F453621
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 488 | 255 | 487 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300028558|Ga0265326_10006285|Ga0265326_100062852 |
| Length | 265 |
| Sequence | MRGGEGVAMLPLVDLLTGCQGTGILLPIMRPDGRRPDELRAIRITPDCNRYAEGSALVEFGETKVICTATVENKVPPFLAGQGKGWVTAEYAMLPRSTHTRSGRNPGGRGQEIQRLIGRALRAAVRTAHMGERQLTVDCDVIQADGGTRTAAITGGWVALALALRRLVKSEKLAHDPLRRAVAALSVGLVSGEPRLDLAYEEDSAADVDFNFVMTDAGQFIEIQGTAEGEPFSADDYAKLVALASVGAKQLFALQQKALQAAKLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 136 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 138 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 166 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 167 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 223 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 225 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 238 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 240 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 243 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 244 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 245 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 246 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 247 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 252 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.1 |
| Nodule | 0 |
| Rhizoplane | 3.69 |
| Rhizosphere | 89.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10025820 | 3300003323 | Bacteria | 2296 |
| 2 | rootH1_10075755 | 3300003323 | Bacteria | 3149 |
| 3 | Ga0070676_10004668 | 3300005328 | Bacteria | 7240 |
| 4 | Ga0070683_100036195 | 3300005329 | Bacteria | 4515 |
| 5 | Ga0070683_100051796 | 3300005329 | Bacteria | 3802 |
| 6 | Ga0070683_100066433 | 3300005329 | Bacteria | 3359 |
| 7 | Ga0070683_100464787 | 3300005329 | Bacteria | 1208 |
| 8 | Ga0070690_100001477 | 3300005330 | Bacteria | 12294 |
| 9 | Ga0070690_100031062 | 3300005330 | Bacteria | 3324 |
| 10 | Ga0068869_100048363 | 3300005334 | Bacteria | 3075 |
| 11 | Ga0068869_100069563 | 3300005334 | Bacteria | 2603 |
| 12 | Ga0070666_10061823 | 3300005335 | Bacteria | 2536 |
| 13 | Ga0070666_10063442 | 3300005335 | Bacteria | 2504 |
| 14 | Ga0070680_100245441 | 3300005336 | Bacteria | 1514 |
| 15 | Ga0070660_100226979 | 3300005339 | Bacteria | 1519 |
| 16 | Ga0070689_100050455 | 3300005340 | Bacteria | 3215 |
| 17 | Ga0070689_100070432 | 3300005340 | Bacteria | 2730 |
| 18 | Ga0070689_100074759 | 3300005340 | Bacteria | 2651 |
| 19 | Ga0070687_100028466 | 3300005343 | Bacteria | 2711 |
| 20 | Ga0070687_100070819 | 3300005343 | Bacteria | 1872 |
| 21 | Ga0070687_100095303 | 3300005343 | Bacteria | 1654 |
| 22 | Ga0070692_10163335 | 3300005345 | Bacteria | 1278 |
| 23 | Ga0070668_100041969 | 3300005347 | Bacteria | 3505 |
| 24 | Ga0070669_100008655 | 3300005353 | Bacteria | 7261 |
| 25 | Ga0070675_100080824 | 3300005354 | Bacteria | 2710 |
| 26 | Ga0070674_100010856 | 3300005356 | Bacteria | 5524 |
| 27 | Ga0070673_100012835 | 3300005364 | Bacteria | 5767 |
| 28 | Ga0070673_100056597 | 3300005364 | Bacteria | 3095 |
| 29 | Ga0070688_100027164 | 3300005365 | Bacteria | 3407 |
| 30 | Ga0070688_100052489 | 3300005365 | Bacteria | 2547 |
| 31 | Ga0070688_100082053 | 3300005365 | Bacteria | 2089 |
| 32 | Ga0070688_100089134 | 3300005365 | Bacteria | 2012 |
| 33 | Ga0070688_100289025 | 3300005365 | Bacteria | 1181 |
| 34 | Ga0070659_100030758 | 3300005366 | Bacteria | 4155 |
| 35 | Ga0070667_100113928 | 3300005367 | Bacteria | 2347 |
| 36 | Ga0070667_100133589 | 3300005367 | Bacteria | 2168 |
| 37 | Ga0070701_10271444 | 3300005438 | Bacteria | 1032 |
| 38 | Ga0070711_100348720 | 3300005439 | Bacteria | 1190 |
| 39 | Ga0070705_100422464 | 3300005440 | Bacteria | 993 |
| 40 | Ga0070694_100119947 | 3300005444 | Bacteria | 1886 |
| 41 | Ga0070678_100023296 | 3300005456 | Bacteria | 4124 |
| 42 | Ga0070678_100618337 | 3300005456 | Bacteria | 969 |
| 43 | Ga0068867_100177916 | 3300005459 | Bacteria | 1689 |
| 44 | Ga0070685_10026282 | 3300005466 | Bacteria | 3208 |
| 45 | Ga0070685_10202666 | 3300005466 | Bacteria | 1291 |
| 46 | Ga0070706_100012807 | 3300005467 | Bacteria | 7763 |
| 47 | Ga0070698_100000144 | 3300005471 | Bacteria | 64348 |
| 48 | Ga0070679_100002895 | 3300005530 | Bacteria | 15590 |
| 49 | Ga0070679_100009198 | 3300005530 | Bacteria | 9333 |
| 50 | Ga0070679_100015171 | 3300005530 | Bacteria | 7404 |
| 51 | Ga0070679_100052079 | 3300005530 | Bacteria | 4078 |
| 52 | Ga0070679_100189877 | 3300005530 | Bacteria | 2024 |
| 53 | Ga0070679_100211219 | 3300005530 | Bacteria | 1904 |
| 54 | Ga0070679_100292356 | 3300005530 | Bacteria | 1580 |
| 55 | Ga0070679_100314037 | 3300005530 | Bacteria | 1517 |
| 56 | Ga0070679_100367565 | 3300005530 | Bacteria | 1385 |
| 57 | Ga0070684_100001991 | 3300005535 | Bacteria | 15026 |
| 58 | Ga0070684_100039273 | 3300005535 | Bacteria | 4070 |
| 59 | Ga0070684_100081966 | 3300005535 | Bacteria | 2855 |
| 60 | Ga0070684_100164171 | 3300005535 | Bacteria | 2016 |
| 61 | Ga0070672_100015262 | 3300005543 | Bacteria | 5463 |
| 62 | Ga0070686_100003953 | 3300005544 | Bacteria | 8151 |
| 63 | Ga0070695_100772026 | 3300005545 | Bacteria | 768 |
| 64 | Ga0070704_100083079 | 3300005549 | Bacteria | 2364 |
| 65 | Ga0068855_100067635 | 3300005563 | Bacteria | 4160 |
| 66 | Ga0068855_100105297 | 3300005563 | Bacteria | 3243 |
| 67 | Ga0068857_100118924 | 3300005577 | Bacteria | 2378 |
| 68 | Ga0068856_100125716 | 3300005614 | Bacteria | 2567 |
| 69 | Ga0070702_100234540 | 3300005615 | Bacteria | 1235 |
| 70 | Ga0068859_100627192 | 3300005617 | Bacteria | 1167 |
| 71 | Ga0068864_100272615 | 3300005618 | Bacteria | 1577 |
| 72 | Ga0068866_10008982 | 3300005718 | Bacteria | 4233 |
| 73 | Ga0068861_100027708 | 3300005719 | Bacteria | 4130 |
| 74 | Ga0068870_10274930 | 3300005840 | Bacteria | 1054 |
| 75 | Ga0068863_100010122 | 3300005841 | Bacteria | 9169 |
| 76 | Ga0068863_100015699 | 3300005841 | Bacteria | 7271 |
| 77 | Ga0068863_100297701 | 3300005841 | Bacteria | 1565 |
| 78 | Ga0068863_100432744 | 3300005841 | Bacteria | 1290 |
| 79 | Ga0068858_100034376 | 3300005842 | Bacteria | 4701 |
| 80 | Ga0068862_100008469 | 3300005844 | Bacteria | 8505 |
| 81 | Ga0097621_100288595 | 3300006237 | Bacteria | 1446 |
| 82 | Ga0075428_100618915 | 3300006844 | Bacteria | 1156 |
| 83 | Ga0075430_100536250 | 3300006846 | Bacteria | 965 |
| 84 | Ga0075434_100881464 | 3300006871 | Bacteria | 910 |
| 85 | Ga0075429_100052297 | 3300006880 | Bacteria | 3554 |
| 86 | Ga0075429_100094918 | 3300006880 | Bacteria | 2601 |
| 87 | Ga0075429_100147562 | 3300006880 | Bacteria | 2059 |
| 88 | Ga0068865_100096241 | 3300006881 | Bacteria | 2158 |
| 89 | Ga0068865_100214092 | 3300006881 | Bacteria | 1503 |
| 90 | Ga0097620_100627201 | 3300006931 | Bacteria | 1167 |
| 91 | Ga0075435_100329425 | 3300007076 | Bacteria | 1307 |
| 92 | Ga0105240_10001486 | 3300009093 | Bacteria | 39891 |
| 93 | Ga0105240_10602786 | 3300009093 | Bacteria | 1209 |
| 94 | Ga0111539_10043060 | 3300009094 | Bacteria | 5416 |
| 95 | Ga0111539_10104133 | 3300009094 | Bacteria | 3330 |
| 96 | Ga0105245_10000109 | 3300009098 | Bacteria | 79725 |
| 97 | Ga0105243_10049514 | 3300009148 | Bacteria | 3315 |
| 98 | Ga0105243_10149997 | 3300009148 | Bacteria | 1999 |
| 99 | Ga0105242_10097405 | 3300009176 | Bacteria | 2487 |
| 100 | Ga0105248_11079515 | 3300009177 | Bacteria | 907 |
| 101 | Ga0105237_10000115 | 3300009545 | Bacteria | 112419 |
| 102 | Ga0105237_10046527 | 3300009545 | Bacteria | 4364 |
| 103 | Ga0105238_10006789 | 3300009551 | Bacteria | 11430 |
| 104 | Ga0105238_10617950 | 3300009551 | Bacteria | 1092 |
| 105 | Ga0105249_10068884 | 3300009553 | Bacteria | 3264 |
| 106 | Ga0105249_10401187 | 3300009553 | Bacteria | 1402 |
| 107 | Ga0157369_10249898 | 3300013105 | Bacteria | 1851 |
| 108 | Ga0157374_10002646 | 3300013296 | Bacteria | 15081 |
| 109 | Ga0157374_10541162 | 3300013296 | Bacteria | 1172 |
| 110 | Ga0157378_10509428 | 3300013297 | Bacteria | 1203 |
| 111 | Ga0157378_10563574 | 3300013297 | Bacteria | 1146 |
| 112 | Ga0163163_10042319 | 3300014325 | Bacteria | 4461 |
| 113 | Ga0157376_10206941 | 3300014969 | Bacteria | 1809 |
| 114 | Ga0213876_10050627 | 3300021384 | Bacteria | 2195 |
| 115 | Ga0224712_10049172 | 3300022467 | Bacteria | 1631 |
| 116 | Ga0207697_10058353 | 3300025315 | Bacteria | 1603 |
| 117 | Ga0207680_10055877 | 3300025903 | Bacteria | 2381 |
| 118 | Ga0207680_10237142 | 3300025903 | Bacteria | 1256 |
