075429_1000522973 233
173 3300014969 Ga0157376_10206941 Ga0157376_102069412 233
174 3300028379 Ga0268266_10000954 Ga0268266_1000095410 233
175 3300031456 Ga0307513_10030051 Ga0307513_100300517 233
176 3300035113 Ga0373936_0000042 Ga0373936_0000042_37089_37796 233
177 3300050508 nmdc:mga09592_8432_c1 nmdc:mga09592_8432_c1_5089_5796 233
178 3300005328 Ga0070676_10004668 Ga0070676_100046688 235
179 3300005329 Ga0070683_100036195 Ga0070683_1000361952 235
180 3300005329 Ga0070683_100066433 Ga0070683_1000664331 235
181 3300005329 Ga0070683_100464787 Ga0070683_1004647871 235
182 3300005330 Ga0070690_100001477 Ga0070690_1000014774 235
183 3300005335 Ga0070666_10061823 Ga0070666_100618232 235
184 3300005335 Ga0070666_10063442 Ga0070666_100634422 235
185 3300005339 Ga0070660_100226979 Ga0070660_1002269792 235
186 3300005340 Ga0070689_100070432 Ga0070689_1000704323 235
187 3300005340 Ga0070689_100074759 Ga0070689_1000747594 235
188 3300005343 Ga0070687_100070819 Ga0070687_1000708192 235
189 3300005343 Ga0070687_100095303 Ga0070687_1000953032 235
190 3300005347 Ga0070668_100041969 Ga0070668_1000419692 235
191 3300005353 Ga0070669_100008655 Ga0070669_1000086558 235
192 3300005354 Ga0070675_100080824 Ga0070675_1000808241 235
193 3300005356 Ga0070674_100010856 Ga0070674_1000108567 235
194 3300005364 Ga0070673_100012835 Ga0070673_1000128354 235
195 3300005364 Ga0070673_100056597 Ga0070673_1000565974 235
196 3300005365 Ga0070688_100027164 Ga0070688_1000271644 235
197 3300005365 Ga0070688_100082053 Ga0070688_1000820532 235
198 3300005365 Ga0070688_100089134 Ga0070688_1000891342 235
199 3300005367 Ga0070667_100113928 Ga0070667_1001139282 235
200 3300005367 Ga0070667_100133589 Ga0070667_1001335892 235
201 3300005439 Ga0070711_100348720 Ga0070711_1003487202 235
202 3300005444 Ga0070694_100119947 Ga0070694_1001199473 235
203 3300005456 Ga0070678_100618337 Ga0070678_1006183371 235
204 3300005459 Ga0068867_100177916 Ga0068867_1001779162 235
205 3300005466 Ga0070685_10026282 Ga0070685_100262822 235
206 3300005530 Ga0070679_100009198 Ga0070679_1000091985 235
207 3300005530 Ga0070679_100367565 Ga0070679_1003675652 235
208 3300005535 Ga0070684_100001991 Ga0070684_10000199110 235
209 3300005535 Ga0070684_100164171 Ga0070684_1001641712 235
210 3300005543 Ga0070672_100015262 Ga0070672_1000152625 235
211 3300005544 Ga0070686_100003953 Ga0070686_1000039537 235
212 3300005563 Ga0068855_100067635 Ga0068855_1000676356 235
213 3300005617 Ga0068859_100627192 Ga0068859_1006271922 235
214 3300005718 Ga0068866_10008982 Ga0068866_100089825 235
215 3300005719 Ga0068861_100027708 Ga0068861_1000277086 235
216 3300005841 Ga0068863_100015699 Ga0068863_1000156996 235
217 3300005842 Ga0068858_100034376 Ga0068858_1000343762 235
218 3300005844 Ga0068862_100008469 Ga0068862_1000084693 235
219 3300006237 Ga0097621_100288595 Ga0097621_1002885952 235
220 3300006881 Ga0068865_100096241 Ga0068865_1000962414 235
221 3300006881 Ga0068865_100214092 Ga0068865_1002140922 235
222 3300006931 Ga0097620_100627201 Ga0097620_1006272012 235