| 119 | Ga0207645_10003813 | 3300025907 | Bacteria | 11294 |
| 120 | Ga0207705_10037466 | 3300025909 | Bacteria | 3470 |
| 121 | Ga0207684_10012901 | 3300025910 | Bacteria | 7237 |
| 122 | Ga0207707_10011043 | 3300025912 | Bacteria | 7859 |
| 123 | Ga0207707_10020022 | 3300025912 | Bacteria | 5837 |
| 124 | Ga0207707_10190338 | 3300025912 | Bacteria | 1790 |
| 125 | Ga0207695_10016341 | 3300025913 | Bacteria | 8685 |
| 126 | Ga0207671_10000335 | 3300025914 | Bacteria | 69222 |
| 127 | Ga0207671_10262577 | 3300025914 | Bacteria | 1359 |
| 128 | Ga0207693_10361401 | 3300025915 | Bacteria | 1136 |
| 129 | Ga0207660_10141365 | 3300025917 | Bacteria | 1840 |
| 130 | Ga0207660_10249195 | 3300025917 | Bacteria | 1401 |
| 131 | Ga0207662_10011136 | 3300025918 | Bacteria | 4977 |
| 132 | Ga0207662_10056880 | 3300025918 | Bacteria | 2337 |
| 133 | Ga0207662_10223276 | 3300025918 | Bacteria | 1228 |
| 134 | Ga0207662_10243282 | 3300025918 | Bacteria | 1178 |
| 135 | Ga0207652_10002591 | 3300025921 | Bacteria | 15165 |
| 136 | Ga0207652_10002880 | 3300025921 | Bacteria | 14391 |
| 137 | Ga0207652_10012196 | 3300025921 | Bacteria | 6945 |
| 138 | Ga0207652_10042840 | 3300025921 | Bacteria | 3854 |
| 139 | Ga0207652_10174508 | 3300025921 | Bacteria | 1930 |
| 140 | Ga0207652_10184194 | 3300025921 | Bacteria | 1877 |
| 141 | Ga0207681_10001273 | 3300025923 | Bacteria | 16279 |
| 142 | Ga0207694_10605837 | 3300025924 | Bacteria | 921 |
| 143 | Ga0207650_10204581 | 3300025925 | Bacteria | 1583 |
| 144 | Ga0207659_10072931 | 3300025926 | Bacteria | 2512 |
| 145 | Ga0207687_10000200 | 3300025927 | Bacteria | 40532 |
| 146 | Ga0207687_10049756 | 3300025927 | Bacteria | 2915 |
| 147 | Ga0207700_10543644 | 3300025928 | Bacteria | 1030 |
| 148 | Ga0207690_10120669 | 3300025932 | Bacteria | 1904 |
| 149 | Ga0207709_10027014 | 3300025935 | Bacteria | 3302 |
| 150 | Ga0207670_10025785 | 3300025936 | Bacteria | 3695 |
| 151 | Ga0207670_10066349 | 3300025936 | Bacteria | 2479 |
| 152 | Ga0207670_10096542 | 3300025936 | Bacteria | 2102 |
| 153 | Ga0207669_10000958 | 3300025937 | Bacteria | 12241 |
| 154 | Ga0207704_10165798 | 3300025938 | Bacteria | 1578 |
| 155 | Ga0207691_10019235 | 3300025940 | Bacteria | 6464 |
| 156 | Ga0207691_10035195 | 3300025940 | Bacteria | 4652 |
| 157 | Ga0207691_10044092 | 3300025940 | Bacteria | 4107 |
| 158 | Ga0207689_10027979 | 3300025942 | Bacteria | 4716 |
| 159 | Ga0207689_10040320 | 3300025942 | Bacteria | 3866 |
| 160 | Ga0207661_10046733 | 3300025944 | Bacteria | 3432 |
| 161 | Ga0207661_10106562 | 3300025944 | Bacteria | 2363 |
| 162 | Ga0207661_10424910 | 3300025944 | Bacteria | 1207 |
| 163 | Ga0207661_10540108 | 3300025944 | Bacteria | 1067 |
| 164 | Ga0207667_10208651 | 3300025949 | Bacteria | 2003 |
| 165 | Ga0207651_10035716 | 3300025960 | Bacteria | 3236 |
| 166 | Ga0207651_10036375 | 3300025960 | Bacteria | 3213 |
| 167 | Ga0207651_10059968 | 3300025960 | Bacteria | 2638 |
| 168 | Ga0207712_10024586 | 3300025961 | Bacteria | 3992 |
| 169 | Ga0207677_10087900 | 3300026023 | Bacteria | 2252 |
| 170 | Ga0207708_10008699 | 3300026075 | Bacteria | 7515 |
| 171 | Ga0207702_10001021 | 3300026078 | Bacteria | 28735 |
| 172 | Ga0207702_10012515 | 3300026078 | Bacteria | 7056 |
| 173 | Ga0207641_10015629 | 3300026088 | Bacteria | 6220 |
| 174 | Ga0207641_10061137 | 3300026088 | Bacteria | 3212 |
| 175 | Ga0207641_10259602 | 3300026088 | Bacteria | 1626 |
| 176 | Ga0207648_10010133 | 3300026089 | Bacteria | 8961 |
| 177 | Ga0207676_10215386 | 3300026095 | Bacteria | 1707 |
| 178 | Ga0207676_10252473 | 3300026095 | Bacteria | 1588 |
| 179 | Ga0207674_10055869 | 3300026116 | Bacteria | 4011 |
| 180 | Ga0207674_10134575 | 3300026116 | Bacteria | 2434 |
| 181 | Ga0207674_10162463 | 3300026116 | Bacteria | 2188 |
| 182 | Ga0207675_100026721 | 3300026118 | Bacteria | 5372 |
| 183 | Ga0207675_100064816 | 3300026118 | Bacteria | 3415 |
| 184 | Ga0207683_10010642 | 3300026121 | Bacteria | 7844 |
| 185 | Ga0207683_10158806 | 3300026121 | Bacteria | 2043 |
| 186 | Ga0268266_10000954 | 3300028379 | Bacteria | 36886 |
| 187 | Ga0268264_10153244 | 3300028381 | Bacteria | 2069 |
| 188 | Ga0265337_1006140 | 3300028556 | Bacteria | 4672 |
| 189 | Ga0265326_10006285 | 3300028558 | Bacteria | 3703 |
| 190 | Ga0265326_10020926 | 3300028558 | Bacteria | 1875 |
| 191 | Ga0265326_10038909 | 3300028558 | Bacteria | 1351 |
| 192 | Ga0265319_1008826 | 3300028563 | Bacteria | 4370 |
| 193 | Ga0265319_1020062 | 3300028563 | Bacteria | 2485 |
| 194 | Ga0265334_10038483 | 3300028573 | Bacteria | 1881 |
| 195 | Ga0265318_10001419 | 3300028577 | Bacteria | 14168 |
| 196 | Ga0265323_10000309 | 3300028653 | Bacteria | 28106 |
| 197 | Ga0265323_10000856 | 3300028653 | Bacteria | 16193 |
| 198 | Ga0265323_10002119 | 3300028653 | Bacteria | 9252 |
| 199 | Ga0265323_10011886 | 3300028653 | Bacteria | 3500 |
| 200 | Ga0265323_10024683 | 3300028653 | Bacteria | 2283 |
| 201 | Ga0265323_10032084 | 3300028653 | Bacteria | 1950 |
| 202 | Ga0265323_10044594 | 3300028653 | Bacteria | 1596 |
| 203 | Ga0265322_10000306 | 3300028654 | Bacteria | 20716 |
| 204 | Ga0265322_10011846 | 3300028654 | Bacteria | 2522 |
| 205 | Ga0265322_10042636 | 3300028654 | Bacteria | 1292 |
| 206 | Ga0265336_10026341 | 3300028666 | Bacteria | 1827 |
| 207 | Ga0265336_10076622 | 3300028666 | Bacteria | 999 |
| 208 | Ga0307517_10170041 | 3300028786 | Bacteria | 1435 |
| 209 | Ga0307515_10007588 | 3300028794 | Bacteria | 21416 |
| 210 | Ga0265338_10000365 | 3300028800 | Bacteria | 81425 |
| 211 | Ga0265338_10003344 | 3300028800 | Bacteria | 22669 |
| 212 | Ga0265338_10019190 | 3300028800 | Bacteria | 7276 |
| 213 | Ga0265338_10027120 | 3300028800 | Bacteria | 5755 |
| 214 | Ga0265338_10050852 | 3300028800 | Bacteria | 3740 |
| 215 | Ga0265338_10074368 | 3300028800 | Bacteria | 2890 |
| 216 | Ga0265338_10084297 | 3300028800 | Bacteria | 2654 |
| 217 | Ga0265338_10095923 | 3300028800 | Bacteria | 2435 |
| 218 | Ga0265324_10000399 | 3300029957 | Bacteria | 31271 |
| 219 | Ga0265324_10011568 | 3300029957 | Bacteria | 3360 |
| 220 | Ga0265324_10055559 | 3300029957 | Bacteria | 1357 |
| 221 | Ga0265330_10000007 | 3300031235 | Bacteria | 208811 |
| 222 | Ga0265330_10000497 | 3300031235 | Bacteria | 26301 |
| 223 | Ga0265330_10001390 | 3300031235 | Bacteria | 14143 |
| 224 | Ga0265330_10003461 | 3300031235 | Bacteria | 8242 |
| 225 | Ga0265330_10006976 | 3300031235 | Bacteria | 5546 |
| 226 | Ga0265330_10011634 | 3300031235 | Bacteria | 4123 |
| 227 | Ga0265330_10012158 | 3300031235 | Bacteria | 4028 |
| 228 | Ga0265330_10015498 | 3300031235 | Bacteria | 3525 |
| 229 | Ga0265330_10018337 | 3300031235 | Bacteria | 3214 |
| 230 | Ga0265330_10038306 | 3300031235 | Bacteria | 2131 |
| 231 | Ga0265332_10000296 | 3300031238 | Bacteria | 38979 |
| 232 | Ga0265332_10001712 | 3300031238 | Bacteria | 11954 |
| 233 | Ga0265332_10007929 | 3300031238 | Bacteria | 4784 |
| 234 | Ga0265332_10029024 | 3300031238 | Bacteria | 2420 |
| 235 | Ga0265332_10038003 | 3300031238 | Bacteria | 2087 |
| 236 | Ga0265332_10040523 | 3300031238 | Bacteria | 2017 |
| 237 | Ga0265328_10000296 | 3300031239 | Bacteria | 23193 |
| 238 | Ga0265328_10001755 | 3300031239 | Bacteria | 9916 |
| 239 | Ga0265320_10000041 | 3300031240 | Bacteria | 129936 |
| 240 | Ga0265320_10001464 | 3300031240 | Bacteria | 17242 |
| 241 | Ga0265320_10009297 | 3300031240 | Bacteria | 5937 |
| 242 | Ga0265320_10023579 | 3300031240 | Bacteria | 3272 |
| 243 | Ga0265325_10005683 | 3300031241 | Bacteria | 7665 |
| 244 | Ga0265325_10166197 | 3300031241 | Bacteria | 1035 |
| 245 | Ga0265329_10000051 | 3300031242 | Bacteria | 50997 |
| 246 | Ga0265329_10000426 | 3300031242 | Bacteria | 22256 |
| 247 | Ga0265329_10008436 | 3300031242 | Bacteria | 3908 |
| 248 | Ga0265329_10031425 | 3300031242 | Bacteria | 1724 |
| 249 | Ga0265340_10001095 | 3300031247 | Bacteria | 15445 |
| 250 | Ga0265340_10125103 | 3300031247 | Bacteria | 1181 |
| 251 | Ga0265339_10000022 | 3300031249 | Bacteria | 171562 |
| 252 | Ga0265339_10037532 | 3300031249 | Bacteria | 2707 |
| 253 | Ga0265339_10042370 | 3300031249 | Bacteria | 2520 |
| 254 | Ga0265339_10083737 | 3300031249 | Bacteria | 1682 |
| 255 | Ga0265339_10199739 | 3300031249 | Bacteria | 987 |
| 256 | Ga0265331_10000031 | 3300031250 | Bacteria | 213762 |
| 257 | Ga0265331_10003525 | 3300031250 | Bacteria | 10054 |
| 258 | Ga0265331_10005121 | 3300031250 | Bacteria | 7988 |
| 259 | Ga0265331_10013904 | 3300031250 | Bacteria | 4305 |
| 260 | Ga0265316_10000322 | 3300031344 | Bacteria | 53085 |
| 261 | Ga0265316_10002089 | 3300031344 | Bacteria | 21002 |
| 262 | Ga0265316_10002141 | 3300031344 | Bacteria | 20765 |
| 263 | Ga0265316_10002313 | 3300031344 | Bacteria | 19915 |
| 264 | Ga0265316_10013418 | 3300031344 | Bacteria | 7281 |
| 265 | Ga0265316_10013973 | 3300031344 | Bacteria | 7100 |
| 266 | Ga0265316_10014565 | 3300031344 | Bacteria | 6913 |
| 267 | Ga0265316_10014576 | 3300031344 | Bacteria | 6912 |
| 268 | Ga0265316_10018583 | 3300031344 | Bacteria | 5971 |
| 269 | Ga0265316_10021198 | 3300031344 | Bacteria | 5511 |
| 270 | Ga0265316_10290905 | 3300031344 | Bacteria | 1192 |
| 271 | Ga0307513_10030051 | 3300031456 | Bacteria | 6178 |
| 272 | Ga0307509_10000069 | 3300031507 | Bacteria | 141246 |
| 273 | Ga0307509_10004839 | 3300031507 | Bacteria | 19133 |
| 274 | Ga0307509_10079246 | 3300031507 | Bacteria | 3401 |
| 275 | Ga0307509_10196251 | 3300031507 | Bacteria | 1862 |
| 276 | Ga0265313_10001453 | 3300031595 | Bacteria | 22105 |
| 277 | Ga0265313_10025362 | 3300031595 | Bacteria | 3143 |
| 278 | Ga0265313_10057987 | 3300031595 | Bacteria | 1826 |
| 279 | Ga0265313_10163159 | 3300031595 | Bacteria | 945 |
| 280 | Ga0307508_10015293 | 3300031616 | Bacteria | 6992 |
| 281 | Ga0265314_10000007 | 3300031711 | Bacteria | 491737 |
| 282 | Ga0265314_10000021 | 3300031711 | Bacteria | 298390 |
| 283 | Ga0265314_10002137 | 3300031711 | Bacteria | 20719 |
| 284 | Ga0265314_10002626 | 3300031711 | Bacteria | 18133 |
| 285 | Ga0265314_10013100 | 3300031711 | Bacteria | 6719 |
| 286 | Ga0265314_10025635 | 3300031711 | Bacteria | 4443 |
| 287 | Ga0265314_10062580 | 3300031711 | Bacteria | 2529 |
| 288 | Ga0265342_10000326 | 3300031712 | Bacteria | 53802 |
| 289 | Ga0265342_10000767 | 3300031712 | Bacteria | 32719 |
| 290 | Ga0265342_10000775 | 3300031712 | Bacteria | 32449 |
| 291 | Ga0265342_10001432 | 3300031712 | Bacteria | 22243 |
| 292 | Ga0265342_10001955 | 3300031712 | Bacteria | 18430 |
| 293 | Ga0265342_10002010 | 3300031712 | Bacteria | 18094 |
| 294 | Ga0265342_10003656 | 3300031712 | Bacteria | 12501 |
| 295 | Ga0265342_10037841 | 3300031712 | Bacteria | 2940 |
| 296 | Ga0265342_10060436 | 3300031712 | Bacteria | 2234 |
| 297 | Ga0265342_10133516 | 3300031712 | Bacteria | 1389 |
| 298 | Ga0265342_10212156 | 3300031712 | Bacteria | 1046 |
| 299 | Ga0316576_10031260 | 3300031727 | Bacteria | 3777 |
| 300 | Ga0307516_10035646 | 3300031730 | Bacteria | 4988 |
| 301 | Ga0307406_10082089 | 3300031901 | Bacteria | 2146 |
| 302 | Ga0373950_0000004 | 3300034818 | Bacteria | 527382 |
| 303 | Ga0373950_0000081 | 3300034818 | Bacteria | 32543 |
| 304 | Ga0373934_0076101 | 3300035086 | Bacteria | 1346 |
| 305 | Ga0373949_0000056 | 3300035090 | Bacteria | 42956 |
| 306 | Ga0373936_0000042 | 3300035113 | Bacteria | 94182 |
| 307 | Ga0373941_0201442 | 3300035115 | Bacteria | 757 |
| 308 | Ga0373954_0061502 | 3300035118 | Bacteria | 1772 |
| 309 | Ga0373956_0008746 | 3300035119 | Bacteria | 4102 |
| 310 | Ga0373956_0054755 | 3300035119 | Bacteria | 1798 |
| 311 | Ga0373956_0072468 | 3300035119 | Bacteria | 1573 |
| 312 | Ga0373956_0269382 | 3300035119 | Bacteria | 810 |
| 313 | Ga0373957_0008584 | 3300035120 | Bacteria | 3317 |
| 314 | Ga0373957_0187319 | 3300035120 | Bacteria | 859 |
| 315 | Ga0373943_0019089 | 3300035170 | Bacteria | 3152 |
| 316 | Ga0373946_0077446 | 3300035171 | Bacteria | 1449 |
| 317 | Ga0373955_0002906 | 3300035172 | Bacteria | 7519 |
| 318 | Ga0373955_0008137 | 3300035172 | Bacteria | 4853 |
| 319 | Ga0373955_0228959 | 3300035172 | Bacteria | 1111 |
| 320 | Ga0373961_0000066 | 3300035241 | Bacteria | 57564 |
| 321 | Ga0373935_0304139 | 3300035692 | Bacteria | 1128 |
| 322 | Ga0373927_0096474 | 3300035695 | Bacteria | 1922 |
| 323 | Ga0373933_0004826 | 3300035724 | Bacteria | 7367 |
| 324 | Ga0373933_0010285 | 3300035724 | Bacteria | 5126 |
| 325 | Ga0373933_0038590 | 3300035724 | Bacteria | 2807 |
| 326 | Ga0373937_0003345 | 3300036401 | Bacteria | 13459 |
| 327 | Ga0373937_0011770 | 3300036401 | Bacteria | 7675 |
| 328 | Ga0373937_0019601 | 3300036401 | Bacteria | 6054 |
| 329 | Ga0373937_0155991 | 3300036401 | Bacteria | 2139 |
| 330 | Ga0373937_0215765 | 3300036401 | Bacteria | 1806 |
| 331 | Ga0373925_0072007 | 3300037068 | Bacteria | 2615 |
| 332 | Ga0373925_0204994 | 3300037068 | Bacteria | 1569 |
| 333 | Ga0395899_0028166 | 3300037312 | Bacteria | 4230 |
| 334 | Ga0395900_0031896 | 3300037418 | Bacteria | 5416 |
| 335 | Ga0395898_0070182 | 3300037466 | Bacteria | 3388 |
| 336 | Ga0395905_0123093 | 3300037471 | Bacteria | 2439 |
| 337 | Ga0395905_0142315 | 3300037471 | Bacteria | 2256 |
| 338 | Ga0395901_0020968 | 3300038443 | Bacteria | 6694 |
| 339 | Ga0436365_1092473 | 3300039437 | Bacteria | 2177 |
| 340 | Ga0436365_1868030 | 3300039437 | Bacteria | 4108 |
| 341 | Ga0436361_0092287 | 3300039447 | Bacteria | 12403 |
| 342 | Ga0451577_0019679 | 3300042876 | Bacteria | 6205 |
| 343 | Ga0451577_0077231 | 3300042876 | Bacteria | 2969 |
| 344 | Ga0466972_0127301 | 3300044658 | Bacteria | 1200 |
| 345 | Ga0453683_0249532 | 3300044673 | Bacteria | 1131 |
| 346 | Ga0466961_0178397 | 3300044693 | Bacteria | 1320 |
| 347 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 348 | Ga0453684_0000207 | 3300044712 | Bacteria | 256144 |
| 349 | Ga0453684_0005977 | 3300044712 | Bacteria | 23593 |
| 350 | Ga0453684_0066776 | 3300044712 | Bacteria | 4578 |
| 351 | Ga0453684_0156223 | 3300044712 | Bacteria | 2704 |
| 352 | Ga0453684_0236755 | 3300044712 | Bacteria | 2104 |
| 353 | Ga0453684_0398683 | 3300044712 | Bacteria | 1541 |
| 354 | Ga0453684_0517002 | 3300044712 | Bacteria | 1320 |
| 355 | Ga0466971_0033067 | 3300044719 | Bacteria | 2318 |
| 356 | Ga0466970_0119378 | 3300044765 | Bacteria | 1444 |
| 357 | Ga0451576_0009466 | 3300045051 | Bacteria | 11293 |
| 358 | Ga0451576_0030211 | 3300045051 | Bacteria | 5795 |
| 359 | Ga0451576_0142071 | 3300045051 | Bacteria | 2503 |
| 360 | Ga0451576_0184109 | 3300045051 | Bacteria | 2181 |
| 361 | Ga0466967_0009904 | 3300045976 | Bacteria | 7111 |
| 362 | Ga0466967_0350881 | 3300045976 | Bacteria | 1428 |
| 363 | Ga0466967_0620802 | 3300045976 | Bacteria | 1068 |
| 364 | Ga0495651_0069629 | 3300046462 | Bacteria | 2679 |
| 365 | Ga0495664_0053560 | 3300046477 | Bacteria | 2399 |
| 366 | Ga0495607_0006472 | 3300046501 | Bacteria | 8241 |
| 367 | Ga0495628_0014918 | 3300046516 | Bacteria | 6499 |
| 368 | Ga0495628_0144207 | 3300046516 | Bacteria | 1816 |
| 369 | Ga0495630_0017876 | 3300046517 | Bacteria | 5201 |
| 370 | Ga0495666_0181865 | 3300046526 | Bacteria | 971 |
| 371 | Ga0495652_0486706 | 3300046529 | Bacteria | 858 |
| 372 | Ga0495586_0135066 | 3300046535 | Bacteria | 1382 |
| 373 | Ga0495622_0073664 | 3300046557 | Bacteria | 1575 |
| 374 | Ga0495622_0205242 | 3300046557 | Bacteria | 877 |
| 375 | Ga0495634_0002690 | 3300046642 | Bacteria | 14611 |
| 376 | Ga0495599_0200157 | 3300046678 | Bacteria | 1227 |
| 377 | Ga0495646_0066029 | 3300046680 | Bacteria | 2141 |
| 378 | Ga0495624_0211569 | 3300046690 | Bacteria | 1176 |
| 379 | Ga0495649_0203207 | 3300046694 | Bacteria | 1028 |
| 380 | Ga0495674_0018164 | 3300047319 | Bacteria | 6546 |
| 381 | Ga0495674_0019183 | 3300047319 | Bacteria | 6353 |
| 382 | Ga0495680_0146138 | 3300047322 | Bacteria | 1727 |
| 383 | Ga0495675_0247358 | 3300047444 | Bacteria | 1072 |
| 384 | Ga0495684_0076848 | 3300047471 | Bacteria | 2536 |
| 385 | Ga0495684_0339992 | 3300047471 | Bacteria | 1068 |
| 386 | Ga0495686_0017588 | 3300047472 | Bacteria | 4811 |
| 387 | Ga0495686_0063522 | 3300047472 | Bacteria | 2288 |
| 388 | Ga0495602_0123906 | 3300048088 | Bacteria | 2074 |
| 389 | Ga0495602_0284295 | 3300048088 | Bacteria | 1217 |
| 390 | Ga0496100_0017774 | 3300048903 | Bacteria | 4206 |
| 391 | Ga0496101_0075635 | 3300048904 | Bacteria | 2479 |
| 392 | Ga0496101_0318084 | 3300048904 | Bacteria | 1221 |
| 393 | Ga0496104_0597061 | 3300048907 | Bacteria | 1014 |
| 394 | Ga0496107_0234445 | 3300048910 | Bacteria | 1366 |
| 395 | Ga0496108_0019626 | 3300048911 | Bacteria | 5553 |
| 396 | Ga0496108_0217729 | 3300048911 | Bacteria | 1659 |
| 397 | Ga0496109_0114651 | 3300048912 | Bacteria | 2507 |
| 398 | Ga0496112_0045530 | 3300048915 | Bacteria | 4301 |
| 399 | Ga0496112_0675125 | 3300048915 | Bacteria | 962 |
| 400 | Ga0496114_0002135 | 3300048917 | Bacteria | 15030 |
| 401 | Ga0496114_0004055 | 3300048917 | Bacteria | 11312 |