223 3300009093 Ga0105240_10602786 Ga0105240_106027861 235
224 3300009094 Ga0111539_10043060 Ga0111539_100430602 235
225 3300009148 Ga0105243_10149997 Ga0105243_101499972 235
226 3300009176 Ga0105242_10097405 Ga0105242_100974051 235
227 3300009553 Ga0105249_10068884 Ga0105249_100688844 235
228 3300013297 Ga0157378_10509428 Ga0157378_105094282 235
229 3300025315 Ga0207697_10058353 Ga0207697_100583532 235
230 3300025903 Ga0207680_10055877 Ga0207680_100558772 235
231 3300025903 Ga0207680_10237142 Ga0207680_102371422 235
232 3300025907 Ga0207645_10003813 Ga0207645_100038137 235
233 3300025915 Ga0207693_10361401 Ga0207693_103614011 235
234 3300025918 Ga0207662_10011136 Ga0207662_100111367 235
235 3300025918 Ga0207662_10223276 Ga0207662_102232762 235
236 3300025918 Ga0207662_10243282 Ga0207662_102432822 235
237 3300025921 Ga0207652_10012196 Ga0207652_100121965 235
238 3300025923 Ga0207681_10001273 Ga0207681_1000127310 235
239 3300025925 Ga0207650_10204581 Ga0207650_102045812 235
240 3300025926 Ga0207659_10072931 Ga0207659_100729311 235
241 3300025928 Ga0207700_10543644 Ga0207700_105436441 235
242 3300025936 Ga0207670_10025785 Ga0207670_100257854 235
243 3300025936 Ga0207670_10096542 Ga0207670_100965422 235
244 3300025937 Ga0207669_10000958 Ga0207669_100009587 235
245 3300025938 Ga0207704_10165798 Ga0207704_101657982 235
246 3300025940 Ga0207691_10019235 Ga0207691_100192356 235
247 3300025940 Ga0207691_10035195 Ga0207691_100351955 235
248 3300025940 Ga0207691_10044092 Ga0207691_100440922 235
249 3300025944 Ga0207661_10046733 Ga0207661_100467332 235
250 3300025944 Ga0207661_10424910 Ga0207661_104249102 235
251 3300025949 Ga0207667_10208651 Ga0207667_102086512 235
252 3300025960 Ga0207651_10035716 Ga0207651_100357162 235
253 3300025960 Ga0207651_10036375 Ga0207651_100363752 235
254 3300025960 Ga0207651_10059968 Ga0207651_100599684 235
255 3300026023 Ga0207677_10087900 Ga0207677_100879002 235
256 3300026075 Ga0207708_10008699 Ga0207708_100086992 235
257 3300026088 Ga0207641_10061137 Ga0207641_100611372 235
258 3300026089 Ga0207648_10010133 Ga0207648_100101333 235
259 3300026095 Ga0207676_10215386 Ga0207676_102153862 235
260 3300026118 Ga0207675_100026721 Ga0207675_1000267211 235
261 3300026121 Ga0207683_10158806 Ga0207683_101588062 235
262 3300028381 Ga0268264_10153244 Ga0268264_101532442 235
263 3300028558 Ga0265326_10038909 Ga0265326_100389092 235
264 3300028563 Ga0265319_1020062 Ga0265319_10200622 235
265 3300028577 Ga0265318_10001419 Ga0265318_1000141911 235
266 3300028666 Ga0265336_10076622 Ga0265336_100766221 235
267 3300028800 Ga0265338_10050852 Ga0265338_100508522 235
268 3300029957 Ga0265324_10000399 Ga0265324_1000039921 235
269 3300029957 Ga0265324_10011568 Ga0265324_100115684 235
270 3300031235 Ga0265330_10011634 Ga0265330_100116344 235
271 3300031235 Ga0265330_10018337 Ga0265330_100183374 235
272 3300031238 Ga0265332_10001712 Ga0265332_1000171210 235
273 3300031239 Ga0265328_10000296 Ga0265328_1000029618 235