| 402 | Ga0496114_0010276 | 3300048917 | Bacteria | 7448 |
| 403 | Ga0496114_0025451 | 3300048917 | Bacteria | 4838 |
| 404 | Ga0496115_0040048 | 3300048918 | Bacteria | 3724 |
| 405 | Ga0496115_0145915 | 3300048918 | Bacteria | 1953 |
| 406 | Ga0496115_0229524 | 3300048918 | Bacteria | 1531 |
| 407 | Ga0496115_0667309 | 3300048918 | Bacteria | 820 |
| 408 | Ga0501033_0002913 | 3300049570 | Bacteria | 14316 |
| 409 | Ga0501034_0000009 | 3300049571 | Bacteria | 336590 |
| 410 | Ga0501036_0012881 | 3300049572 | Bacteria | 6943 |
| 411 | Ga0501036_0085235 | 3300049572 | Bacteria | 2670 |
| 412 | Ga0501037_0023526 | 3300049573 | Bacteria | 4556 |
| 413 | Ga0501038_0054779 | 3300049574 | Bacteria | 3429 |
| 414 | Ga0501038_0112923 | 3300049574 | Bacteria | 2249 |
| 415 | Ga0501043_0000619 | 3300049579 | Bacteria | 31331 |
| 416 | Ga0501043_0581431 | 3300049579 | Bacteria | 829 |
| 417 | Ga0501046_0000219 | 3300049580 | Bacteria | 59638 |
| 418 | Ga0501046_0024137 | 3300049580 | Bacteria | 4993 |
| 419 | Ga0501047_0000006 | 3300049581 | Bacteria | 455727 |
| 420 | Ga0501047_0009416 | 3300049581 | Bacteria | 9228 |
| 421 | Ga0501047_0064204 | 3300049581 | Bacteria | 3541 |
| 422 | Ga0501047_0342859 | 3300049581 | Bacteria | 1331 |
| 423 | Ga0501048_0001853 | 3300049582 | Bacteria | 16046 |
| 424 | Ga0501048_0494167 | 3300049582 | Bacteria | 877 |
| 425 | Ga0501067_0000571 | 3300049583 | Bacteria | 19941 |
| 426 | Ga0501067_0027189 | 3300049583 | Bacteria | 3169 |
| 427 | Ga0501067_0153225 | 3300049583 | Bacteria | 1284 |
| 428 | Ga0501068_0000309 | 3300049584 | Bacteria | 24458 |
| 429 | Ga0501069_0110142 | 3300049585 | Bacteria | 1567 |
| 430 | Ga0501070_0001307 | 3300049586 | Bacteria | 22334 |
| 431 | Ga0501070_0026399 | 3300049586 | Bacteria | 4871 |
| 432 | Ga0501070_0032666 | 3300049586 | Bacteria | 4356 |
| 433 | Ga0501072_0000484 | 3300049588 | Bacteria | 28573 |
| 434 | Ga0501073_0000104 | 3300049589 | Bacteria | 53927 |
| 435 | Ga0501073_0005718 | 3300049589 | Bacteria | 9302 |
| 436 | Ga0501073_0007032 | 3300049589 | Bacteria | 8383 |
| 437 | Ga0501073_0024221 | 3300049589 | Bacteria | 4358 |
| 438 | Ga0501074_0000426 | 3300049590 | Bacteria | 25176 |
| 439 | Ga0501074_0161063 | 3300049590 | Bacteria | 1603 |
| 440 | Ga0501077_0210129 | 3300049593 | Bacteria | 1237 |
| 441 | Ga0501216_001090 | 3300049660 | Bacteria | 3539 |
| 442 | Ga0501227_000190 | 3300049665 | Bacteria | 12175 |
| 443 | Ga0501230_018118 | 3300049667 | Bacteria | 1199 |
| 444 | Ga0501225_0019229 | 3300049705 | Bacteria | 1891 |
| 445 | Ga0501079_0000007 | 3300049741 | Bacteria | 76508 |
| 446 | Ga0501080_0000465 | 3300049742 | Bacteria | 31424 |
| 447 | Ga0501080_0256942 | 3300049742 | Bacteria | 1592 |
| 448 | Ga0501081_0208353 | 3300049743 | Bacteria | 1419 |
| 449 | Ga0501083_0000156 | 3300049744 | Bacteria | 45386 |
| 450 | Ga0501083_0001072 | 3300049744 | Bacteria | 18258 |
| 451 | Ga0501083_0242506 | 3300049744 | Bacteria | 1173 |
| 452 | Ga0501035_0224935 | 3300049822 | Bacteria | 1601 |
| 453 | Ga0501044_0009718 | 3300049823 | Bacteria | 10463 |
| 454 | Ga0501044_0130945 | 3300049823 | Bacteria | 2502 |
| 455 | Ga0501044_0293085 | 3300049823 | Bacteria | 1558 |
| 456 | nmdc:mga09592_76988_c1 | 3300050508 | Bacteria | 2837 |
| 457 | nmdc:mga09592_8432_c1 | 3300050508 | Bacteria | 8379 |
| 458 | nmdc:mga0qj67_479498_c1 | 3300050509 | Bacteria | 1001 |
| 459 | nmdc:mga08y16_75053_c1 | 3300050511 | Bacteria | 3525 |
| 460 | nmdc:mga08y16_98172_c1 | 3300050511 | Bacteria | 3050 |
| 461 | nmdc:mga0rr50_25417_c1 | 3300050513 | Bacteria | 4116 |
| 462 | Ga0495601_0217606 | 3300053077 | Bacteria | 1247 |
| 463 | Ga0500635_0026635 | 3300053080 | Bacteria | 1831 |
| 464 | Ga0495619_0166203 | 3300053085 | Bacteria | 1525 |
| 465 | Ga0500578_0082463 | 3300053086 | Bacteria | 2044 |
| 466 | Ga0500578_0179326 | 3300053086 | Bacteria | 1306 |
| 467 | Ga0500566_0001520 | 3300053094 | Bacteria | 13619 |
| 468 | Ga0500566_0010357 | 3300053094 | Bacteria | 5498 |
| 469 | Ga0500566_0044344 | 3300053094 | Bacteria | 2562 |
| 470 | Ga0500640_000132 | 3300053095 | Bacteria | 14428 |
| 471 | Ga0500554_000048 | 3300053102 | Bacteria | 21032 |
| 472 | Ga0500572_001013 | 3300053111 | Bacteria | 8471 |
| 473 | Ga0500595_000261 | 3300053119 | Bacteria | 34894 |
| 474 | Ga0500597_040053 | 3300053120 | Bacteria | 1967 |
| 475 | Ga0500614_000201 | 3300053123 | Bacteria | 15680 |
| 476 | Ga0500614_002218 | 3300053123 | Bacteria | 4396 |
| 477 | Ga0500642_0179281 | 3300053130 | Bacteria | 990 |
| 478 | Ga0500559_0054190 | 3300053136 | Bacteria | 1776 |
| 479 | Ga0500568_0023365 | 3300053139 | Bacteria | 2630 |
| 480 | Ga0500603_003644 | 3300053150 | Bacteria | 3298 |
| 481 | Ga0500630_098248 | 3300053159 | Bacteria | 1339 |
| 482 | Ga0500638_061737 | 3300053162 | Bacteria | 1800 |
| 483 | Ga0500636_0106697 | 3300053177 | Bacteria | 1587 |
| 484 | Ga0501084_0000019 | 3300054114 | Bacteria | 146907 |
| 485 | Ga0501084_0455983 | 3300054114 | Bacteria | 1081 |
| 486 | Ga0501082_0000310 | 3300060353 | Bacteria | 43373 |
| 487 | Ga0501082_0010831 | 3300060353 | Bacteria | 7853 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0178397 | Ga0466961_0178397_24_653 | 209 |
| 2 | 3300025924 | Ga0207694_10605837 | Ga0207694_106058371 | 212 |
| 3 | 3300006871 | Ga0075434_100881464 | Ga0075434_1008814641 | 214 |
| 4 | 3300028800 | Ga0265338_10019190 | Ga0265338_100191902 | 214 |
| 5 | 3300031247 | Ga0265340_10125103 | Ga0265340_101251031 | 218 |
| 6 | 3300031249 | Ga0265339_10083737 | Ga0265339_100837372 | 218 |
| 7 | 3300031344 | Ga0265316_10290905 | Ga0265316_102909052 | 218 |
| 8 | 3300053094 | Ga0500566_0001520 | Ga0500566_0001520_1064_1765 | 218 |
| 9 | 3300053095 | Ga0500640_000132 | Ga0500640_000132_4649_5350 | 218 |
| 10 | 3300053102 | Ga0500554_000048 | Ga0500554_000048_19952_20653 | 218 |
| 11 | 3300053111 | Ga0500572_001013 | Ga0500572_001013_718_1419 | 218 |
| 12 | 3300053119 | Ga0500595_000261 | Ga0500595_000261_12673_13374 | 218 |
| 13 | 3300053123 | Ga0500614_000201 | Ga0500614_000201_13795_14496 | 218 |
| 14 | 3300053136 | Ga0500559_0054190 | Ga0500559_0054190_333_1034 | 218 |
| 15 | 3300009551 | Ga0105238_10006789 | Ga0105238_1000678911 | 219 |
| 16 | 3300013105 | Ga0157369_10249898 | Ga0157369_102498982 | 220 |
| 17 | 3300046557 | Ga0495622_0073664 | Ga0495622_0073664_42_743 | 221 |
| 18 | 3300053120 | Ga0500597_040053 | Ga0500597_040053_703_1404 | 221 |
| 19 | 3300053123 | Ga0500614_002218 | Ga0500614_002218_2824_3525 | 221 |
| 20 | 3300053162 | Ga0500638_061737 | Ga0500638_061737_748_1449 | 221 |
| 21 | 3300005345 | Ga0070692_10163335 | Ga0070692_101633352 | 222 |
| 22 | 3300005466 | Ga0070685_10202666 | Ga0070685_102026662 | 222 |
| 23 | 3300022467 | Ga0224712_10049172 | Ga0224712_100491722 | 222 |
| 24 | 3300044712 | Ga0453684_0005977 | Ga0453684_0005977_15855_16529 | 223 |
| 25 | 3300053086 | Ga0500578_0082463 | Ga0500578_0082463_762_1475 | 224 |
| 26 | 3300028556 | Ga0265337_1006140 | Ga0265337_10061403 | 225 |
| 27 | 3300028558 | Ga0265326_10020926 | Ga0265326_100209262 | 225 |
| 28 | 3300031235 | Ga0265330_10006976 | Ga0265330_100069765 | 225 |
| 29 | 3300031238 | Ga0265332_10029024 | Ga0265332_100290242 | 225 |
| 30 | 3300031241 | Ga0265325_10005683 | Ga0265325_100056836 | 225 |
| 31 | 3300031242 | Ga0265329_10031425 | Ga0265329_100314252 | 225 |
| 32 | 3300031247 | Ga0265340_10001095 | Ga0265340_1000109512 | 225 |
| 33 | 3300031250 | Ga0265331_10013904 | Ga0265331_100139046 | 225 |
| 34 | 3300031344 | Ga0265316_10014576 | Ga0265316_100145762 | 225 |
| 35 | 3300031711 | Ga0265314_10000007 | Ga0265314_10000007308 | 225 |
| 36 | 3300031712 | Ga0265342_10000775 | Ga0265342_1000077527 | 225 |
| 37 | 3300049570 | Ga0501033_0002913 | Ga0501033_0002913_9808_10560 | 227 |
| 38 | 3300049573 | Ga0501037_0023526 | Ga0501037_0023526_1235_1987 | 227 |
| 39 | 3300049574 | Ga0501038_0054779 | Ga0501038_0054779_2579_3331 | 227 |
| 40 | 3300049579 | Ga0501043_0581431 | Ga0501043_0581431_40_729 | 227 |
| 41 | 3300049580 | Ga0501046_0024137 | Ga0501046_0024137_1703_2455 | 227 |
| 42 | 3300049581 | Ga0501047_0064204 | Ga0501047_0064204_2339_3091 | 227 |
| 43 | 3300049582 | Ga0501048_0494167 | Ga0501048_0494167_37_789 | 227 |
| 44 | 3300049823 | Ga0501044_0130945 | Ga0501044_0130945_399_1151 | 227 |
| 45 | 3300048918 | Ga0496115_0229524 | Ga0496115_0229524_803_1513 | 228 |
| 46 | 3300013296 | Ga0157374_10541162 | Ga0157374_105411622 | 229 |
| 47 | 3300045976 | Ga0466967_0350881 | Ga0466967_0350881_615_1325 | 229 |
| 48 | 3300048907 | Ga0496104_0597061 | Ga0496104_0597061_98_808 | 229 |
| 49 | 3300048917 | Ga0496114_0010276 | Ga0496114_0010276_2063_2773 | 229 |
| 50 | 3300048918 | Ga0496115_0667309 | Ga0496115_0667309_59_769 | 229 |
| 51 | 3300005366 | Ga0070659_100030758 | Ga0070659_1000307583 | 230 |
| 52 | 3300005530 | Ga0070679_100052079 | Ga0070679_1000520793 | 230 |
| 53 | 3300005563 | Ga0068855_100105297 | Ga0068855_1001052974 | 230 |
| 54 | 3300005577 | Ga0068857_100118924 | Ga0068857_1001189243 | 230 |
| 55 | 3300009093 | Ga0105240_10001486 | Ga0105240_1000148627 | 230 |
| 56 | 3300009545 | Ga0105237_10000115 | Ga0105237_1000011534 | 230 |
| 57 | 3300025909 | Ga0207705_10037466 | Ga0207705_100374665 | 230 |
| 58 | 3300025913 | Ga0207695_10016341 | Ga0207695_100163417 | 230 |
| 59 | 3300025914 | Ga0207671_10000335 | Ga0207671_1000033516 | 230 |
| 60 | 3300025921 | Ga0207652_10002880 | Ga0207652_100028807 | 230 |
| 61 | 3300025932 | Ga0207690_10120669 | Ga0207690_101206692 | 230 |
| 62 | 3300026116 | Ga0207674_10134575 | Ga0207674_101345753 | 230 |
| 63 | 3300035115 | Ga0373941_0201442 | Ga0373941_0201442_27_722 | 230 |
| 64 | 3300046477 | Ga0495664_0053560 | Ga0495664_0053560_209_994 | 230 |
| 65 | 3300046516 | Ga0495628_0144207 | Ga0495628_0144207_698_1483 | 230 |
| 66 | 3300046526 | Ga0495666_0181865 | Ga0495666_0181865_35_820 | 230 |
| 67 | 3300046678 | Ga0495599_0200157 | Ga0495599_0200157_107_892 | 230 |
| 68 | 3300046680 | Ga0495646_0066029 | Ga0495646_0066029_1117_1902 | 230 |
| 69 | 3300046690 | Ga0495624_0211569 | Ga0495624_0211569_114_899 | 230 |
| 70 | 3300047319 | Ga0495674_0019183 | Ga0495674_0019183_563_1348 | 230 |
| 71 | 3300047444 | Ga0495675_0247358 | Ga0495675_0247358_251_1036 | 230 |
| 72 | 3300047471 | Ga0495684_0076848 | Ga0495684_0076848_1727_2512 | 230 |
| 73 | 3300048088 | Ga0495602_0284295 | Ga0495602_0284295_275_1060 | 230 |
| 74 | 3300005329 | Ga0070683_100051796 | Ga0070683_1000517963 | 231 |
| 75 | 3300005330 | Ga0070690_100031062 | Ga0070690_1000310622 | 231 |
| 76 | 3300005334 | Ga0068869_100048363 | Ga0068869_1000483632 | 231 |
| 77 | 3300005334 | Ga0068869_100069563 | Ga0068869_1000695634 | 231 |
| 78 | 3300005336 | Ga0070680_100245441 | Ga0070680_1002454412 | 231 |
| 79 | 3300005340 | Ga0070689_100050455 | Ga0070689_1000504552 | 231 |
| 80 | 3300005365 | Ga0070688_100052489 | Ga0070688_1000524892 | 231 |
| 81 | 3300005365 | Ga0070688_100289025 | Ga0070688_1002890252 | 231 |
| 82 | 3300005438 | Ga0070701_10271444 | Ga0070701_102714442 | 231 |
| 83 | 3300005456 | Ga0070678_100023296 | Ga0070678_1000232963 | 231 |
| 84 | 3300005530 | Ga0070679_100015171 | Ga0070679_1000151714 | 231 |
| 85 | 3300005530 | Ga0070679_100189877 | Ga0070679_1001898772 | 231 |
| 86 | 3300005530 | Ga0070679_100314037 | Ga0070679_1003140372 | 231 |
| 87 | 3300005535 | Ga0070684_100039273 | Ga0070684_1000392733 | 231 |
| 88 | 3300005545 | Ga0070695_100772026 | Ga0070695_1007720261 | 231 |
| 89 | 3300005614 | Ga0068856_100125716 | Ga0068856_1001257163 | 231 |
| 90 | 3300005840 | Ga0068870_10274930 | Ga0068870_102749302 | 231 |
| 91 | 3300005841 | Ga0068863_100010122 | Ga0068863_1000101226 | 231 |
| 92 | 3300005841 | Ga0068863_100297701 | Ga0068863_1002977012 | 231 |
| 93 | 3300009098 | Ga0105245_10000109 | Ga0105245_1000010971 | 231 |
| 94 | 3300009148 | Ga0105243_10049514 | Ga0105243_100495142 | 231 |
| 95 | 3300009177 | Ga0105248_11079515 | Ga0105248_110795152 | 231 |
| 96 | 3300009551 | Ga0105238_10617950 | Ga0105238_106179502 | 231 |
| 97 | 3300009553 | Ga0105249_10401187 | Ga0105249_104011872 | 231 |
| 98 | 3300013296 | Ga0157374_10002646 | Ga0157374_100026465 | 231 |
| 99 | 3300013297 | Ga0157378_10563574 | Ga0157378_105635741 | 231 |
| 100 | 3300021384 | Ga0213876_10050627 | Ga0213876_100506273 | 231 |
| 101 | 3300025917 | Ga0207660_10249195 | Ga0207660_102491952 | 231 |
| 102 | 3300025921 | Ga0207652_10042840 | Ga0207652_100428407 | 231 |
| 103 | 3300025921 | Ga0207652_10174508 | Ga0207652_101745082 | 231 |
| 104 | 3300025927 | Ga0207687_10000200 | Ga0207687_100002008 | 231 |
| 105 | 3300025927 | Ga0207687_10049756 | Ga0207687_100497563 | 231 |
| 106 | 3300025935 | Ga0207709_10027014 | Ga0207709_100270143 | 231 |
| 107 | 3300025942 | Ga0207689_10027979 | Ga0207689_100279792 | 231 |
| 108 | 3300025942 | Ga0207689_10040320 | Ga0207689_100403205 | 231 |
| 109 | 3300025944 | Ga0207661_10106562 | Ga0207661_101065622 | 231 |
| 110 | 3300025961 | Ga0207712_10024586 | Ga0207712_100245864 | 231 |
| 111 | 3300026078 | Ga0207702_10012515 | Ga0207702_100125157 | 231 |
| 112 | 3300026088 | Ga0207641_10015629 | Ga0207641_100156292 | 231 |
| 113 | 3300026088 | Ga0207641_10259602 | Ga0207641_102596022 | 231 |
| 114 | 3300026095 | Ga0207676_10252473 | Ga0207676_102524732 | 231 |
| 115 | 3300026118 | Ga0207675_100064816 | Ga0207675_1000648162 | 231 |
| 116 | 3300026121 | Ga0207683_10010642 | Ga0207683_100106428 | 231 |
| 117 | 3300028786 | Ga0307517_10170041 | Ga0307517_101700411 | 231 |
| 118 | 3300028794 | Ga0307515_10007588 | Ga0307515_100075882 | 231 |
| 119 | 3300031238 | Ga0265332_10007929 | Ga0265332_100079294 | 231 |
| 120 | 3300031507 | Ga0307509_10000069 | Ga0307509_10000069129 | 231 |
| 121 | 3300031507 | Ga0307509_10004839 | Ga0307509_100048397 | 231 |
| 122 | 3300031507 | Ga0307509_10079246 | Ga0307509_100792462 | 231 |
| 123 | 3300031507 | Ga0307509_10196251 | Ga0307509_101962512 | 231 |
| 124 | 3300031616 | Ga0307508_10015293 | Ga0307508_100152933 | 231 |
| 125 | 3300031730 | Ga0307516_10035646 | Ga0307516_100356462 | 231 |
| 126 | 3300031901 | Ga0307406_10082089 | Ga0307406_100820892 | 231 |
| 127 | 3300035090 | Ga0373949_0000056 | Ga0373949_0000056_40860_41561 | 231 |
| 128 | 3300035119 | Ga0373956_0054755 | Ga0373956_0054755_546_1247 | 231 |
| 129 | 3300035241 | Ga0373961_0000066 | Ga0373961_0000066_43541_44242 | 231 |
| 130 | 3300037312 | Ga0395899_0028166 | Ga0395899_0028166_825_1526 | 231 |
| 131 | 3300037418 | Ga0395900_0031896 | Ga0395900_0031896_1744_2445 | 231 |
| 132 | 3300037466 | Ga0395898_0070182 | Ga0395898_0070182_1519_2220 | 231 |
| 133 | 3300037471 | Ga0395905_0123093 | Ga0395905_0123093_1607_2308 | 231 |
| 134 | 3300037471 | Ga0395905_0142315 | Ga0395905_0142315_1236_1937 | 231 |
| 135 | 3300038443 | Ga0395901_0020968 | Ga0395901_0020968_5038_5739 | 231 |
| 136 | 3300039437 | Ga0436365_1092473 | Ga0436365_1092473_222_923 | 231 |
| 137 | 3300039437 | Ga0436365_1868030 | Ga0436365_1868030_2710_3411 | 231 |
| 138 | 3300045976 | Ga0466967_0620802 | Ga0466967_0620802_186_887 | 231 |
| 139 | 3300046694 | Ga0495649_0203207 | Ga0495649_0203207_144_845 | 231 |
| 140 | 3300048915 | Ga0496112_0675125 | Ga0496112_0675125_201_902 | 231 |
| 141 | 3300049581 | Ga0501047_0009416 | Ga0501047_0009416_2128_2829 | 231 |
| 142 | 3300049581 | Ga0501047_0342859 | Ga0501047_0342859_536_1237 | 231 |
| 143 | 3300049586 | Ga0501070_0032666 | Ga0501070_0032666_1258_1959 | 231 |
| 144 | 3300049593 | Ga0501077_0210129 | Ga0501077_0210129_327_1025 | 231 |
| 145 | 3300049822 | Ga0501035_0224935 | Ga0501035_0224935_350_1051 | 231 |
| 146 | 3300049823 | Ga0501044_0009718 | Ga0501044_0009718_5288_5989 | 231 |
| 147 | 3300049823 | Ga0501044_0293085 | Ga0501044_0293085_147_848 | 231 |
| 148 | 3300053080 | Ga0500635_0026635 | Ga0500635_0026635_943_1644 | 231 |
| 149 | 3300053086 | Ga0500578_0179326 | Ga0500578_0179326_165_866 | 231 |
| 150 | 3300053094 | Ga0500566_0010357 | Ga0500566_0010357_2508_3209 | 231 |
| 151 | 3300053094 | Ga0500566_0044344 | Ga0500566_0044344_1484_2185 | 231 |
| 152 | 3300053130 | Ga0500642_0179281 | Ga0500642_0179281_155_856 | 231 |
| 153 | 3300053139 | Ga0500568_0023365 | Ga0500568_0023365_1283_1984 | 231 |
| 154 | 3300053150 | Ga0500603_003644 | Ga0500603_003644_194_895 | 231 |
| 155 | 3300053159 | Ga0500630_098248 | Ga0500630_098248_375_1076 | 231 |
| 156 | 3300053177 | Ga0500636_0106697 | Ga0500636_0106697_314_1015 | 231 |
| 157 | 3300005467 | Ga0070706_100012807 | Ga0070706_1000128076 | 232 |
| 158 | 3300005471 | Ga0070698_100000144 | Ga0070698_1000001442 | 232 |
| 159 | 3300006844 | Ga0075428_100618915 | Ga0075428_1006189152 | 232 |
| 160 | 3300006880 | Ga0075429_100147562 | Ga0075429_1001475622 | 232 |
| 161 | 3300007076 | Ga0075435_100329425 | Ga0075435_1003294252 | 232 |
| 162 | 3300025910 | Ga0207684_10012901 | Ga0207684_100129014 | 232 |
| 163 | 3300025936 | Ga0207670_10066349 | Ga0207670_100663493 | 232 |