274 3300031239 Ga0265328_10001755 Ga0265328_100017553 235
275 3300031240 Ga0265320_10001464 Ga0265320_100014647 235
276 3300031240 Ga0265320_10023579 Ga0265320_100235792 235
277 3300031241 Ga0265325_10166197 Ga0265325_101661971 235
278 3300031242 Ga0265329_10008436 Ga0265329_100084363 235
279 3300031249 Ga0265339_10000022 Ga0265339_1000002223 235
280 3300031249 Ga0265339_10037532 Ga0265339_100375322 235
281 3300031249 Ga0265339_10042370 Ga0265339_100423701 235
282 3300031250 Ga0265331_10003525 Ga0265331_100035259 235
283 3300031344 Ga0265316_10002141 Ga0265316_1000214114 235
284 3300031595 Ga0265313_10025362 Ga0265313_100253622 235
285 3300031595 Ga0265313_10163159 Ga0265313_101631592 235
286 3300031711 Ga0265314_10002137 Ga0265314_1000213716 235
287 3300031711 Ga0265314_10002626 Ga0265314_100026264 235
288 3300031711 Ga0265314_10013100 Ga0265314_100131009 235
289 3300031711 Ga0265314_10025635 Ga0265314_100256352 235
290 3300031712 Ga0265342_10000326 Ga0265342_100003269 235
291 3300031712 Ga0265342_10000767 Ga0265342_100007679 235
292 3300031712 Ga0265342_10212156 Ga0265342_102121561 235
293 3300031727 Ga0316576_10031260 Ga0316576_100312603 235
294 3300034818 Ga0373950_0000081 Ga0373950_0000081_1300_2016 235
295 3300035118 Ga0373954_0061502 Ga0373954_0061502_239_961 235
296 3300035119 Ga0373956_0072468 Ga0373956_0072468_21_731 235
297 3300035119 Ga0373956_0269382 Ga0373956_0269382_37_759 235
298 3300035170 Ga0373943_0019089 Ga0373943_0019089_108_818 235
299 3300035172 Ga0373955_0008137 Ga0373955_0008137_2225_2947 235
300 3300035172 Ga0373955_0228959 Ga0373955_0228959_279_1028 235
301 3300035692 Ga0373935_0304139 Ga0373935_0304139_43_759 235
302 3300035695 Ga0373927_0096474 Ga0373927_0096474_1112_1822 235
303 3300035724 Ga0373933_0004826 Ga0373933_0004826_2217_2933 235
304 3300035724 Ga0373933_0010285 Ga0373933_0010285_2837_3559 235
305 3300035724 Ga0373933_0038590 Ga0373933_0038590_1910_2620 235
306 3300036401 Ga0373937_0003345 Ga0373937_0003345_8613_9329 235
307 3300036401 Ga0373937_0019601 Ga0373937_0019601_2765_3487 235
308 3300036401 Ga0373937_0155991 Ga0373937_0155991_918_1628 235
309 3300036401 Ga0373937_0215765 Ga0373937_0215765_297_1007 235
310 3300037068 Ga0373925_0072007 Ga0373925_0072007_1622_2332 235
311 3300042876 Ga0451577_0019679 Ga0451577_0019679_3583_4293 235
312 3300044673 Ga0453683_0249532 Ga0453683_0249532_102_812 235
313 3300044712 Ga0453684_0000207 Ga0453684_0000207_109308_110018 235
314 3300044712 Ga0453684_0156223 Ga0453684_0156223_201_911 235
315 3300045051 Ga0451576_0142071 Ga0451576_0142071_412_1122 235
316 3300046557 Ga0495622_0205242 Ga0495622_0205242_49_804 235
317 3300047322 Ga0495680_0146138 Ga0495680_0146138_264_986 235
318 3300047471 Ga0495684_0339992 Ga0495684_0339992_129_839 235
319 3300047472 Ga0495686_0017588 Ga0495686_0017588_2761_3474 235
320 3300048903 Ga0496100_0017774 Ga0496100_0017774_2363_3073 235
321 3300048904 Ga0496101_0075635 Ga0496101_0075635_1391_2101 235
322 3300048904 Ga0496101_0318084 Ga0496101_0318084_53_763 235