| 164 | 3300028800 | Ga0265338_10027120 | Ga0265338_100271202 | 232 |
| 165 | 3300044712 | Ga0453684_0517002 | Ga0453684_0517002_78_782 | 232 |
| 166 | 3300049660 | Ga0501216_001090 | Ga0501216_001090_1643_2347 | 232 |
| 167 | 3300049665 | Ga0501227_000190 | Ga0501227_000190_10684_11388 | 232 |
| 168 | 3300049667 | Ga0501230_018118 | Ga0501230_018118_55_759 | 232 |
| 169 | 3300049705 | Ga0501225_0019229 | Ga0501225_0019229_374_1078 | 232 |
| 170 | 3300050513 | nmdc:mga0rr50_25417_c1 | nmdc:mga0rr50_25417_c1_2939_3643 | 232 |
| 171 | 3300054114 | Ga0501084_0455983 | Ga0501084_0455983_255_959 | 232 |
| 172 | 3300006880 | Ga0075429_100052297 | Ga0075429_1000522973 | 233 |
| 173 | 3300014969 | Ga0157376_10206941 | Ga0157376_102069412 | 233 |
| 174 | 3300028379 | Ga0268266_10000954 | Ga0268266_1000095410 | 233 |
| 175 | 3300031456 | Ga0307513_10030051 | Ga0307513_100300517 | 233 |
| 176 | 3300035113 | Ga0373936_0000042 | Ga0373936_0000042_37089_37796 | 233 |
| 177 | 3300050508 | nmdc:mga09592_8432_c1 | nmdc:mga09592_8432_c1_5089_5796 | 233 |
| 178 | 3300005328 | Ga0070676_10004668 | Ga0070676_100046688 | 235 |
| 179 | 3300005329 | Ga0070683_100036195 | Ga0070683_1000361952 | 235 |
| 180 | 3300005329 | Ga0070683_100066433 | Ga0070683_1000664331 | 235 |
| 181 | 3300005329 | Ga0070683_100464787 | Ga0070683_1004647871 | 235 |
| 182 | 3300005330 | Ga0070690_100001477 | Ga0070690_1000014774 | 235 |
| 183 | 3300005335 | Ga0070666_10061823 | Ga0070666_100618232 | 235 |
| 184 | 3300005335 | Ga0070666_10063442 | Ga0070666_100634422 | 235 |
| 185 | 3300005339 | Ga0070660_100226979 | Ga0070660_1002269792 | 235 |
| 186 | 3300005340 | Ga0070689_100070432 | Ga0070689_1000704323 | 235 |
| 187 | 3300005340 | Ga0070689_100074759 | Ga0070689_1000747594 | 235 |
| 188 | 3300005343 | Ga0070687_100070819 | Ga0070687_1000708192 | 235 |
| 189 | 3300005343 | Ga0070687_100095303 | Ga0070687_1000953032 | 235 |
| 190 | 3300005347 | Ga0070668_100041969 | Ga0070668_1000419692 | 235 |
| 191 | 3300005353 | Ga0070669_100008655 | Ga0070669_1000086558 | 235 |
| 192 | 3300005354 | Ga0070675_100080824 | Ga0070675_1000808241 | 235 |
| 193 | 3300005356 | Ga0070674_100010856 | Ga0070674_1000108567 | 235 |
| 194 | 3300005364 | Ga0070673_100012835 | Ga0070673_1000128354 | 235 |
| 195 | 3300005364 | Ga0070673_100056597 | Ga0070673_1000565974 | 235 |
| 196 | 3300005365 | Ga0070688_100027164 | Ga0070688_1000271644 | 235 |
| 197 | 3300005365 | Ga0070688_100082053 | Ga0070688_1000820532 | 235 |
| 198 | 3300005365 | Ga0070688_100089134 | Ga0070688_1000891342 | 235 |
| 199 | 3300005367 | Ga0070667_100113928 | Ga0070667_1001139282 | 235 |
| 200 | 3300005367 | Ga0070667_100133589 | Ga0070667_1001335892 | 235 |
| 201 | 3300005439 | Ga0070711_100348720 | Ga0070711_1003487202 | 235 |
| 202 | 3300005444 | Ga0070694_100119947 | Ga0070694_1001199473 | 235 |
| 203 | 3300005456 | Ga0070678_100618337 | Ga0070678_1006183371 | 235 |
| 204 | 3300005459 | Ga0068867_100177916 | Ga0068867_1001779162 | 235 |
| 205 | 3300005466 | Ga0070685_10026282 | Ga0070685_100262822 | 235 |
| 206 | 3300005530 | Ga0070679_100009198 | Ga0070679_1000091985 | 235 |
| 207 | 3300005530 | Ga0070679_100367565 | Ga0070679_1003675652 | 235 |
| 208 | 3300005535 | Ga0070684_100001991 | Ga0070684_10000199110 | 235 |
| 209 | 3300005535 | Ga0070684_100164171 | Ga0070684_1001641712 | 235 |
| 210 | 3300005543 | Ga0070672_100015262 | Ga0070672_1000152625 | 235 |
| 211 | 3300005544 | Ga0070686_100003953 | Ga0070686_1000039537 | 235 |
| 212 | 3300005563 | Ga0068855_100067635 | Ga0068855_1000676356 | 235 |
| 213 | 3300005617 | Ga0068859_100627192 | Ga0068859_1006271922 | 235 |
| 214 | 3300005718 | Ga0068866_10008982 | Ga0068866_100089825 | 235 |
| 215 | 3300005719 | Ga0068861_100027708 | Ga0068861_1000277086 | 235 |
| 216 | 3300005841 | Ga0068863_100015699 | Ga0068863_1000156996 | 235 |
| 217 | 3300005842 | Ga0068858_100034376 | Ga0068858_1000343762 | 235 |
| 218 | 3300005844 | Ga0068862_100008469 | Ga0068862_1000084693 | 235 |
| 219 | 3300006237 | Ga0097621_100288595 | Ga0097621_1002885952 | 235 |
| 220 | 3300006881 | Ga0068865_100096241 | Ga0068865_1000962414 | 235 |
| 221 | 3300006881 | Ga0068865_100214092 | Ga0068865_1002140922 | 235 |
| 222 | 3300006931 | Ga0097620_100627201 | Ga0097620_1006272012 | 235 |
| 223 | 3300009093 | Ga0105240_10602786 | Ga0105240_106027861 | 235 |
| 224 | 3300009094 | Ga0111539_10043060 | Ga0111539_100430602 | 235 |
| 225 | 3300009148 | Ga0105243_10149997 | Ga0105243_101499972 | 235 |
| 226 | 3300009176 | Ga0105242_10097405 | Ga0105242_100974051 | 235 |
| 227 | 3300009553 | Ga0105249_10068884 | Ga0105249_100688844 | 235 |
| 228 | 3300013297 | Ga0157378_10509428 | Ga0157378_105094282 | 235 |
| 229 | 3300025315 | Ga0207697_10058353 | Ga0207697_100583532 | 235 |
| 230 | 3300025903 | Ga0207680_10055877 | Ga0207680_100558772 | 235 |
| 231 | 3300025903 | Ga0207680_10237142 | Ga0207680_102371422 | 235 |
| 232 | 3300025907 | Ga0207645_10003813 | Ga0207645_100038137 | 235 |
| 233 | 3300025915 | Ga0207693_10361401 | Ga0207693_103614011 | 235 |
| 234 | 3300025918 | Ga0207662_10011136 | Ga0207662_100111367 | 235 |
| 235 | 3300025918 | Ga0207662_10223276 | Ga0207662_102232762 | 235 |
| 236 | 3300025918 | Ga0207662_10243282 | Ga0207662_102432822 | 235 |
| 237 | 3300025921 | Ga0207652_10012196 | Ga0207652_100121965 | 235 |
| 238 | 3300025923 | Ga0207681_10001273 | Ga0207681_1000127310 | 235 |
| 239 | 3300025925 | Ga0207650_10204581 | Ga0207650_102045812 | 235 |
| 240 | 3300025926 | Ga0207659_10072931 | Ga0207659_100729311 | 235 |
| 241 | 3300025928 | Ga0207700_10543644 | Ga0207700_105436441 | 235 |
| 242 | 3300025936 | Ga0207670_10025785 | Ga0207670_100257854 | 235 |
| 243 | 3300025936 | Ga0207670_10096542 | Ga0207670_100965422 | 235 |
| 244 | 3300025937 | Ga0207669_10000958 | Ga0207669_100009587 | 235 |
| 245 | 3300025938 | Ga0207704_10165798 | Ga0207704_101657982 | 235 |
| 246 | 3300025940 | Ga0207691_10019235 | Ga0207691_100192356 | 235 |
| 247 | 3300025940 | Ga0207691_10035195 | Ga0207691_100351955 | 235 |
| 248 | 3300025940 | Ga0207691_10044092 | Ga0207691_100440922 | 235 |
| 249 | 3300025944 | Ga0207661_10046733 | Ga0207661_100467332 | 235 |
| 250 | 3300025944 | Ga0207661_10424910 | Ga0207661_104249102 | 235 |
| 251 | 3300025949 | Ga0207667_10208651 | Ga0207667_102086512 | 235 |
| 252 | 3300025960 | Ga0207651_10035716 | Ga0207651_100357162 | 235 |
| 253 | 3300025960 | Ga0207651_10036375 | Ga0207651_100363752 | 235 |
| 254 | 3300025960 | Ga0207651_10059968 | Ga0207651_100599684 | 235 |
| 255 | 3300026023 | Ga0207677_10087900 | Ga0207677_100879002 | 235 |
| 256 | 3300026075 | Ga0207708_10008699 | Ga0207708_100086992 | 235 |
| 257 | 3300026088 | Ga0207641_10061137 | Ga0207641_100611372 | 235 |
| 258 | 3300026089 | Ga0207648_10010133 | Ga0207648_100101333 | 235 |
| 259 | 3300026095 | Ga0207676_10215386 | Ga0207676_102153862 | 235 |
| 260 | 3300026118 | Ga0207675_100026721 | Ga0207675_1000267211 | 235 |
| 261 | 3300026121 | Ga0207683_10158806 | Ga0207683_101588062 | 235 |
| 262 | 3300028381 | Ga0268264_10153244 | Ga0268264_101532442 | 235 |
| 263 | 3300028558 | Ga0265326_10038909 | Ga0265326_100389092 | 235 |
| 264 | 3300028563 | Ga0265319_1020062 | Ga0265319_10200622 | 235 |
| 265 | 3300028577 | Ga0265318_10001419 | Ga0265318_1000141911 | 235 |
| 266 | 3300028666 | Ga0265336_10076622 | Ga0265336_100766221 | 235 |
| 267 | 3300028800 | Ga0265338_10050852 | Ga0265338_100508522 | 235 |
| 268 | 3300029957 | Ga0265324_10000399 | Ga0265324_1000039921 | 235 |
| 269 | 3300029957 | Ga0265324_10011568 | Ga0265324_100115684 | 235 |
| 270 | 3300031235 | Ga0265330_10011634 | Ga0265330_100116344 | 235 |
| 271 | 3300031235 | Ga0265330_10018337 | Ga0265330_100183374 | 235 |
| 272 | 3300031238 | Ga0265332_10001712 | Ga0265332_1000171210 | 235 |
| 273 | 3300031239 | Ga0265328_10000296 | Ga0265328_1000029618 | 235 |
| 274 | 3300031239 | Ga0265328_10001755 | Ga0265328_100017553 | 235 |
| 275 | 3300031240 | Ga0265320_10001464 | Ga0265320_100014647 | 235 |
| 276 | 3300031240 | Ga0265320_10023579 | Ga0265320_100235792 | 235 |
| 277 | 3300031241 | Ga0265325_10166197 | Ga0265325_101661971 | 235 |
| 278 | 3300031242 | Ga0265329_10008436 | Ga0265329_100084363 | 235 |
| 279 | 3300031249 | Ga0265339_10000022 | Ga0265339_1000002223 | 235 |
| 280 | 3300031249 | Ga0265339_10037532 | Ga0265339_100375322 | 235 |
| 281 | 3300031249 | Ga0265339_10042370 | Ga0265339_100423701 | 235 |
| 282 | 3300031250 | Ga0265331_10003525 | Ga0265331_100035259 | 235 |
| 283 | 3300031344 | Ga0265316_10002141 | Ga0265316_1000214114 | 235 |
| 284 | 3300031595 | Ga0265313_10025362 | Ga0265313_100253622 | 235 |
| 285 | 3300031595 | Ga0265313_10163159 | Ga0265313_101631592 | 235 |
| 286 | 3300031711 | Ga0265314_10002137 | Ga0265314_1000213716 | 235 |
| 287 | 3300031711 | Ga0265314_10002626 | Ga0265314_100026264 | 235 |
| 288 | 3300031711 | Ga0265314_10013100 | Ga0265314_100131009 | 235 |
| 289 | 3300031711 | Ga0265314_10025635 | Ga0265314_100256352 | 235 |
| 290 | 3300031712 | Ga0265342_10000326 | Ga0265342_100003269 | 235 |
| 291 | 3300031712 | Ga0265342_10000767 | Ga0265342_100007679 | 235 |
| 292 | 3300031712 | Ga0265342_10212156 | Ga0265342_102121561 | 235 |
| 293 | 3300031727 | Ga0316576_10031260 | Ga0316576_100312603 | 235 |
| 294 | 3300034818 | Ga0373950_0000081 | Ga0373950_0000081_1300_2016 | 235 |
| 295 | 3300035118 | Ga0373954_0061502 | Ga0373954_0061502_239_961 | 235 |
| 296 | 3300035119 | Ga0373956_0072468 | Ga0373956_0072468_21_731 | 235 |
| 297 | 3300035119 | Ga0373956_0269382 | Ga0373956_0269382_37_759 | 235 |
| 298 | 3300035170 | Ga0373943_0019089 | Ga0373943_0019089_108_818 | 235 |
| 299 | 3300035172 | Ga0373955_0008137 | Ga0373955_0008137_2225_2947 | 235 |
| 300 | 3300035172 | Ga0373955_0228959 | Ga0373955_0228959_279_1028 | 235 |
| 301 | 3300035692 | Ga0373935_0304139 | Ga0373935_0304139_43_759 | 235 |
| 302 | 3300035695 | Ga0373927_0096474 | Ga0373927_0096474_1112_1822 | 235 |
| 303 | 3300035724 | Ga0373933_0004826 | Ga0373933_0004826_2217_2933 | 235 |
| 304 | 3300035724 | Ga0373933_0010285 | Ga0373933_0010285_2837_3559 | 235 |
| 305 | 3300035724 | Ga0373933_0038590 | Ga0373933_0038590_1910_2620 | 235 |
| 306 | 3300036401 | Ga0373937_0003345 | Ga0373937_0003345_8613_9329 | 235 |
| 307 | 3300036401 | Ga0373937_0019601 | Ga0373937_0019601_2765_3487 | 235 |
| 308 | 3300036401 | Ga0373937_0155991 | Ga0373937_0155991_918_1628 | 235 |
| 309 | 3300036401 | Ga0373937_0215765 | Ga0373937_0215765_297_1007 | 235 |
| 310 | 3300037068 | Ga0373925_0072007 | Ga0373925_0072007_1622_2332 | 235 |
| 311 | 3300042876 | Ga0451577_0019679 | Ga0451577_0019679_3583_4293 | 235 |
| 312 | 3300044673 | Ga0453683_0249532 | Ga0453683_0249532_102_812 | 235 |
| 313 | 3300044712 | Ga0453684_0000207 | Ga0453684_0000207_109308_110018 | 235 |
| 314 | 3300044712 | Ga0453684_0156223 | Ga0453684_0156223_201_911 | 235 |
| 315 | 3300045051 | Ga0451576_0142071 | Ga0451576_0142071_412_1122 | 235 |
| 316 | 3300046557 | Ga0495622_0205242 | Ga0495622_0205242_49_804 | 235 |
| 317 | 3300047322 | Ga0495680_0146138 | Ga0495680_0146138_264_986 | 235 |
| 318 | 3300047471 | Ga0495684_0339992 | Ga0495684_0339992_129_839 | 235 |
| 319 | 3300047472 | Ga0495686_0017588 | Ga0495686_0017588_2761_3474 | 235 |
| 320 | 3300048903 | Ga0496100_0017774 | Ga0496100_0017774_2363_3073 | 235 |
| 321 | 3300048904 | Ga0496101_0075635 | Ga0496101_0075635_1391_2101 | 235 |
| 322 | 3300048904 | Ga0496101_0318084 | Ga0496101_0318084_53_763 | 235 |
| 323 | 3300048911 | Ga0496108_0019626 | Ga0496108_0019626_4400_5110 | 235 |
| 324 | 3300048911 | Ga0496108_0217729 | Ga0496108_0217729_76_786 | 235 |
| 325 | 3300048912 | Ga0496109_0114651 | Ga0496109_0114651_1774_2484 | 235 |
| 326 | 3300048915 | Ga0496112_0045530 | Ga0496112_0045530_3179_3889 | 235 |
| 327 | 3300048917 | Ga0496114_0004055 | Ga0496114_0004055_6800_7510 | 235 |
| 328 | 3300048917 | Ga0496114_0025451 | Ga0496114_0025451_3922_4638 | 235 |
| 329 | 3300048918 | Ga0496115_0040048 | Ga0496115_0040048_1453_2163 | 235 |
| 330 | 3300049571 | Ga0501034_0000009 | Ga0501034_0000009_323814_324530 | 235 |
| 331 | 3300049572 | Ga0501036_0012881 | Ga0501036_0012881_6077_6793 | 235 |
| 332 | 3300049572 | Ga0501036_0085235 | Ga0501036_0085235_1157_1873 | 235 |
| 333 | 3300049574 | Ga0501038_0112923 | Ga0501038_0112923_463_1179 | 235 |
| 334 | 3300049579 | Ga0501043_0000619 | Ga0501043_0000619_2774_3490 | 235 |
| 335 | 3300049580 | Ga0501046_0000219 | Ga0501046_0000219_6717_7433 | 235 |
| 336 | 3300049581 | Ga0501047_0000006 | Ga0501047_0000006_11289_12005 | 235 |
| 337 | 3300049582 | Ga0501048_0001853 | Ga0501048_0001853_11946_12662 | 235 |
| 338 | 3300049583 | Ga0501067_0027189 | Ga0501067_0027189_844_1554 | 235 |
| 339 | 3300049583 | Ga0501067_0153225 | Ga0501067_0153225_154_867 | 235 |
| 340 | 3300049584 | Ga0501068_0000309 | Ga0501068_0000309_17310_18026 | 235 |
| 341 | 3300049585 | Ga0501069_0110142 | Ga0501069_0110142_670_1383 | 235 |
| 342 | 3300049586 | Ga0501070_0001307 | Ga0501070_0001307_17899_18615 | 235 |
| 343 | 3300049586 | Ga0501070_0026399 | Ga0501070_0026399_4073_4786 | 235 |
| 344 | 3300049588 | Ga0501072_0000484 | Ga0501072_0000484_6798_7514 | 235 |
| 345 | 3300049589 | Ga0501073_0005718 | Ga0501073_0005718_6737_7453 | 235 |
| 346 | 3300049589 | Ga0501073_0024221 | Ga0501073_0024221_1071_1781 | 235 |
| 347 | 3300049590 | Ga0501074_0000426 | Ga0501074_0000426_3363_4079 | 235 |
| 348 | 3300049590 | Ga0501074_0161063 | Ga0501074_0161063_405_1118 | 235 |
| 349 | 3300049741 | Ga0501079_0000007 | Ga0501079_0000007_6743_7459 | 235 |
| 350 | 3300049742 | Ga0501080_0000465 | Ga0501080_0000465_18650_19366 | 235 |
| 351 | 3300049742 | Ga0501080_0256942 | Ga0501080_0256942_244_957 | 235 |
| 352 | 3300049743 | Ga0501081_0208353 | Ga0501081_0208353_106_819 | 235 |
| 353 | 3300049744 | Ga0501083_0000156 | Ga0501083_0000156_37954_38670 | 235 |
| 354 | 3300049744 | Ga0501083_0242506 | Ga0501083_0242506_86_799 | 235 |
| 355 | 3300050511 | nmdc:mga08y16_75053_c1 | nmdc:mga08y16_75053_c1_1194_1904 | 235 |
| 356 | 3300054114 | Ga0501084_0000019 | Ga0501084_0000019_11273_11989 | 235 |
| 357 | 3300060353 | Ga0501082_0000310 | Ga0501082_0000310_10537_11253 | 235 |
| 358 | 3300060353 | Ga0501082_0010831 | Ga0501082_0010831_5313_6026 | 235 |
| 359 | 3300005343 | Ga0070687_100028466 | Ga0070687_1000284664 | 236 |
| 360 | 3300005440 | Ga0070705_100422464 | Ga0070705_1004224642 | 236 |
| 361 | 3300005530 | Ga0070679_100002895 | Ga0070679_10000289512 | 236 |
| 362 | 3300005530 | Ga0070679_100211219 | Ga0070679_1002112193 | 236 |
| 363 | 3300005530 | Ga0070679_100292356 | Ga0070679_1002923562 | 236 |
| 364 | 3300005535 | Ga0070684_100081966 | Ga0070684_1000819662 | 236 |
| 365 | 3300005618 | Ga0068864_100272615 | Ga0068864_1002726152 | 236 |
| 366 | 3300005841 | Ga0068863_100432744 | Ga0068863_1004327442 | 236 |
| 367 | 3300014325 | Ga0163163_10042319 | Ga0163163_100423193 | 236 |
| 368 | 3300025912 | Ga0207707_10011043 | Ga0207707_100110436 | 236 |
| 369 | 3300025912 | Ga0207707_10020022 | Ga0207707_100200229 | 236 |
| 370 | 3300025912 | Ga0207707_10190338 | Ga0207707_101903382 | 236 |
| 371 | 3300025917 | Ga0207660_10141365 | Ga0207660_101413653 | 236 |
| 372 | 3300025918 | Ga0207662_10056880 | Ga0207662_100568803 | 236 |
| 373 | 3300025921 | Ga0207652_10002591 | Ga0207652_1000259112 | 236 |
| 374 | 3300025921 | Ga0207652_10184194 | Ga0207652_101841942 | 236 |
| 375 | 3300025944 | Ga0207661_10540108 | Ga0207661_105401082 | 236 |
| 376 | 3300026116 | Ga0207674_10055869 | Ga0207674_100558693 | 236 |
| 377 | 3300028653 | Ga0265323_10000856 | Ga0265323_1000085611 | 236 |
| 378 | 3300028800 | Ga0265338_10003344 | Ga0265338_1000334410 | 236 |
| 379 | 3300031235 | Ga0265330_10000007 | Ga0265330_1000000711 | 236 |
| 380 | 3300031235 | Ga0265330_10000497 | Ga0265330_1000049715 | 236 |
| 381 | 3300031235 | Ga0265330_10001390 | Ga0265330_100013909 | 236 |
| 382 | 3300031235 | Ga0265330_10012158 | Ga0265330_100121583 | 236 |
| 383 | 3300031235 | Ga0265330_10015498 | Ga0265330_100154982 | 236 |
| 384 | 3300031235 | Ga0265330_10038306 | Ga0265330_100383063 | 236 |
| 385 | 3300031238 | Ga0265332_10000296 | Ga0265332_1000029617 | 236 |
| 386 | 3300031238 | Ga0265332_10038003 | Ga0265332_100380032 | 236 |
| 387 | 3300031238 | Ga0265332_10040523 | Ga0265332_100405233 | 236 |
| 388 | 3300031240 | Ga0265320_10000041 | Ga0265320_100000418 | 236 |
| 389 | 3300031242 | Ga0265329_10000051 | Ga0265329_100000517 | 236 |
| 390 | 3300031249 | Ga0265339_10199739 | Ga0265339_101997392 | 236 |
| 391 | 3300031250 | Ga0265331_10000031 | Ga0265331_10000031166 | 236 |
| 392 | 3300031250 | Ga0265331_10005121 | Ga0265331_100051212 | 236 |
| 393 | 3300031344 | Ga0265316_10002089 | Ga0265316_100020899 | 236 |
| 394 | 3300031344 | Ga0265316_10002313 | Ga0265316_100023138 | 236 |
| 395 | 3300031344 | Ga0265316_10013418 | Ga0265316_100134181 | 236 |
| 396 | 3300031344 | Ga0265316_10013973 | Ga0265316_100139736 | 236 |