323 3300048911 Ga0496108_0019626 Ga0496108_0019626_4400_5110 235
324 3300048911 Ga0496108_0217729 Ga0496108_0217729_76_786 235
325 3300048912 Ga0496109_0114651 Ga0496109_0114651_1774_2484 235
326 3300048915 Ga0496112_0045530 Ga0496112_0045530_3179_3889 235
327 3300048917 Ga0496114_0004055 Ga0496114_0004055_6800_7510 235
328 3300048917 Ga0496114_0025451 Ga0496114_0025451_3922_4638 235
329 3300048918 Ga0496115_0040048 Ga0496115_0040048_1453_2163 235
330 3300049571 Ga0501034_0000009 Ga0501034_0000009_323814_324530 235
331 3300049572 Ga0501036_0012881 Ga0501036_0012881_6077_6793 235
332 3300049572 Ga0501036_0085235 Ga0501036_0085235_1157_1873 235
333 3300049574 Ga0501038_0112923 Ga0501038_0112923_463_1179 235
334 3300049579 Ga0501043_0000619 Ga0501043_0000619_2774_3490 235
335 3300049580 Ga0501046_0000219 Ga0501046_0000219_6717_7433 235
336 3300049581 Ga0501047_0000006 Ga0501047_0000006_11289_12005 235
337 3300049582 Ga0501048_0001853 Ga0501048_0001853_11946_12662 235
338 3300049583 Ga0501067_0027189 Ga0501067_0027189_844_1554 235
339 3300049583 Ga0501067_0153225 Ga0501067_0153225_154_867 235
340 3300049584 Ga0501068_0000309 Ga0501068_0000309_17310_18026 235
341 3300049585 Ga0501069_0110142 Ga0501069_0110142_670_1383 235
342 3300049586 Ga0501070_0001307 Ga0501070_0001307_17899_18615 235
343 3300049586 Ga0501070_0026399 Ga0501070_0026399_4073_4786 235
344 3300049588 Ga0501072_0000484 Ga0501072_0000484_6798_7514 235
345 3300049589 Ga0501073_0005718 Ga0501073_0005718_6737_7453 235
346 3300049589 Ga0501073_0024221 Ga0501073_0024221_1071_1781 235
347 3300049590 Ga0501074_0000426 Ga0501074_0000426_3363_4079 235
348 3300049590 Ga0501074_0161063 Ga0501074_0161063_405_1118 235
349 3300049741 Ga0501079_0000007 Ga0501079_0000007_6743_7459 235
350 3300049742 Ga0501080_0000465 Ga0501080_0000465_18650_19366 235
351 3300049742 Ga0501080_0256942 Ga0501080_0256942_244_957 235
352 3300049743 Ga0501081_0208353 Ga0501081_0208353_106_819 235
353 3300049744 Ga0501083_0000156 Ga0501083_0000156_37954_38670 235
354 3300049744 Ga0501083_0242506 Ga0501083_0242506_86_799 235
355 3300050511 nmdc:mga08y16_75053_c1 nmdc:mga08y16_75053_c1_1194_1904 235
356 3300054114 Ga0501084_0000019 Ga0501084_0000019_11273_11989 235
357 3300060353 Ga0501082_0000310 Ga0501082_0000310_10537_11253 235
358 3300060353 Ga0501082_0010831 Ga0501082_0010831_5313_6026 235
359 3300005343 Ga0070687_100028466 Ga0070687_1000284664 236
360 3300005440 Ga0070705_100422464 Ga0070705_1004224642 236
361 3300005530 Ga0070679_100002895 Ga0070679_10000289512 236
362 3300005530 Ga0070679_100211219 Ga0070679_1002112193 236
363 3300005530 Ga0070679_100292356 Ga0070679_1002923562 236
364 3300005535 Ga0070684_100081966 Ga0070684_1000819662 236
365 3300005618 Ga0068864_100272615 Ga0068864_1002726152 236
366 3300005841 Ga0068863_100432744 Ga0068863_1004327442 236
367 3300014325 Ga0163163_10042319 Ga0163163_100423193 236
368 3300025912 Ga0207707_10011043 Ga0207707_100110436 236
369 3300025912 Ga0207707_10020022 Ga0207707_100200229 236
370 3300025912 Ga0207707_10190338 Ga0207707_101903382 236
371 3300025917 Ga0207660_10141365 Ga0207660_101413653 236
372 3300025918 Ga0207662_10056880 Ga0207662_100568803 236
373 3300025921 Ga0207652_10002591 Ga0207652_1000259112 236
374 3300025921 Ga0207652_10184194 Ga0207652_101841942 236
375 3300025944 Ga0207661_10540108 Ga0207661_105401082 236
376 3300026116 Ga0207674_10055869 Ga0207674_100558693 236
377 3300028653 Ga0265323_10000856 Ga0265323_1000085611 236
378 3300028800 Ga0265338_10003344 Ga0265338_1000334410 236
379 3300031235 Ga0265330_10000007 Ga0265330_1000000711 236
380 3300031235 Ga0265330_10000497 Ga0265330_1000049715 236
381 3300031235 Ga0265330_10001390 Ga0265330_100013909 236
382 3300031235 Ga0265330_10012158 Ga0265330_100121583 236
383 3300031235 Ga0265330_10015498 Ga0265330_100154982 236
384 3300031235 Ga0265330_10038306 Ga0265330_100383063 236
385 3300031238 Ga0265332_10000296 Ga0265332_1000029617 236
386 3300031238 Ga0265332_10038003 Ga0265332_100380032 236
387 3300031238 Ga0265332_10040523 Ga0265332_100405233 236
388 3300031240 Ga0265320_10000041 Ga0265320_100000418 236
389 3300031242 Ga0265329_10000051 Ga0265329_100000517 236
390 3300031249 Ga0265339_10199739 Ga0265339_101997392 236
391 3300031250 Ga0265331_10000031 Ga0265331_10000031166 236
392 3300031250 Ga0265331_10005121 Ga0265331_100051212 236
393 3300031344 Ga0265316_10002089 Ga0265316_100020899 236
394 3300031344 Ga0265316_10002313 Ga0265316_100023138 236
395 3300031344 Ga0265316_10013418 Ga0265316_100134181 236
396 3300031344 Ga0265316_10013973 Ga0265316_100139736 236
397 3300031344 Ga0265316_10014565 Ga0265316_100145657 236
398 3300031344 Ga0265316_10018583 Ga0265316_100185834 236
399 3300031344 Ga0265316_10021198 Ga0265316_100211983 236
400 3300031711 Ga0265314_10000021 Ga0265314_10000021165 236
401 3300031711 Ga0265314_10062580 Ga0265314_100625803 236
402 3300031712 Ga0265342_10001955 Ga0265342_100019554 236
403 3300031712 Ga0265342_10002010 Ga0265342_100020102 236
404 3300031712 Ga0265342_10037841 Ga0265342_100378411 236
405 3300031712 Ga0265342_10060436 Ga0265342_100604362 236
406 3300031712 Ga0265342_10133516 Ga0265342_101335162 236
407 3300034818 Ga0373950_0000004 Ga0373950_0000004_313731_314450 236
408 3300037068 Ga0373925_0204994 Ga0373925_0204994_267_980 236
409 3300044712 Ga0453684_0236755 Ga0453684_0236755_1373_2086 236
410 3300045051 Ga0451576_0009466 Ga0451576_0009466_2568_3281 236
411 3300046462 Ga0495651_0069629 Ga0495651_0069629_189_902 236
412 3300048088 Ga0495602_0123906 Ga0495602_0123906_250_963 236
413 3300049583 Ga0501067_0000571 Ga0501067_0000571_14852_15571 236
414 3300049589 Ga0501073_0007032 Ga0501073_0007032_5568_6287 236
415 3300005549 Ga0070704_100083079 Ga0070704_1000830792 237
416 3300005615 Ga0070702_100234540 Ga0070702_1002345401 237
417 3300028653 Ga0265323_10002119 Ga0265323_1000211911 237
418 3300028654 Ga0265322_10000306 Ga0265322_100003064 237
419 3300028654 Ga0265322_10042636 Ga0265322_100426361 237
420 3300028800 Ga0265338_10000365 Ga0265338_1000036562 237
421 3300029957 Ga0265324_10055559 Ga0265324_100555591 237
422 3300031595 Ga0265313_10057987 Ga0265313_100579873 237
423 3300039447 Ga0436361_0092287 Ga0436361_0092287_1501_2217 237
424 3300045051 Ga0451576_0030211 Ga0451576_0030211_3267_3983 237
425 3300009094 Ga0111539_10104133 Ga0111539_101041332 238
426 3300035120 Ga0373957_0008584 Ga0373957_0008584_1961_2704 238
427 3300035171 Ga0373946_0077446 Ga0373946_0077446_301_1023 238
428 3300044658 Ga0466972_0127301 Ga0466972_0127301_424_1182 238
429 3300046516 Ga0495628_0014918 Ga0495628_0014918_4199_4921 238
430 3300046517 Ga0495630_0017876 Ga0495630_0017876_2683_3405 238
431 3300046529 Ga0495652_0486706 Ga0495652_0486706_40_762 238
432 3300046535 Ga0495586_0135066 Ga0495586_0135066_181_903 238
433 3300046642 Ga0495634_0002690 Ga0495634_0002690_9184_9906 238
434 3300047319 Ga0495674_0018164 Ga0495674_0018164_4928_5650 238
435 3300047472 Ga0495686_0063522 Ga0495686_0063522_1088_1810 238
436 3300050511 nmdc:mga08y16_98172_c1 nmdc:mga08y16_98172_c1_2054_2779 238
437 3300053077 Ga0495601_0217606 Ga0495601_0217606_424_1146 238
438 3300006880 Ga0075429_100094918 Ga0075429_1000949185 239
439 3300028666 Ga0265336_10026341 Ga0265336_100263412 239
440 3300028800 Ga0265338_10095923 Ga0265338_100959232 239
441 3300035086 Ga0373934_0076101 Ga0373934_0076101_333_1061 239
442 3300035119 Ga0373956_0008746 Ga0373956_0008746_1750_2478 239
443 3300035120 Ga0373957_0187319 Ga0373957_0187319_80_808 239
444 3300035172 Ga0373955_0002906 Ga0373955_0002906_5622_6350 239
445 3300036401 Ga0373937_0011770 Ga0373937_0011770_5309_6037 239
446 3300048910 Ga0496107_0234445 Ga0496107_0234445_351_1079 239
447 3300048917 Ga0496114_0002135 Ga0496114_0002135_1359_2087 239
448 3300048918 Ga0496115_0145915 Ga0496115_0145915_582_1310 239
449 3300049589 Ga0501073_0000104 Ga0501073_0000104_19892_20620 239
450 3300050508 nmdc:mga09592_76988_c1 nmdc:mga09592_76988_c1_1514_2254 239
451 3300053085 Ga0495619_0166203 Ga0495619_0166203_100_828 239
452 3300003323 rootH1_10075755 rootH1_100757552 240
453 3300006846 Ga0075430_100536250 Ga0075430_1005362502 240
454 3300009545 Ga0105237_10046527 Ga0105237_100465272 240
455 3300025914 Ga0207671_10262577 Ga0207671_102625772 240
456 3300050509 nmdc:mga0qj67_479498_c1 nmdc:mga0qj67_479498_c1_87_830 240
457 3300028558 Ga0265326_10006285 Ga0265326_100062852 241
458 3300028573 Ga0265334_10038483 Ga0265334_100384832 241
459 3300028653 Ga0265323_10000309 Ga0265323_1000030913 241
460 3300028653 Ga0265323_10011886 Ga0265323_100118862 241
461 3300028653 Ga0265323_10032084 Ga0265323_100320842 241
462 3300028653 Ga0265323_10044594 Ga0265323_100445942 241
463 3300028654 Ga0265322_10011846 Ga0265322_100118463 241
464 3300028800 Ga0265338_10074368 Ga0265338_100743682 241
465 3300031242 Ga0265329_10000426 Ga0265329_1000042614 241
466 3300031344 Ga0265316_10000322 Ga0265316_100003228 241
467 3300031712 Ga0265342_10001432 Ga0265342_1000143214 241
468 3300031712 Ga0265342_10003656 Ga0265342_100036569 241
469 3300045051 Ga0451576_0184109 Ga0451576_0184109_1147_1881 241
470 3300028800 Ga0265338_10084297 Ga0265338_100842974 242
471 3300044765 Ga0466970_0119378 Ga0466970_0119378_71_844 243
472 3300028653 Ga0265323_10024683 Ga0265323_100246832 248
473 3300031235 Ga0265330_10003461 Ga0265330_100034612 248
474 3300044712 Ga0453684_0066776 Ga0453684_0066776_1362_2111 249
475 3300046501 Ga0495607_0006472 Ga0495607_0006472_3040_3804 249
476 iso_pu_bacteria 2786546940 2788436003 249
477 3300028563 Ga0265319_1008826 Ga0265319_10088262 250
478 3300031240 Ga0265320_10009297 Ga0265320_100092975 250
479 3300031595 Ga0265313_10001453 Ga0265313_1000145316 250
480 3300049744 Ga0501083_0001072 Ga0501083_0001072_9571_10323 250
481 3300042876 Ga0451577_0077231 Ga0451577_0077231_279_1064 252
482 3300044712 Ga0453684_0000001 Ga0453684_0000001_1570889_1571674 252
483 3300044712 Ga0453684_0398683 Ga0453684_0398683_330_1088 252
484 3300003323 rootH1_10025820 rootH1_100258201 253
485 3300026078 Ga0207702_10001021 Ga0207702_100010217 253
486 3300026116 Ga0207674_10162463 Ga0207674_101624632 253
487 3300044719 Ga0466971_0033067 Ga0466971_0033067_542_1303 253
488 3300045976 Ga0466967_0009904 Ga0466967_0009904_5743_6504 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03725

RNase_PH_C

3' exoribonuclease family, domain 2

180

247

0.96

PF01138

RNase_PH

3' exoribonuclease family, domain 1

38

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1udn-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph from aquifex aeolicus 0.9678 7 240
1oyr-assembly1.cif.gz_C crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis 0.9675 7 244
1r6l-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph from pseudomonas aeruginosa 0.9673 6 244
1udo-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph r86a mutant from aquifex aeolicus 0.9672 7 241
1uds-assembly1.cif.gz_A crystal structure of the trna processing enzyme rnase ph r126a mutant from aquifex aeolicus 0.9664 7 240
ID Description Score Start End Superfamily
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9585 18 244 3.30.230.70
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9537 18 242 3.30.230.70
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9445 18 242 3.30.230.70
2wnrF01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.938 15 245 3.30.230.70
3dd6A01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.9264 18 244 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A836W3E1-F1-model_v4 Ribonuclease PH 0.9939 124 231 GO:0000049
GO:0008033
GO:0009022
GO:0016075
AF-A0A4U9HE90-F1-model_v4 Ribonuclease PH (EC 2.7.7.56) 0.9902 126 243 GO:0000049
GO:0008033
GO:0009022
GO:0016075
AF-A0A074TXN7-F1-model_v4 deleted 0.9901 129 226
AF-A0A519CLY9-F1-model_v4 Ribonuclease PH 0.9901 167 243
AF-A0A356UAB4-F1-model_v4 Ribonuclease PH 0.99 124 243 GO:0000049
GO:0006364
GO:0008033
GO:0009022
GO:0016075

Feature Viewer

pLDDT pTM Quality
92.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map