| 397 | 3300031344 | Ga0265316_10014565 | Ga0265316_100145657 | 236 |
| 398 | 3300031344 | Ga0265316_10018583 | Ga0265316_100185834 | 236 |
| 399 | 3300031344 | Ga0265316_10021198 | Ga0265316_100211983 | 236 |
| 400 | 3300031711 | Ga0265314_10000021 | Ga0265314_10000021165 | 236 |
| 401 | 3300031711 | Ga0265314_10062580 | Ga0265314_100625803 | 236 |
| 402 | 3300031712 | Ga0265342_10001955 | Ga0265342_100019554 | 236 |
| 403 | 3300031712 | Ga0265342_10002010 | Ga0265342_100020102 | 236 |
| 404 | 3300031712 | Ga0265342_10037841 | Ga0265342_100378411 | 236 |
| 405 | 3300031712 | Ga0265342_10060436 | Ga0265342_100604362 | 236 |
| 406 | 3300031712 | Ga0265342_10133516 | Ga0265342_101335162 | 236 |
| 407 | 3300034818 | Ga0373950_0000004 | Ga0373950_0000004_313731_314450 | 236 |
| 408 | 3300037068 | Ga0373925_0204994 | Ga0373925_0204994_267_980 | 236 |
| 409 | 3300044712 | Ga0453684_0236755 | Ga0453684_0236755_1373_2086 | 236 |
| 410 | 3300045051 | Ga0451576_0009466 | Ga0451576_0009466_2568_3281 | 236 |
| 411 | 3300046462 | Ga0495651_0069629 | Ga0495651_0069629_189_902 | 236 |
| 412 | 3300048088 | Ga0495602_0123906 | Ga0495602_0123906_250_963 | 236 |
| 413 | 3300049583 | Ga0501067_0000571 | Ga0501067_0000571_14852_15571 | 236 |
| 414 | 3300049589 | Ga0501073_0007032 | Ga0501073_0007032_5568_6287 | 236 |
| 415 | 3300005549 | Ga0070704_100083079 | Ga0070704_1000830792 | 237 |
| 416 | 3300005615 | Ga0070702_100234540 | Ga0070702_1002345401 | 237 |
| 417 | 3300028653 | Ga0265323_10002119 | Ga0265323_1000211911 | 237 |
| 418 | 3300028654 | Ga0265322_10000306 | Ga0265322_100003064 | 237 |
| 419 | 3300028654 | Ga0265322_10042636 | Ga0265322_100426361 | 237 |
| 420 | 3300028800 | Ga0265338_10000365 | Ga0265338_1000036562 | 237 |
| 421 | 3300029957 | Ga0265324_10055559 | Ga0265324_100555591 | 237 |
| 422 | 3300031595 | Ga0265313_10057987 | Ga0265313_100579873 | 237 |
| 423 | 3300039447 | Ga0436361_0092287 | Ga0436361_0092287_1501_2217 | 237 |
| 424 | 3300045051 | Ga0451576_0030211 | Ga0451576_0030211_3267_3983 | 237 |
| 425 | 3300009094 | Ga0111539_10104133 | Ga0111539_101041332 | 238 |
| 426 | 3300035120 | Ga0373957_0008584 | Ga0373957_0008584_1961_2704 | 238 |
| 427 | 3300035171 | Ga0373946_0077446 | Ga0373946_0077446_301_1023 | 238 |
| 428 | 3300044658 | Ga0466972_0127301 | Ga0466972_0127301_424_1182 | 238 |
| 429 | 3300046516 | Ga0495628_0014918 | Ga0495628_0014918_4199_4921 | 238 |
| 430 | 3300046517 | Ga0495630_0017876 | Ga0495630_0017876_2683_3405 | 238 |
| 431 | 3300046529 | Ga0495652_0486706 | Ga0495652_0486706_40_762 | 238 |
| 432 | 3300046535 | Ga0495586_0135066 | Ga0495586_0135066_181_903 | 238 |
| 433 | 3300046642 | Ga0495634_0002690 | Ga0495634_0002690_9184_9906 | 238 |
| 434 | 3300047319 | Ga0495674_0018164 | Ga0495674_0018164_4928_5650 | 238 |
| 435 | 3300047472 | Ga0495686_0063522 | Ga0495686_0063522_1088_1810 | 238 |
| 436 | 3300050511 | nmdc:mga08y16_98172_c1 | nmdc:mga08y16_98172_c1_2054_2779 | 238 |
| 437 | 3300053077 | Ga0495601_0217606 | Ga0495601_0217606_424_1146 | 238 |
| 438 | 3300006880 | Ga0075429_100094918 | Ga0075429_1000949185 | 239 |
| 439 | 3300028666 | Ga0265336_10026341 | Ga0265336_100263412 | 239 |
| 440 | 3300028800 | Ga0265338_10095923 | Ga0265338_100959232 | 239 |
| 441 | 3300035086 | Ga0373934_0076101 | Ga0373934_0076101_333_1061 | 239 |
| 442 | 3300035119 | Ga0373956_0008746 | Ga0373956_0008746_1750_2478 | 239 |
| 443 | 3300035120 | Ga0373957_0187319 | Ga0373957_0187319_80_808 | 239 |
| 444 | 3300035172 | Ga0373955_0002906 | Ga0373955_0002906_5622_6350 | 239 |
| 445 | 3300036401 | Ga0373937_0011770 | Ga0373937_0011770_5309_6037 | 239 |
| 446 | 3300048910 | Ga0496107_0234445 | Ga0496107_0234445_351_1079 | 239 |
| 447 | 3300048917 | Ga0496114_0002135 | Ga0496114_0002135_1359_2087 | 239 |
| 448 | 3300048918 | Ga0496115_0145915 | Ga0496115_0145915_582_1310 | 239 |
| 449 | 3300049589 | Ga0501073_0000104 | Ga0501073_0000104_19892_20620 | 239 |
| 450 | 3300050508 | nmdc:mga09592_76988_c1 | nmdc:mga09592_76988_c1_1514_2254 | 239 |
| 451 | 3300053085 | Ga0495619_0166203 | Ga0495619_0166203_100_828 | 239 |
| 452 | 3300003323 | rootH1_10075755 | rootH1_100757552 | 240 |
| 453 | 3300006846 | Ga0075430_100536250 | Ga0075430_1005362502 | 240 |
| 454 | 3300009545 | Ga0105237_10046527 | Ga0105237_100465272 | 240 |
| 455 | 3300025914 | Ga0207671_10262577 | Ga0207671_102625772 | 240 |
| 456 | 3300050509 | nmdc:mga0qj67_479498_c1 | nmdc:mga0qj67_479498_c1_87_830 | 240 |
| 457 | 3300028558 | Ga0265326_10006285 | Ga0265326_100062852 | 241 |
| 458 | 3300028573 | Ga0265334_10038483 | Ga0265334_100384832 | 241 |
| 459 | 3300028653 | Ga0265323_10000309 | Ga0265323_1000030913 | 241 |
| 460 | 3300028653 | Ga0265323_10011886 | Ga0265323_100118862 | 241 |
| 461 | 3300028653 | Ga0265323_10032084 | Ga0265323_100320842 | 241 |
| 462 | 3300028653 | Ga0265323_10044594 | Ga0265323_100445942 | 241 |
| 463 | 3300028654 | Ga0265322_10011846 | Ga0265322_100118463 | 241 |
| 464 | 3300028800 | Ga0265338_10074368 | Ga0265338_100743682 | 241 |
| 465 | 3300031242 | Ga0265329_10000426 | Ga0265329_1000042614 | 241 |
| 466 | 3300031344 | Ga0265316_10000322 | Ga0265316_100003228 | 241 |
| 467 | 3300031712 | Ga0265342_10001432 | Ga0265342_1000143214 | 241 |
| 468 | 3300031712 | Ga0265342_10003656 | Ga0265342_100036569 | 241 |
| 469 | 3300045051 | Ga0451576_0184109 | Ga0451576_0184109_1147_1881 | 241 |
| 470 | 3300028800 | Ga0265338_10084297 | Ga0265338_100842974 | 242 |
| 471 | 3300044765 | Ga0466970_0119378 | Ga0466970_0119378_71_844 | 243 |
| 472 | 3300028653 | Ga0265323_10024683 | Ga0265323_100246832 | 248 |
| 473 | 3300031235 | Ga0265330_10003461 | Ga0265330_100034612 | 248 |
| 474 | 3300044712 | Ga0453684_0066776 | Ga0453684_0066776_1362_2111 | 249 |
| 475 | 3300046501 | Ga0495607_0006472 | Ga0495607_0006472_3040_3804 | 249 |
| 476 | iso_pu_bacteria | 2786546940 | 2788436003 | 249 |
| 477 | 3300028563 | Ga0265319_1008826 | Ga0265319_10088262 | 250 |
| 478 | 3300031240 | Ga0265320_10009297 | Ga0265320_100092975 | 250 |
| 479 | 3300031595 | Ga0265313_10001453 | Ga0265313_1000145316 | 250 |
| 480 | 3300049744 | Ga0501083_0001072 | Ga0501083_0001072_9571_10323 | 250 |
| 481 | 3300042876 | Ga0451577_0077231 | Ga0451577_0077231_279_1064 | 252 |
| 482 | 3300044712 | Ga0453684_0000001 | Ga0453684_0000001_1570889_1571674 | 252 |
| 483 | 3300044712 | Ga0453684_0398683 | Ga0453684_0398683_330_1088 | 252 |
| 484 | 3300003323 | rootH1_10025820 | rootH1_100258201 | 253 |
| 485 | 3300026078 | Ga0207702_10001021 | Ga0207702_100010217 | 253 |
| 486 | 3300026116 | Ga0207674_10162463 | Ga0207674_101624632 | 253 |
| 487 | 3300044719 | Ga0466971_0033067 | Ga0466971_0033067_542_1303 | 253 |
| 488 | 3300045976 | Ga0466967_0009904 | Ga0466967_0009904_5743_6504 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1udn-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph from aquifex aeolicus | 0.9678 | 7 | 240 |
| 1oyr-assembly1.cif.gz_C | crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis | 0.9675 | 7 | 244 |
| 1r6l-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph from pseudomonas aeruginosa | 0.9673 | 6 | 244 |
| 1udo-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph r86a mutant from aquifex aeolicus | 0.9672 | 7 | 241 |
| 1uds-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph r126a mutant from aquifex aeolicus | 0.9664 | 7 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dd6A01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9585 | 18 | 244 | 3.30.230.70 |
| 1oysA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9537 | 18 | 242 | 3.30.230.70 |
| 1oysA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9445 | 18 | 242 | 3.30.230.70 |
| 2wnrF01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.938 | 15 | 245 | 3.30.230.70 |
| 3dd6A01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9264 | 18 | 244 | 3.30.230.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836W3E1-F1-model_v4 | Ribonuclease PH | 0.9939 | 124 | 231 |
GO:0000049
GO:0008033 GO:0009022 GO:0016075 |
| AF-A0A4U9HE90-F1-model_v4 | Ribonuclease PH (EC 2.7.7.56) | 0.9902 | 126 | 243 |
GO:0000049
GO:0008033 GO:0009022 GO:0016075 |
| AF-A0A074TXN7-F1-model_v4 | deleted | 0.9901 | 129 | 226 |
|
| AF-A0A519CLY9-F1-model_v4 | Ribonuclease PH | 0.9901 | 167 | 243 |
|
| AF-A0A356UAB4-F1-model_v4 | Ribonuclease PH | 0.99 | 124 | 243 |
GO:0000049
GO:0006364 GO:0008033 GO:0009022 GO:0016075 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar